F459382

General Info

Members Datasets Scaffolds Average Seq Length
526 247 1052 126

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_101399826|Ga0068852_1013998262
Length 139
Sequence LENNGVQYRSSLSARLSVVFYIILCFEIGVFLTVLPWWPQGMWGLSDWGNNYFLLYAARKTGQGLQTVVASGWVRGAVTGVGLLNLGMAFWEIFHFNQTVRALDSQAGSQVRPTGNGTETGTTDHVSDNERPNISDNNA

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
147 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
154 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
155 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
158 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
159 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
160 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
164 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
168 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
173 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
174 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
178 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
179 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
180 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
181 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
182 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
183 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
184 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
185 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
186 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
191 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
192 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
193 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
194 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
195 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
196 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
197 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
202 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
203 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
204 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
205 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
206 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
207 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
208 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
209 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
210 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
211 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
212 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
213 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
214 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
218 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
219 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
222 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
223 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
224 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
225 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
226 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
227 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
228 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
229 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
230 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
231 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
232 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
233 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
234 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
235 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
236 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.18
Rhizosphere 95.82
Stem 0
Stem Tuber 0
Unclassified 48.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_101399826 3300005616 Bacteria 721
2 JGI25406J46586_10167017 3300003203 Unclassified 641
3 JGI25406J46586_10183362 3300003203 Unclassified 610
4 Ga0065714_10064478 3300005288 Bacteria 56205
5 Ga0065704_10109683 3300005289 Unclassified 1998
6 Ga0065704_10125594 3300005289 Unclassified 1701
7 Ga0065712_10000121 3300005290 Bacteria 103063
8 Ga0065712_10287493 3300005290 Unclassified 884
9 Ga0065715_10022813 3300005293 Viruses 1972
10 Ga0065715_10162772 3300005293 Bacteria 1613
11 Ga0070690_100918041 3300005330 Unclassified 686
12 Ga0070670_100928507 3300005331 Unclassified 790
13 Ga0070670_101143510 3300005331 Unclassified 710
14 Ga0068869_100452085 3300005334 Bacteria 1065
15 Ga0070680_100017998 3300005336 Bacteria 5580
16 Ga0070680_100477365 3300005336 Unclassified 1066
17 Ga0070680_101123161 3300005336 Bacteria 679
18 Ga0070689_100001007 3300005340 Bacteria 17652
19 Ga0070689_100833661 3300005340 Unclassified 813
20 Ga0070689_101093471 3300005340 Unclassified 712
21 Ga0070687_101405260 3300005343 Unclassified 522
22 Ga0070661_100459047 3300005344 Bacteria 1014
23 Ga0070661_100534165 3300005344 Bacteria 942
24 Ga0070661_100880598 3300005344 Unclassified 738
25 Ga0070692_10306853 3300005345 Unclassified 971
26 Ga0070692_10387533 3300005345 Unclassified 879
27 Ga0070692_10727824 3300005345 Bacteria 670
28 Ga0070692_11029790 3300005345 Unclassified 577
29 Ga0070668_100312247 3300005347 Unclassified 1321
30 Ga0070673_100747043 3300005364 Unclassified 901
31 Ga0070673_101189261 3300005364 Unclassified 714
32 Ga0070673_101363624 3300005364 Unclassified 667
33 Ga0070673_101516384 3300005364 Bacteria 632
34 Ga0070659_101415365 3300005366 Unclassified 618
35 Ga0070705_100026001 3300005440 Bacteria 3182
36 Ga0070705_100103396 3300005440 Bacteria 1804
37 Ga0070705_100326546 3300005440 Bacteria 1110
