F459426

General Info

Members Datasets Scaffolds Average Seq Length
526 311 1052 292

Family's Representative Sequence

Representative Sequence 3300031733|Ga0316577_10018703|Ga0316577_100187033
Length 318
Sequence MDHIFFQIVIFKKSRDREGHHSNSYGAYRRAAMNQTHFHGVFPYLVSPVHESGEVNADVLARLCDDLIKAGVHGLTPLGSTGEFAYLTWPQRRRVVEVVVDAAKGRVPVVAGVASTTIVDAVFQAREFASLGCSGILAILDAYFPVPDEGVFAYFKAIAEAVSIPIVLYTNPNFQRSDLSLAVIDRLSRIPNIGYIKDASFNTGRLLSIINRVEGRMQVFAASAHIPACVMLIGGIGWMAGPACVAPKQSVELYELCRRGDWVTAMKRQRPLWNLNRAFARYNLAACIKGGLQLQGYPVGAPLGVEEVRRALVAIGAL

Samples

Sample ID Description Type Environment
1 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
152 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
156 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
157 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
158 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
159 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
160 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
161 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
165 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
166 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
179 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
180 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
182 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
184 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
185 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
186 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
187 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
224 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
225 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
226 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
245 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
283 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
284 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
285 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
289 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
290 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
291 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
292 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
293 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
294 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
295 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
296 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
297 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
298 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
303 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
306 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
307 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
308 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.19
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 0
Rhizoplane 6.65
Rhizosphere 89.73
Stem 0
Stem Tuber 0
Unclassified 4.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316577_10018703 3300031733 Bacteria 3832
2 JGI24743J22301_10002075 3300001991 Bacteria 2951
3 JGI24738J21930_10002534 3300002075 Bacteria 4744
4 JGI24744J21845_10006139 3300002077 Bacteria 2491
5 JGI24034J26672_10003527 3300002239 Unclassified 2184
6 JGI24034J26672_10012004 3300002239 Bacteria 1302
7 JGI24742J22300_10008726 3300002244 Unclassified 1670
8 JGI24751J29686_10007557 3300002459 Unclassified 2221
9 Ga0070658_10036384 3300005327 Bacteria 3968
10 Ga0070690_100005061 3300005330 Bacteria 7389
11 Ga0070690_100134828 3300005330 Bacteria 1671
12 Ga0070670_100006158 3300005331 Bacteria 10142
13 Ga0070670_100010575 3300005331 Bacteria 7880
14 Ga0070670_100160244 3300005331 Bacteria 1950
15 Ga0070677_10017133 3300005333 Unclassified 2589
16 Ga0070680_100153532 3300005336 Bacteria 1934
17 Ga0070680_100189666 3300005336 Bacteria 1732
18 Ga0070680_100265480 3300005336 Bacteria 1453
19 Ga0070682_100024264 3300005337 Bacteria 3607
20 Ga0068868_100007673 3300005338 Bacteria 7697
21 Ga0070660_100096932 3300005339 Unclassified 2333
22 Ga0070689_100370864 3300005340 Bacteria 1204
23 Ga0070687_100001516 3300005343 Bacteria 8210
24 Ga0070661_100115200 3300005344 Bacteria 2010
25 Ga0070692_10008203 3300005345 Bacteria 4648
26 Ga0070668_100178688 3300005347 Bacteria 1732
27 Ga0070675_100007115 3300005354 Bacteria 8615
28 Ga0070674_100091464 3300005356 Unclassified 2197
29 Ga0070673_100571561 3300005364 Bacteria 1029
30 Ga0070688_100054492 3300005365 Bacteria 2505
31 Ga0070659_100078812 3300005366 Bacteria 2629
32 Ga0070659_100246097 3300005366 Bacteria 1481
33 Ga0070667_100014530 3300005367 Bacteria 6505
34 Ga0070667_100489096 3300005367 Bacteria 1127
35 Ga0070714_100276653 3300005435 Bacteria 1558
36 Ga0070713_100024947 3300005436 Bacteria 4666
37 Ga0070713_100136160 3300005436 Bacteria 2171
38 Ga0070710_10009746 3300005437 Bacteria 4706
39 Ga0070705_100056356 3300005440 Bacteria 2314
40 Ga0070705_100130433 3300005440 Bacteria 1639
41 Ga0070700_100047027 3300005441 Unclassified 2669
42 Ga0070663_100072264 3300005455 Bacteria 2512
43 Ga0070663_100280003 3300005455 Bacteria 1329
44 Ga0070663_100503419 3300005455 Bacteria 1006
45 Ga0070678_100013490 3300005456 Bacteria 5126
46 Ga0070662_100056377 3300005457 Unclassified 2853
47 Ga0070681_10124205 3300005458 Bacteria 2514
48 Ga0070707_100084455 3300005468 Bacteria 3068
49 Ga0070699_100221017 3300005518 Bacteria 1688
50 Ga0070679_100218676 3300005530 Bacteria 1867
51 Ga0068853_100110935 3300005539 Unclassified 2437
52 Ga0070672_100005396 3300005543 Bacteria 8467
53 Ga0070695_100155477 3300005545 Bacteria 1600
54 Ga0070696_100049488 3300005546 Bacteria 2919
55 Ga0070693_100105125 3300005547 Bacteria 1727
56 Ga0070704_100341138 3300005549 Bacteria 1261
57 Ga0068855_100012239 3300005563 Bacteria 10369
58 Ga0068855_100013776 3300005563 Bacteria 9747
59 Ga0070664_100050621 3300005564 Bacteria 3516
60 Ga0070664_100080026 3300005564 Bacteria 2814
61 Ga0068857_100095705 3300005577 Bacteria 2661
62 Ga0068854_100053539 3300005578 Bacteria 2899
63 Ga0068856_100420646 3300005614 Bacteria 1356
64 Ga0068856_100500132 3300005614 Bacteria 1236
65 Ga0070702_100061201 3300005615 Bacteria 2191
66 Ga0068852_100002168 3300005616 Bacteria 13456
67 Ga0068852_100209723 3300005616 Bacteria 1847
68 Ga0068864_100311810 3300005618 Bacteria 1475
69 Ga0068866_10007081 3300005718 Bacteria 4688
70 Ga0068870_10013351 3300005840 Bacteria 3858
71 Ga0068863_100114795 3300005841 Bacteria 2565
72 Ga0068858_100261653 3300005842 Bacteria 1644
73 Ga0068862_100080844 3300005844 Bacteria 2819
74 Ga0081540_1017777 3300005983 Bacteria 4390
75 Ga0081539_10048291 3300005985 Bacteria 2422
76 Ga0070717_10252726 3300006028 Bacteria 1558
77 Ga0075365_10085206 3300006038 Bacteria 2146
78 Ga0070715_10147698 3300006163 Bacteria 1148
79 Ga0070712_100015300 3300006175 Bacteria 4936
80 Ga0070712_100068370 3300006175 Bacteria 2531
81 Ga0075367_10090665 3300006178 Bacteria 1859
82 Ga0068871_100007976 3300006358 Bacteria 7597
83 Ga0075428_100028442 3300006844 Bacteria 6185
84 Ga0075434_100078419 3300006871 Bacteria 3299
85 Ga0075429_100280839 3300006880 Bacteria 1458
86 Ga0068865_100019455 3300006881 Bacteria 4394
87 Ga0068865_100267251 3300006881 Bacteria 1357
88 Ga0075436_100108473 3300006914 Bacteria 1937
89 Ga0105240_10031165 3300009093 Bacteria 6919
90 Ga0111539_10006159 3300009094 Bacteria 15484
91 Ga0105245_10169553 3300009098 Bacteria 2078
92 Ga0105247_10017144 3300009101 Bacteria 4347
93 Ga0114129_10208000 3300009147 Bacteria 2647
94 Ga0105243_10034455 3300009148 Bacteria 3920
95 Ga0105241_10788702 3300009174 Bacteria 874
96 Ga0105242_10012315 3300009176 Bacteria 6582
97 Ga0105248_10087226 3300009177 Bacteria 3512
98 Ga0105248_10212660 3300009177 Bacteria 2179
99 Ga0105237_10675676 3300009545 Bacteria 1039
100 Ga0105238_10019721 3300009551 Bacteria 6867
101 Ga0105238_10142794 3300009551 Bacteria 2371
102 Ga0105238_10213334 3300009551 Bacteria 1907
103 Ga0105239_10148006 3300010375 Bacteria 2620
104 Ga0105246_10081212 3300011119 Bacteria 2310
105 Ga0105246_10382141 3300011119 Unclassified 1164
106 Ga0157371_10054602 3300013102 Bacteria 2837
107 Ga0157370_10156941 3300013104 Bacteria 2117
108 Ga0157370_10205849 3300013104 Bacteria 1824
109 Ga0157369_10041952 3300013105 Bacteria 4993
110 Ga0157369_10262995 3300013105 Bacteria 1799
111 Ga0157369_10393842 3300013105 Bacteria 1437
112 Ga0157378_10010734 3300013297 Bacteria 8007
113 Ga0163162_10031215 3300013306 Bacteria 5284
114 Ga0157372_10222655 3300013307 Bacteria 2187
115 Ga0157375_10232404 3300013308 Bacteria 2003
116 Ga0157375_10323012 3300013308 Unclassified 1708
117 Ga0163163_10008580 3300014325 Bacteria 9086
118 Ga0163163_10011643 3300014325 Bacteria 7990
119 Ga0157377_10002286 3300014745 Bacteria 8424
120 Ga0157379_10008682 3300014968 Bacteria 8850
121 Ga0157379_10043206 3300014968 Bacteria 4023
122 Ga0157379_10102950 3300014968 Bacteria 2562
123 Ga0157376_10086107 3300014969 Bacteria 2709
124 Ga0163161_10029657 3300017792 Bacteria 3889
125 Ga0206353_11134490 3300020082 Bacteria 1438
126 Ga0213876_10008281 3300021384 Bacteria 5626
127 Ga0213876_10012420 3300021384 Bacteria 4534
128 Ga0207697_10106190 3300025315 Unclassified 1200
129 Ga0207692_10036383 3300025898 Unclassified 2400
130 Ga0207688_10000305 3300025901 Bacteria 22568
131 Ga0207680_10176736 3300025903 Bacteria 1441
132 Ga0207699_10065733 3300025906 Bacteria 2200
133 Ga0207645_10009122 3300025907 Bacteria 6880
134 Ga0207645_10088838 3300025907 Bacteria 1987
135 Ga0207643_10048021 3300025908 Bacteria 2417
136 Ga0207707_10067743 3300025912 Bacteria 3109
137 Ga0207707_10191138 3300025912 Bacteria 1786
138 Ga0207695_10161926 3300025913 Bacteria 2168
139 Ga0207693_10011263 3300025915 Bacteria 7240
140 Ga0207693_10130204 3300025915 Bacteria 1978
141 Ga0207660_10166523 3300025917 Bacteria 1704
142 Ga0207660_10267771 3300025917 Bacteria 1353
143 Ga0207657_10011510 3300025919 Bacteria 8783
144 Ga0207657_10029851 3300025919 Bacteria 4956
145 Ga0207657_10494587 3300025919 Bacteria 958
146 Ga0207649_10051944 3300025920 Bacteria 2541
147 Ga0207649_10128391 3300025920 Bacteria 1719
148 Ga0207652_10036670 3300025921 Bacteria 4146
149 Ga0207694_10029171 3300025924 Bacteria 4208
150 Ga0207694_10124541 3300025924 Bacteria 2060
151 Ga0207650_10046348 3300025925 Bacteria 3201
152 Ga0207650_10053591 3300025925 Bacteria 2990
153 Ga0207659_10119543 3300025926 Bacteria 2017
154 Ga0207700_10131724 3300025928 Bacteria 2042
155 Ga0207700_10135494 3300025928 Bacteria 2017
156 Ga0207664_10192186 3300025929 Bacteria 1758
157 Ga0207664_10234038 3300025929 Bacteria 1597
158 Ga0207664_10460904 3300025929 Bacteria 1135
159 Ga0207644_10014574 3300025931 Bacteria 5262
160 Ga0207690_10412661 3300025932 Bacteria 1079
161 Ga0207690_10429141 3300025932 Bacteria 1059
162 Ga0207706_10001680 3300025933 Bacteria 21847
163 Ga0207706_10018709 3300025933 Bacteria 6231
164 Ga0207686_10088002 3300025934 Bacteria 2044
165 Ga0207670_10076137 3300025936 Unclassified 2334
166 Ga0207691_10010064 3300025940 Bacteria 9077
167 Ga0207711_10172979 3300025941 Bacteria 1961
168 Ga0207689_10003094 3300025942 Bacteria 15306
169 Ga0207689_10081459 3300025942 Bacteria 2660
170 Ga0207661_10553946 3300025944 Bacteria 1053
171 Ga0207679_10031610 3300025945 Bacteria 3707
172 Ga0207679_10318052 3300025945 Bacteria 1347
173 Ga0207667_10005244 3300025949 Bacteria 15813
174 Ga0207667_10012846 3300025949 Bacteria 9622
175 Ga0207651_10005051 3300025960 Bacteria 6730
176 Ga0207651_10037003 3300025960 Bacteria 3193
177 Ga0207712_10007315 3300025961 Bacteria 6968
178 Ga0207668_10042698 3300025972 Bacteria 3072
179 Ga0207658_10025036 3300025986 Bacteria 4177
180 Ga0207677_10003335 3300026023 Bacteria 8498
181 Ga0207703_10106460 3300026035 Bacteria 2385
182 Ga0207639_10101054 3300026041 Unclassified 2331
183 Ga0207678_10042281 3300026067 Bacteria 3949
184 Ga0207678_10082739 3300026067 Bacteria 2746
185 Ga0207678_10134866 3300026067 Bacteria 2107
186 Ga0207708_10000855 3300026075 Bacteria 22926
187 Ga0207702_10036593 3300026078 Bacteria 4107
188 Ga0207648_10023824 3300026089 Bacteria 5475
189 Ga0207676_10362202 3300026095 Bacteria 1344
190 Ga0207674_10084194 3300026116 Bacteria 3179
191 Ga0207675_100002171 3300026118 Bacteria 19502
192 Ga0207683_10096868 3300026121 Unclassified 2630
193 Ga0207698_10015351 3300026142 Bacteria 5126
194 Ga0209999_1001876 3300027543 Bacteria 3652
195 Ga0210002_1004358 3300027617 Bacteria 2105
196 Ga0209966_1002045 3300027695 Bacteria 3368
197 Ga0209998_10027171 3300027717 Bacteria 1253
198 Ga0268265_10088007 3300028380 Bacteria 2473
199 Ga0265338_10103004 3300028800 Bacteria 2320
200 Ga0265338_10173091 3300028800 Bacteria 1653
201 Ga0265330_10031350 3300031235 Bacteria 2383
202 Ga0265325_10037369 3300031241 Bacteria 2566
203 Ga0265325_10065939 3300031241 Bacteria 1827
204 Ga0265329_10027207 3300031242 Bacteria 1881
205 Ga0265331_10006164 3300031250 Bacteria 7122
206 Ga0265316_10077513 3300031344 Bacteria 2553
207 Ga0265313_10025558 3300031595 Bacteria 3125
208 Ga0265313_10153139 3300031595 Bacteria 984
209 Ga0316575_10000082 3300031665 Bacteria 22890
210 Ga0316575_10004744 3300031665 Bacteria 4796
211 Ga0316575_10057448 3300031665 Bacteria 1551
212 Ga0316579_10000015 3300031691 Bacteria 39681
213 Ga0316579_10000245 3300031691 Bacteria 16618
214 Ga0316579_10154508 3300031691 Bacteria 1108
215 Ga0265314_10001133 3300031711 Bacteria 30864
216 Ga0265314_10002100 3300031711 Bacteria 20973
217 Ga0265342_10000196 3300031712 Bacteria 67364
218 Ga0316576_10070351 3300031727 Bacteria 2581
219 Ga0316576_10221771 3300031727 Bacteria 1422
220 Ga0316576_10396989 3300031727 Bacteria 1022
221 Ga0316578_10005745 3300031728 Bacteria 6051
222 Ga0316578_10123681 3300031728 Bacteria 1556
223 Ga0316578_10309155 3300031728 Unclassified 944
224 Ga0316577_10072289 3300031733 Bacteria 1925
225 Ga0307410_10299762 3300031852 Bacteria 1268
226 Ga0307416_100030693 3300032002 Bacteria 4036
227 Ga0316583_10000483 3300032133 Bacteria 11841
228 Ga0316583_10000835 3300032133 Bacteria 9809
229 Ga0316583_10007765 3300032133 Bacteria 3869
230 Ga0316585_10008292 3300032137 Bacteria 3012
231 Ga0316580_10038793 3300032139 Bacteria 1472
232 Ga0373926_0003395 3300035083 Bacteria 5131
233 Ga0373934_0000044 3300035086 Bacteria 41857
234 Ga0373936_0000601 3300035113 Bacteria 12463
235 Ga0373945_0016300 3300035116 Bacteria 2504
236 Ga0373953_0003022 3300035117 Bacteria 5153
237 Ga0373953_0013910 3300035117 Bacteria 2884
238 Ga0373953_0033810 3300035117 Bacteria 2001
239 Ga0373954_0000805 3300035118 Bacteria 12122
240 Ga0373954_0012950 3300035118 Bacteria 3714
241 Ga0373954_0015076 3300035118 Bacteria 3452
242 Ga0373954_0059775 3300035118 Bacteria 1797
243 Ga0373954_0064480 3300035118 Bacteria 1732
244 Ga0373956_0002849 3300035119 Bacteria 6998
245 Ga0373956_0020453 3300035119 Bacteria 2817
246 Ga0373956_0023536 3300035119 Bacteria 2644
247 Ga0373957_0001310 3300035120 Bacteria 6684
248 Ga0373957_0004597 3300035120 Bacteria 4210
249 Ga0373957_0007834 3300035120 Bacteria 3432
250 Ga0373943_0016851 3300035170 Bacteria 3338
251 Ga0373943_0154984 3300035170 Bacteria 1243
252 Ga0373946_0017665 3300035171 Bacteria 2732
253 Ga0373955_0000470 3300035172 Bacteria 16971
254 Ga0373955_0066102 3300035172 Bacteria 2009
255 Ga0373942_0015953 3300035207 Bacteria 1837
256 Ga0316574_0005436 3300035398 Bacteria 6793
257 Ga0316574_0022996 3300035398 Bacteria 3717
258 Ga0373924_0000643 3300035410 Bacteria 10842
259 Ga0373924_0071924 3300035410 Bacteria 1460
260 Ga0373931_0032826 3300035691 Bacteria 2688
261 Ga0373935_0028666 3300035692 Bacteria 3441
262 Ga0373935_0095402 3300035692 Bacteria 1953
263 Ga0373935_0113493 3300035692 Bacteria 1801
264 Ga0373927_0025024 3300035695 Bacteria 3903
265 Ga0373933_0000107 3300035724 Bacteria 53134
266 Ga0373933_0001423 3300035724 Bacteria 14035
267 Ga0373933_0002148 3300035724 Bacteria 11303
268 Ga0373933_0035637 3300035724 Bacteria 2907
269 Ga0373947_0148842 3300035725 Bacteria 1506
270 Ga0373947_0182506 3300035725 Bacteria 1367
271 Ga0373937_0000810 3300036401 Bacteria 26724
272 Ga0373937_0001978 3300036401 Bacteria 17143
273 Ga0373937_0008090 3300036401 Bacteria 9128
274 Ga0373937_0009096 3300036401 Bacteria 8620
275 Ga0373937_0019962 3300036401 Bacteria 6001
276 Ga0373937_0403395 3300036401 Bacteria 1297
277 Ga0316582_0000358 3300036647 Bacteria 16239
278 Ga0316582_0001924 3300036647 Bacteria 9477
279 Ga0316582_0003674 3300036647 Bacteria 7582
280 Ga0316582_0178199 3300036647 Bacteria 1445
281 Ga0316582_0187004 3300036647 Unclassified 1410
282 Ga0316584_0002511 3300036712 Bacteria 11626
283 Ga0316584_0036573 3300036712 Unclassified 3644
284 Ga0316584_0051327 3300036712 Bacteria 3084
285 Ga0373925_0041557 3300037068 Bacteria 3409
286 Ga0373925_0146031 3300037068 Bacteria 1854
287 Ga0316581_0001262 3300037588 Bacteria 5612
288 Ga0316581_0008730 3300037588 Unclassified 2768
289 Ga0436365_1357757 3300039437 Bacteria 1651
290 Ga0439453_0006485 3300041408 Bacteria 1823
291 Ga0439446_0016079 3300042156 Bacteria 2081
292 Ga0439435_0000022 3300042436 Bacteria 17156
293 Ga0466961_0035645 3300044693 Bacteria 3194
294 Ga0466957_0076867 3300044842 Bacteria 2074
295 Ga0495592_0022271 3300046454 Bacteria 4820
296 Ga0495592_0023313 3300046454 Bacteria 4707
297 Ga0495592_0023881 3300046454 Bacteria 4650
298 Ga0495592_0088629 3300046454 Bacteria 2223
299 Ga0495603_0007184 3300046455 Bacteria 6688
300 Ga0495603_0120416 3300046455 Bacteria 1529
301 Ga0495629_0044828 3300046459 Bacteria 3103
302 Ga0495629_0105849 3300046459 Bacteria 1962
303 Ga0495638_0161153 3300046460 Bacteria 1294
304 Ga0495641_0003233 3300046461 Bacteria 12354
305 Ga0495641_0008236 3300046461 Bacteria 6383
306 Ga0495641_0021539 3300046461 Bacteria 3242
307 Ga0495651_0000105 3300046462 Bacteria 61688
308 Ga0495651_0003319 3300046462 Bacteria 12355
309 Ga0495651_0043484 3300046462 Bacteria 3485
310 Ga0495653_0073236 3300046463 Bacteria 2556
311 Ga0495580_0026172 3300046472 Bacteria 4256
312 Ga0495580_0111247 3300046472 Bacteria 1902
313 Ga0495580_0140273 3300046472 Bacteria 1675
314 Ga0495582_0031648 3300046473 Bacteria 2908
315 Ga0495639_0018448 3300046475 Bacteria 3038
316 Ga0495662_0067873 3300046476 Bacteria 1726
317 Ga0495662_0086854 3300046476 Bacteria 1523
318 Ga0495664_0016343 3300046477 Bacteria 4225
319 Ga0495664_0017957 3300046477 Bacteria 4045
320 Ga0495664_0036445 3300046477 Bacteria 2899
321 Ga0495664_0066717 3300046477 Bacteria 2146
322 Ga0495585_0082712 3300046492 Unclassified 1738
323 Ga0495594_0008917 3300046499 Bacteria 5172
324 Ga0495594_0009344 3300046499 Bacteria 5064
325 Ga0495594_0068887 3300046499 Bacteria 1965
326 Ga0495607_0089515 3300046501 Bacteria 1671
327 Ga0495608_0034076 3300046511 Bacteria 3438
328 Ga0495608_0158008 3300046511 Bacteria 1442
329 Ga0495618_0005250 3300046514 Bacteria 7917
330 Ga0495618_0005302 3300046514 Bacteria 7873
331 Ga0495618_0035547 3300046514 Bacteria 3127
332 Ga0495618_0055823 3300046514 Bacteria 2500
333 Ga0495628_0007532 3300046516 Bacteria 9414
334 Ga0495628_0011777 3300046516 Bacteria 7383
335 Ga0495628_0015785 3300046516 Bacteria 6303
336 Ga0495628_0021529 3300046516 Bacteria 5300
337 Ga0495630_0008055 3300046517 Bacteria 7575
338 Ga0495630_0054807 3300046517 Unclassified 2987
339 Ga0495630_0060205 3300046517 Bacteria 2849
340 Ga0495630_0089633 3300046517 Bacteria 2323
341 Ga0495637_0077984 3300046520 Bacteria 1325
342 Ga0495644_0085255 3300046523 Bacteria 1191
343 Ga0495666_0074126 3300046526 Bacteria 1614
344 Ga0495666_0142723 3300046526 Bacteria 1115
345 Ga0495652_0003474 3300046529 Bacteria 15537
346 Ga0495652_0035488 3300046529 Bacteria 4340
347 Ga0495652_0103661 3300046529 Bacteria 2302
348 Ga0495665_0016894 3300046531 Bacteria 3929
349 Ga0495665_0029461 3300046531 Bacteria 2941
350 Ga0495640_0035906 3300046533 Bacteria 3505
351 Ga0495640_0055696 3300046533 Bacteria 2704
352 Ga0495640_0076308 3300046533 Bacteria 2236
353 Ga0495640_0123749 3300046533 Bacteria 1679
354 Ga0495586_0015739 3300046535 Bacteria 4023
355 Ga0495587_0002310 3300046536 Bacteria 12764
356 Ga0495587_0004038 3300046536 Bacteria 9723
357 Ga0495587_0035465 3300046536 Bacteria 3004
358 Ga0495645_0000399 3300046543 Bacteria 30028
359 Ga0495645_0004156 3300046543 Bacteria 9890
360 Ga0495645_0146416 3300046543 Bacteria 1645
361 Ga0495622_0008540 3300046557 Bacteria 4746
362 Ga0495622_0057829 3300046557 Bacteria 1797
363 Ga0495667_0004692 3300046559 Bacteria 9239
364 Ga0495667_0042615 3300046559 Bacteria 3010
365 Ga0495667_0063911 3300046559 Bacteria 2408
366 Ga0495667_0073717 3300046559 Bacteria 2223
367 Ga0495656_0094949 3300046615 Bacteria 1370
368 Ga0495668_0138135 3300046616 Bacteria 1334
369 Ga0495634_0012863 3300046642 Bacteria 6057
370 Ga0495634_0091730 3300046642 Bacteria 1971
371 Ga0495635_0006787 3300046663 Bacteria 8001
372 Ga0495635_0007724 3300046663 Bacteria 7503
373 Ga0495635_0072347 3300046663 Bacteria 2362
374 Ga0495661_0175302 3300046665 Bacteria 1140
375 Ga0495588_0004060 3300046674 Bacteria 6442
376 Ga0495588_0082361 3300046674 Bacteria 1680
377 Ga0495657_0002627 3300046675 Bacteria 15037
378 Ga0495657_0004446 3300046675 Bacteria 11199
379 Ga0495657_0063329 3300046675 Bacteria 2440
380 Ga0495657_0101683 3300046675 Bacteria 1831
381 Ga0495599_0000569 3300046678 Bacteria 21086
382 Ga0495599_0004094 3300046678 Bacteria 8596
383 Ga0495599_0008006 3300046678 Bacteria 6414
384 Ga0495599_0242868 3300046678 Bacteria 1097
385 Ga0495623_0000372 3300046679 Bacteria 29382
386 Ga0495646_0044527 3300046680 Bacteria 2713
387 Ga0495647_0000588 3300046681 Bacteria 10771
388 Ga0495647_0086518 3300046681 Bacteria 1278
389 Ga0495647_0123157 3300046681 Bacteria 1092
390 Ga0495658_0033610 3300046683 Bacteria 2810
391 Ga0495658_0077120 3300046683 Bacteria 1948
392 Ga0495669_0115500 3300046684 Bacteria 1256
393 Ga0495669_0155239 3300046684 Bacteria 1085
394 Ga0495613_0006955 3300046689 Bacteria 8437
395 Ga0495613_0257612 3300046689 Bacteria 1216
396 Ga0495624_0013228 3300046690 Bacteria 5626
397 Ga0495589_0114634 3300046794 Bacteria 1300
398 Ga0495589_0149478 3300046794 Bacteria 1116
399 Ga0495600_0000689 3300046809 Bacteria 17658
400 Ga0495600_0013518 3300046809 Bacteria 5132
401 Ga0495600_0033267 3300046809 Bacteria 3347
402 Ga0495600_0039011 3300046809 Bacteria 3092
403 Ga0495581_0011376 3300047315 Bacteria 5149
404 Ga0495581_0057097 3300047315 Bacteria 2253
405 Ga0495581_0131502 3300047315 Bacteria 1458
406 Ga0495604_0005162 3300047317 Bacteria 10340
407 Ga0495604_0013271 3300047317 Bacteria 6560
408 Ga0495604_0041397 3300047317 Bacteria 3613
409 Ga0495674_0000463 3300047319 Bacteria 36736
410 Ga0495674_0003696 3300047319 Bacteria 14880
411 Ga0495674_0026505 3300047319 Bacteria 5303
412 Ga0495676_0114840 3300047321 Bacteria 1969
413 Ga0495676_0137171 3300047321 Bacteria 1758
414 Ga0495680_0002292 3300047322 Bacteria 19664
415 Ga0495680_0019322 3300047322 Bacteria 5754
416 Ga0495680_0020566 3300047322 Bacteria 5547
417 Ga0495680_0027640 3300047322 Bacteria 4657
418 Ga0495675_0011653 3300047444 Bacteria 5520
419 Ga0495675_0012650 3300047444 Bacteria 5310
420 Ga0495684_0001586 3300047471 Bacteria 18214
421 Ga0495593_0040931 3300047673 Bacteria 2493
422 Ga0495593_0254961 3300047673 Bacteria 878
423 Ga0495602_0023695 3300048088 Bacteria 5975
424 Ga0495602_0031873 3300048088 Bacteria 4974
425 Ga0495602_0078521 3300048088 Bacteria 2788
426 Ga0495614_0012703 3300048089 Bacteria 3694
427 Ga0496100_0003041 3300048903 Bacteria 8658
428 Ga0496100_0019183 3300048903 Bacteria 4074
429 Ga0496101_0002476 3300048904 Bacteria 11339
430 Ga0496102_0011061 3300048905 Bacteria 7773
431 Ga0496102_0035842 3300048905 Bacteria 4468
432 Ga0496103_0001366 3300048906 Bacteria 16458
433 Ga0496104_0012295 3300048907 Bacteria 7695
434 Ga0496104_0037783 3300048907 Bacteria 4514
435 Ga0496104_0371665 3300048907 Bacteria 1342
436 Ga0496105_0001981 3300048908 Bacteria 14741
437 Ga0496105_0003680 3300048908 Bacteria 11408
438 Ga0496105_0005839 3300048908 Bacteria 9391
439 Ga0496106_0002191 3300048909 Bacteria 14600
440 Ga0496106_0042397 3300048909 Bacteria 3413
441 Ga0496106_0063166 3300048909 Bacteria 2813
442 Ga0496107_0003730 3300048910 Bacteria 10234
443 Ga0496107_0062625 3300048910 Bacteria 2695
444 Ga0496108_0002042 3300048911 Bacteria 16189
445 Ga0496108_0009727 3300048911 Bacteria 7792
446 Ga0496108_0089093 3300048911 Bacteria 2622
447 Ga0496109_0003657 3300048912 Bacteria 12850
448 Ga0496109_0004693 3300048912 Bacteria 11404
449 Ga0496109_0007290 3300048912 Bacteria 9348
450 Ga0496110_0091933 3300048913 Bacteria 2714
451 Ga0496110_0121525 3300048913 Bacteria 2353
452 Ga0496111_0001512 3300048914 Bacteria 13339
453 Ga0496111_0101810 3300048914 Bacteria 2111
454 Ga0496112_0000112 3300048915 Bacteria 50370
455 Ga0496112_0008138 3300048915 Bacteria 9368
456 Ga0496113_0001285 3300048916 Bacteria 13859
457 Ga0496114_0024617 3300048917 Bacteria 4913
458 Ga0496114_0066134 3300048917 Bacteria 3030
459 Ga0496115_0016563 3300048918 Bacteria 5616
460 Ga0496115_0043997 3300048918 Bacteria 3560
461 Ga0496115_0054735 3300048918 Bacteria 3204
462 Ga0501039_0116732 3300049575 Bacteria 2090
463 Ga0501040_0241701 3300049576 Bacteria 1287
464 Ga0501043_0496824 3300049579 Bacteria 912
465 Ga0501047_0009045 3300049581 Bacteria 9408
466 Ga0501047_0267800 3300049581 Bacteria 1555
467 Ga0501067_0035307 3300049583 Bacteria 2776
468 Ga0501068_0058059 3300049584 Bacteria 2347
469 Ga0501069_0003200 3300049585 Bacteria 8389
470 Ga0501072_0165355 3300049588 Bacteria 1765
471 Ga0501072_0443628 3300049588 Bacteria 1028
472 Ga0501073_0011539 3300049589 Bacteria 6460
473 Ga0501074_0000350 3300049590 Bacteria 27041
474 Ga0501076_0048860 3300049592 Bacteria 3344
475 Ga0501077_0066292 3300049593 Bacteria 2290
476 Ga0501077_0333462 3300049593 Bacteria 967
477 Ga0501079_0014166 3300049741 Bacteria 6078
478 Ga0501081_0030816 3300049743 Bacteria 3633
479 Ga0501083_0000850 3300049744 Bacteria 20096
480 Ga0501083_0118724 3300049744 Bacteria 1735
481 Ga0501044_0018740 3300049823 Bacteria 7413
482 Ga0501044_0171925 3300049823 Bacteria 2138
483 Ga0501044_0227774 3300049823 Bacteria 1813
484 Ga0501045_0042499 3300049824 Bacteria 3308
485 nmdc:mga0yw44_352988_c1 3300050492 Bacteria 990
486 nmdc:mga0yw44_6488_c1 3300050492 Bacteria 5662
487 nmdc:mga07m45_86840_c1 3300050496 Bacteria 1336
488 nmdc:mga05p37_32454_c1 3300050507 Bacteria 6385
489 nmdc:mga09592_308235_c1 3300050508 Bacteria 1372
490 nmdc:mga08y16_62524_c1 3300050511 Bacteria 3888
491 nmdc:mga08y16_70580_c1 3300050511 Bacteria 3641
492 nmdc:mga0n895_207375_c1 3300050512 Bacteria 1990
493 nmdc:mga0n895_39513_c1 3300050512 Bacteria 4578
494 nmdc:mga0n895_542469_c1 3300050512 Bacteria 1169
495 nmdc:mga0a205_78816_c1 3300050515 Bacteria 3182
496 Ga0495601_0000161 3300053077 Bacteria 36812
497 Ga0495601_0013564 3300053077 Bacteria 4901
498 Ga0495601_0140820 3300053077 Bacteria 1573
499 Ga0495612_0001381 3300053078 Bacteria 10007
500 Ga0495612_0002813 3300053078 Bacteria 7196
501 Ga0495612_0006149 3300053078 Bacteria 4939
502 Ga0495612_0017560 3300053078 Bacteria 2864
503 Ga0495655_0030989 3300053083 Bacteria 1298
504 Ga0495595_0008104 3300053084 Bacteria 4308
505 Ga0495595_0011373 3300053084 Bacteria 3719
506 Ga0495595_0029210 3300053084 Bacteria 2466
507 Ga0495595_0106529 3300053084 Bacteria 1356
508 Ga0495619_0000059 3300053085 Bacteria 92434
509 Ga0495619_0010050 3300053085 Bacteria 5957
510 Ga0495619_0048428 3300053085 Bacteria 2800
511 Ga0495619_0079223 3300053085 Bacteria 2209
512 Ga0495619_0130393 3300053085 Bacteria 1727
513 Ga0495619_0135070 3300053085 Bacteria 1696
514 Ga0500643_010256 3300053087 Bacteria 3502
515 Ga0500644_0000605 3300053088 Bacteria 13553
516 Ga0500651_0008638 3300053093 Bacteria 6011
517 Ga0500641_0009851 3300053096 Bacteria 3442
518 Ga0500650_0111453 3300053098 Bacteria 1277
519 Ga0500595_000001 3300053119 Bacteria 1088438
520 Ga0500652_005982 3300053131 Bacteria 3879
521 Ga0500655_027365 3300053133 Bacteria 1088
522 Ga0500616_0000001 3300053153 Bacteria 1986011
523 Ga0500645_000288 3300053730 Bacteria 36240
524 Ga0501084_0380530 3300054114 Bacteria 1193
525 Ga0501082_0000002 3300060353 Bacteria 186546
526 2643758458 2643221547 Bacteria 4740017
527 Ga0316577_10018703
528 JGI24743J22301_10002075
529 JGI24738J21930_10002534
530 JGI24744J21845_10006139
531 JGI24034J26672_10003527
532 JGI24034J26672_10012004
533 JGI24742J22300_10008726
534 JGI24751J29686_10007557
535 Ga0070658_10036384
536 Ga0070690_100005061
537 Ga0070690_100134828
538 Ga0070670_100006158
539 Ga0070670_100010575
540 Ga0070670_100160244
541 Ga0070677_10017133
542 Ga0070680_100153532
543 Ga0070680_100189666
544 Ga0070680_100265480
545 Ga0070682_100024264
546 Ga0068868_100007673
547 Ga0070660_100096932
548 Ga0070689_100370864
549 Ga0070687_100001516
550 Ga0070661_100115200
551 Ga0070692_10008203
552 Ga0070668_100178688
553 Ga0070675_100007115
554 Ga0070674_100091464
555 Ga0070673_100571561
556 Ga0070688_100054492
557 Ga0070659_100078812
558 Ga0070659_100246097
559 Ga0070667_100014530
560 Ga0070667_100489096
561 Ga0070714_100276653
562 Ga0070713_100024947
563 Ga0070713_100136160
564 Ga0070710_10009746
565 Ga0070705_100056356
566 Ga0070705_100130433
567 Ga0070700_100047027
568 Ga0070663_100072264
569 Ga0070663_100280003
570 Ga0070663_100503419
571 Ga0070678_100013490
572 Ga0070662_100056377
573 Ga0070681_10124205
574 Ga0070707_100084455
575 Ga0070699_100221017
576 Ga0070679_100218676
577 Ga0068853_100110935
578 Ga0070672_100005396
579 Ga0070695_100155477
580 Ga0070696_100049488
581 Ga0070693_100105125
582 Ga0070704_100341138
583 Ga0068855_100012239
584 Ga0068855_100013776
585 Ga0070664_100050621
586 Ga0070664_100080026
587 Ga0068857_100095705
588 Ga0068854_100053539
589 Ga0068856_100420646
590 Ga0068856_100500132
591 Ga0070702_100061201
592 Ga0068852_100002168
593 Ga0068852_100209723
594 Ga0068864_100311810
595 Ga0068866_10007081
596 Ga0068870_10013351
597 Ga0068863_100114795
598 Ga0068858_100261653
599 Ga0068862_100080844
600 Ga0081540_1017777
601 Ga0081539_10048291
602 Ga0070717_10252726
603 Ga0075365_10085206
604 Ga0070715_10147698
605 Ga0070712_100015300
606 Ga0070712_100068370
607 Ga0075367_10090665
608 Ga0068871_100007976
609 Ga0075428_100028442
610 Ga0075434_100078419
611 Ga0075429_100280839
612 Ga0068865_100019455
613 Ga0068865_100267251
614 Ga0075436_100108473
615 Ga0105240_10031165
616 Ga0111539_10006159
617 Ga0105245_10169553
618 Ga0105247_10017144
619 Ga0114129_10208000
620 Ga0105243_10034455
621 Ga0105241_10788702
622 Ga0105242_10012315
623 Ga0105248_10087226
624 Ga0105248_10212660
625 Ga0105237_10675676
626 Ga0105238_10019721
627 Ga0105238_10142794
628 Ga0105238_10213334
629 Ga0105239_10148006
630 Ga0105246_10081212
631 Ga0105246_10382141
632 Ga0157371_10054602
633 Ga0157370_10156941
634 Ga0157370_10205849
635 Ga0157369_10041952
636 Ga0157369_10262995
637 Ga0157369_10393842
638 Ga0157378_10010734
639 Ga0163162_10031215
640 Ga0157372_10222655
641 Ga0157375_10232404
642 Ga0157375_10323012
643 Ga0163163_10008580
644 Ga0163163_10011643
645 Ga0157377_10002286
646 Ga0157379_10008682
647 Ga0157379_10043206
648 Ga0157379_10102950
649 Ga0157376_10086107
650 Ga0163161_10029657
651 Ga0206353_11134490
652 Ga0213876_10008281
653 Ga0213876_10012420
654 Ga0207697_10106190
655 Ga0207692_10036383
656 Ga0207688_10000305
657 Ga0207680_10176736
658 Ga0207699_10065733
659 Ga0207645_10009122
660 Ga0207645_10088838
661 Ga0207643_10048021
662 Ga0207707_10067743
663 Ga0207707_10191138
664 Ga0207695_10161926
665 Ga0207693_10011263
666 Ga0207693_10130204
667 Ga0207660_10166523
668 Ga0207660_10267771
669 Ga0207657_10011510
670 Ga0207657_10029851
671 Ga0207657_10494587
672 Ga0207649_10051944
673 Ga0207649_10128391
674 Ga0207652_10036670
675 Ga0207694_10029171
676 Ga0207694_10124541
677 Ga0207650_10046348
678 Ga0207650_10053591
679 Ga0207659_10119543
680 Ga0207700_10131724
681 Ga0207700_10135494
682 Ga0207664_10192186
683 Ga0207664_10234038
684 Ga0207664_10460904
685 Ga0207644_10014574
686 Ga0207690_10412661
687 Ga0207690_10429141
688 Ga0207706_10001680
689 Ga0207706_10018709
690 Ga0207686_10088002
691 Ga0207670_10076137
692 Ga0207691_10010064
693 Ga0207711_10172979
694 Ga0207689_10003094
695 Ga0207689_10081459
696 Ga0207661_10553946
697 Ga0207679_10031610
698 Ga0207679_10318052
699 Ga0207667_10005244
700 Ga0207667_10012846
701 Ga0207651_10005051
702 Ga0207651_10037003
703 Ga0207712_10007315
704 Ga0207668_10042698
705 Ga0207658_10025036
706 Ga0207677_10003335
707 Ga0207703_10106460
708 Ga0207639_10101054
709 Ga0207678_10042281
710 Ga0207678_10082739
711 Ga0207678_10134866
712 Ga0207708_10000855
713 Ga0207702_10036593
714 Ga0207648_10023824
715 Ga0207676_10362202
716 Ga0207674_10084194
717 Ga0207675_100002171
718 Ga0207683_10096868
719 Ga0207698_10015351
720 Ga0209999_1001876
721 Ga0210002_1004358
722 Ga0209966_1002045
723 Ga0209998_10027171
724 Ga0268265_10088007
725 Ga0265338_10103004
726 Ga0265338_10173091
727 Ga0265330_10031350
728 Ga0265325_10037369
729 Ga0265325_10065939
730 Ga0265329_10027207
731 Ga0265331_10006164
732 Ga0265316_10077513
733 Ga0265313_10025558
734 Ga0265313_10153139
735 Ga0316575_10000082
736 Ga0316575_10004744
737 Ga0316575_10057448
738 Ga0316579_10000015
739 Ga0316579_10000245
740 Ga0316579_10154508
741 Ga0265314_10001133
742 Ga0265314_10002100
743 Ga0265342_10000196
744 Ga0316576_10070351
745 Ga0316576_10221771
746 Ga0316576_10396989
747 Ga0316578_10005745
748 Ga0316578_10123681
749 Ga0316578_10309155
750 Ga0316577_10072289
751 Ga0307410_10299762
752 Ga0307416_100030693
753 Ga0316583_10000483
754 Ga0316583_10000835
755 Ga0316583_10007765
756 Ga0316585_10008292
757 Ga0316580_10038793
758 Ga0373926_0003395
759 Ga0373934_0000044
760 Ga0373936_0000601
761 Ga0373945_0016300
762 Ga0373953_0003022
763 Ga0373953_0013910
764 Ga0373953_0033810
765 Ga0373954_0000805
766 Ga0373954_0012950
767 Ga0373954_0015076
768 Ga0373954_0059775
769 Ga0373954_0064480
770 Ga0373956_0002849
771 Ga0373956_0020453
772 Ga0373956_0023536
773 Ga0373957_0001310
774 Ga0373957_0004597
775 Ga0373957_0007834
776 Ga0373943_0016851
777 Ga0373943_0154984
778 Ga0373946_0017665
779 Ga0373955_0000470
780 Ga0373955_0066102
781 Ga0373942_0015953
782 Ga0316574_0005436
783 Ga0316574_0022996
784 Ga0373924_0000643
785 Ga0373924_0071924
786 Ga0373931_0032826
787 Ga0373935_0028666
788 Ga0373935_0095402
789 Ga0373935_0113493
790 Ga0373927_0025024
791 Ga0373933_0000107
792 Ga0373933_0001423
793 Ga0373933_0002148
794 Ga0373933_0035637
795 Ga0373947_0148842
796 Ga0373947_0182506
797 Ga0373937_0000810
798 Ga0373937_0001978
799 Ga0373937_0008090
800 Ga0373937_0009096
801 Ga0373937_0019962
802 Ga0373937_0403395
803 Ga0316582_0000358
804 Ga0316582_0001924
805 Ga0316582_0003674
806 Ga0316582_0178199
807 Ga0316582_0187004
808 Ga0316584_0002511
809 Ga0316584_0036573
810 Ga0316584_0051327
811 Ga0373925_0041557
812 Ga0373925_0146031
813 Ga0316581_0001262
814 Ga0316581_0008730
815 Ga0436365_1357757
816 Ga0439453_0006485
817 Ga0439446_0016079
818 Ga0439435_0000022
819 Ga0466961_0035645
820 Ga0466957_0076867
821 Ga0495592_0022271
822 Ga0495592_0023313
823 Ga0495592_0023881
824 Ga0495592_0088629
825 Ga0495603_0007184
826 Ga0495603_0120416
827 Ga0495629_0044828
828 Ga0495629_0105849
829 Ga0495638_0161153
830 Ga0495641_0003233
831 Ga0495641_0008236
832 Ga0495641_0021539
833 Ga0495651_0000105
834 Ga0495651_0003319
835 Ga0495651_0043484
836 Ga0495653_0073236
837 Ga0495580_0026172
838 Ga0495580_0111247
839 Ga0495580_0140273
840 Ga0495582_0031648
841 Ga0495639_0018448
842 Ga0495662_0067873
843 Ga0495662_0086854
844 Ga0495664_0016343
845 Ga0495664_0017957
846 Ga0495664_0036445
847 Ga0495664_0066717
848 Ga0495585_0082712
849 Ga0495594_0008917
850 Ga0495594_0009344
851 Ga0495594_0068887
852 Ga0495607_0089515
853 Ga0495608_0034076
854 Ga0495608_0158008
855 Ga0495618_0005250
856 Ga0495618_0005302
857 Ga0495618_0035547
858 Ga0495618_0055823
859 Ga0495628_0007532
860 Ga0495628_0011777
861 Ga0495628_0015785
862 Ga0495628_0021529
863 Ga0495630_0008055
864 Ga0495630_0054807
865 Ga0495630_0060205
866 Ga0495630_0089633
867 Ga0495637_0077984
868 Ga0495644_0085255
869 Ga0495666_0074126
870 Ga0495666_0142723
871 Ga0495652_0003474
872 Ga0495652_0035488
873 Ga0495652_0103661
874 Ga0495665_0016894
875 Ga0495665_0029461
876 Ga0495640_0035906
877 Ga0495640_0055696
878 Ga0495640_0076308
879 Ga0495640_0123749
880 Ga0495586_0015739
881 Ga0495587_0002310
882 Ga0495587_0004038
883 Ga0495587_0035465
884 Ga0495645_0000399
885 Ga0495645_0004156
886 Ga0495645_0146416
887 Ga0495622_0008540
888 Ga0495622_0057829
889 Ga0495667_0004692
890 Ga0495667_0042615
891 Ga0495667_0063911
892 Ga0495667_0073717
893 Ga0495656_0094949
894 Ga0495668_0138135
895 Ga0495634_0012863
896 Ga0495634_0091730
897 Ga0495635_0006787
898 Ga0495635_0007724
899 Ga0495635_0072347
900 Ga0495661_0175302
901 Ga0495588_0004060
902 Ga0495588_0082361
903 Ga0495657_0002627
904 Ga0495657_0004446
905 Ga0495657_0063329
906 Ga0495657_0101683
907 Ga0495599_0000569
908 Ga0495599_0004094
909 Ga0495599_0008006
910 Ga0495599_0242868
911 Ga0495623_0000372
912 Ga0495646_0044527
913 Ga0495647_0000588
914 Ga0495647_0086518
915 Ga0495647_0123157
916 Ga0495658_0033610
917 Ga0495658_0077120
918 Ga0495669_0115500
919 Ga0495669_0155239
920 Ga0495613_0006955
921 Ga0495613_0257612
922 Ga0495624_0013228
923 Ga0495589_0114634
924 Ga0495589_0149478
925 Ga0495600_0000689
926 Ga0495600_0013518
927 Ga0495600_0033267
928 Ga0495600_0039011
929 Ga0495581_0011376
930 Ga0495581_0057097
931 Ga0495581_0131502
932 Ga0495604_0005162
933 Ga0495604_0013271
934 Ga0495604_0041397
935 Ga0495674_0000463
936 Ga0495674_0003696
937 Ga0495674_0026505
938 Ga0495676_0114840
939 Ga0495676_0137171
940 Ga0495680_0002292
941 Ga0495680_0019322
942 Ga0495680_0020566
943 Ga0495680_0027640
944 Ga0495675_0011653
945 Ga0495675_0012650
946 Ga0495684_0001586
947 Ga0495593_0040931
948 Ga0495593_0254961
949 Ga0495602_0023695
950 Ga0495602_0031873
951 Ga0495602_0078521
952 Ga0495614_0012703
953 Ga0496100_0003041
954 Ga0496100_0019183
955 Ga0496101_0002476
956 Ga0496102_0011061
957 Ga0496102_0035842
958 Ga0496103_0001366
959 Ga0496104_0012295
960 Ga0496104_0037783
961 Ga0496104_0371665
962 Ga0496105_0001981
963 Ga0496105_0003680
964 Ga0496105_0005839
965 Ga0496106_0002191
966 Ga0496106_0042397
967 Ga0496106_0063166
968 Ga0496107_0003730
969 Ga0496107_0062625
970 Ga0496108_0002042
971 Ga0496108_0009727
972 Ga0496108_0089093
973 Ga0496109_0003657
974 Ga0496109_0004693
975 Ga0496109_0007290
976 Ga0496110_0091933
977 Ga0496110_0121525
978 Ga0496111_0001512
979 Ga0496111_0101810
980 Ga0496112_0000112
981 Ga0496112_0008138
982 Ga0496113_0001285
983 Ga0496114_0024617
984 Ga0496114_0066134
985 Ga0496115_0016563
986 Ga0496115_0043997
987 Ga0496115_0054735
988 Ga0501039_0116732
989 Ga0501040_0241701
990 Ga0501043_0496824
991 Ga0501047_0009045
992 Ga0501047_0267800
993 Ga0501067_0035307
994 Ga0501068_0058059
995 Ga0501069_0003200
996 Ga0501072_0165355
997 Ga0501072_0443628
998 Ga0501073_0011539
999 Ga0501074_0000350
1000 Ga0501076_0048860
1001 Ga0501077_0066292
1002 Ga0501077_0333462
1003 Ga0501079_0014166
1004 Ga0501081_0030816
1005 Ga0501083_0000850
1006 Ga0501083_0118724
1007 Ga0501044_0018740
1008 Ga0501044_0171925
1009 Ga0501044_0227774
1010 Ga0501045_0042499
1011 nmdc:mga0yw44_352988_c1
1012 nmdc:mga0yw44_6488_c1
1013 nmdc:mga07m45_86840_c1
1014 nmdc:mga05p37_32454_c1
1015 nmdc:mga09592_308235_c1
1016 nmdc:mga08y16_62524_c1
1017 nmdc:mga08y16_70580_c1
1018 nmdc:mga0n895_207375_c1
1019 nmdc:mga0n895_39513_c1
1020 nmdc:mga0n895_542469_c1
1021 nmdc:mga0a205_78816_c1
1022 Ga0495601_0000161
1023 Ga0495601_0013564
1024 Ga0495601_0140820
1025 Ga0495612_0001381
1026 Ga0495612_0002813
1027 Ga0495612_0006149
1028 Ga0495612_0017560
1029 Ga0495655_0030989
1030 Ga0495595_0008104
1031 Ga0495595_0011373
1032 Ga0495595_0029210
1033 Ga0495595_0106529
1034 Ga0495619_0000059
1035 Ga0495619_0010050
1036 Ga0495619_0048428
1037 Ga0495619_0079223
1038 Ga0495619_0130393
1039 Ga0495619_0135070
1040 Ga0500643_010256
1041 Ga0500644_0000605
1042 Ga0500651_0008638
1043 Ga0500641_0009851
1044 Ga0500650_0111453
1045 Ga0500595_000001
1046 Ga0500652_005982
1047 Ga0500655_027365
1048 Ga0500616_0000001
1049 Ga0500645_000288
1050 Ga0501084_0380530
1051 Ga0501082_0000002
1052 2643758458

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00701

DHDPS

Dihydrodipicolinate synthetase family

37

310

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eb2-assembly1.cif.gz_C crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 2.0a resolution 0.9856 6 291
3eb2-assembly1.cif.gz_C crystal structure of dihydrodipicolinate synthase from rhodopseudomonas palustris at 2.0a resolution 0.9754 6 291
4nq1-assembly1.cif.gz_B legionella pneumophila dihydrodipicolinate synthase with first substrate pyruvate bound in the active site 0.9564 7 295
3na8-assembly1.cif.gz_D crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa 0.9538 5 292
3pud-assembly1.cif.gz_A crystal structure of dhydrodipicolinate synthase from acinetobacter baumannii at 2.8a resolution 0.95 7 295
ID Description Score Start End Superfamily
3eb2C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9856 6 291 3.20.20.70
3eb2C00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9754 6 291 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9482 6 295 3.20.20.70
2rfgB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9453 6 293 3.20.20.70
2yxgD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.945 6 295 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7V7DDU0-F1-model_v4 Dihydrodipicolinate synthase family protein 0.996 209 295 GO:0016829
AF-B3Q7F3-F1-model_v4 deleted 0.9865 3 292
AF-A0A7V7DDU0-F1-model_v4 Dihydrodipicolinate synthase family protein 0.9848 209 295 GO:0016829
AF-A0A7Y8IBI3-F1-model_v4 Dihydrodipicolinate synthase family protein 0.98 6 295 GO:0008840
AF-B3Q7F3-F1-model_v4 deleted 0.9798 3 292

Map