38 Ga0070705_100537399 3300005440 Unclassified 894
39 Ga0070705_100756889 3300005440 Unclassified 769
40 Ga0070705_101213134 3300005440 Bacteria 622
41 Ga0070700_100000068 3300005441 Bacteria 74024
42 Ga0070700_101031541 3300005441 Unclassified 678
43 Ga0070700_101502055 3300005441 Unclassified 573
44 Ga0070694_100012173 3300005444 Bacteria 5345
45 Ga0070694_100306264 3300005444 Bacteria 1219
46 Ga0070694_100317245 3300005444 Bacteria 1199
47 Ga0070694_100663136 3300005444 Bacteria 845
48 Ga0070694_100674583 3300005444 Unclassified 838
49 Ga0070694_101120649 3300005444 Unclassified 657
50 Ga0070694_101497810 3300005444 Unclassified 571
51 Ga0070694_101589488 3300005444 Bacteria 555
52 Ga0070694_101672635 3300005444 Bacteria 541
53 Ga0070663_101648216 3300005455 Unclassified 573
54 Ga0070681_10002491 3300005458 Bacteria 16858
55 Ga0070681_10155647 3300005458 Unclassified 2211
56 Ga0068867_100148862 3300005459 Bacteria 1837
57 Ga0068867_100551255 3300005459 Bacteria 999
58 Ga0070685_10516836 3300005466 Unclassified 847
59 Ga0070685_10943499 3300005466 Unclassified 644
60 Ga0070706_100292938 3300005467 Bacteria 1519
61 Ga0070707_100078827 3300005468 Bacteria 3179
62 Ga0070707_100444995 3300005468 Bacteria 1256
63 Ga0070698_100062150 3300005471 Bacteria 3767
64 Ga0070699_100002708 3300005518 Bacteria 15795
65 Ga0070699_101183518 3300005518 Unclassified 701
66 Ga0070684_100853424 3300005535 Bacteria 852
67 Ga0070684_101701623 3300005535 Unclassified 595
68 Ga0070697_100711330 3300005536 Unclassified 886
69 Ga0068853_100263973 3300005539 Bacteria 1584
70 Ga0068853_101731262 3300005539 Unclassified 606
71 Ga0070672_101391652 3300005543 Unclassified 627
72 Ga0070695_100052011 3300005545 Unclassified 2631
73 Ga0070695_100109451 3300005545 Bacteria 1873
74 Ga0070695_100448601 3300005545 Unclassified 988
75 Ga0070695_100780662 3300005545 Unclassified 764
76 Ga0070695_100904252 3300005545 Unclassified 713
77 Ga0070695_101016395 3300005545 Unclassified 675
78 Ga0070696_100087268 3300005546 Bacteria 2216
79 Ga0070693_100006779 3300005547 Bacteria 5560
80 Ga0070693_100166307 3300005547 Unclassified 1409
81 Ga0070693_100544790 3300005547 Unclassified 830
82 Ga0070693_100813430 3300005547 Unclassified 693
83 Ga0070693_101501498 3300005547 Unclassified 527
84 Ga0070665_100945412 3300005548 Bacteria 874
85 Ga0070704_100275548 3300005549 Bacteria 1392
86 Ga0070704_100976426 3300005549 Unclassified 765
87 Ga0070664_100252279 3300005564 Bacteria 1586
88 Ga0070664_100873593 3300005564 Bacteria 842
89 Ga0068857_100242725 3300005577 Unclassified 1650
90 Ga0068857_101113978 3300005577 Unclassified 762
91 Ga0068857_101576895 3300005577 Unclassified 641
92 Ga0068854_101671105 3300005578 Unclassified 582
93 Ga0070702_100161751 3300005615 Bacteria 1448
94 Ga0070702_100295785 3300005615 Bacteria 1118
95 Ga0070702_101055343 3300005615 Unclassified 646
96 Ga0068852_101547539 3300005616 Unclassified 685
97 Ga0068859_100012062 3300005617 Bacteria 8683
98 Ga0068859_100088309 3300005617 Bacteria 3149
99 Ga0068859_100088550 3300005617 Bacteria 3145
100 Ga0068859_100226499 3300005617 Bacteria 1957
101 Ga0068859_100704202 3300005617 Unclassified 1100
102 Ga0068859_100704245 3300005617 Bacteria 1100
103 Ga0068864_100003653 3300005618 Bacteria 12718
104 Ga0068864_100038506 3300005618 Bacteria 4084
105 Ga0068864_100350794 3300005618 Bacteria 1392
106 Ga0068864_101221463 3300005618 Unclassified 751
107 Ga0068864_101229917 3300005618 Bacteria 748
108 Ga0068864_101933967 3300005618 Unclassified 596
109 Ga0068861_100006754 3300005719 Bacteria 7841
110 Ga0068861_100268822 3300005719 Bacteria 1463
111 Ga0068861_102486581 3300005719 Unclassified 521
112 Ga0068851_10017471 3300005834 Bacteria 3446
113 Ga0068851_10247230 3300005834 Bacteria 1011
114 Ga0068851_10376228 3300005834 Unclassified 831
115 Ga0068870_10023580 3300005840 Bacteria 3036
116 Ga0068863_100046962 3300005841 Bacteria 4098
117 Ga0068863_100503817 3300005841 Unclassified 1192
118 Ga0068858_100038503 3300005842 Bacteria 4435
119 Ga0068858_100124225 3300005842 Bacteria 2416
120 Ga0068858_100412955 3300005842 Unclassified 1297
121 Ga0068858_100785922 3300005842 Unclassified 928
122 Ga0068858_100894109 3300005842 Unclassified 868
123 Ga0068858_101097170 3300005842 Unclassified 781
124 Ga0068858_101403949 3300005842 Unclassified 688
125 Ga0068860_100274828 3300005843 Bacteria 1645
126 Ga0068860_100302962 3300005843 Unclassified 1566
127 Ga0068860_100844409 3300005843 Bacteria 930
128 Ga0068860_101164206 3300005843 Unclassified 791
129 Ga0068862_101291323 3300005844 Unclassified 731
130 Ga0081455_10910690 3300005937 Unclassified 547
131 Ga0081539_10003751 3300005985 Bacteria 18049
132 Ga0070716_100263936 3300006173 Bacteria 1180
133 Ga0097621_100171585 3300006237 Unclassified 1870
134 Ga0068871_100824054 3300006358 Bacteria 856
135 Ga0075428_100414519 3300006844 Bacteria 1443
136 Ga0075428_101169100 3300006844 Bacteria 811
137 Ga0075428_101610306 3300006844 Unclassified 679
138 Ga0075430_100062015 3300006846 Bacteria 3141
139 Ga0075430_100098592 3300006846 Bacteria 2441
140 Ga0075431_100305785 3300006847 Unclassified 1606
141 Ga0075431_100718924 3300006847 Unclassified 976
142 Ga0075433_10042245 3300006852 Bacteria 3954
143 Ga0075433_10243431 3300006852 Unclassified 1597
144 Ga0075433_10300999 3300006852 Unclassified 1420
145 Ga0075433_10582712 3300006852 Unclassified 982
146 Ga0075433_11076533 3300006852 Unclassified 699
147 Ga0075434_100029971 3300006871 Bacteria 5356
148 Ga0075434_100186634 3300006871 Bacteria 2094
149 Ga0075429_100037218 3300006880 Unclassified 4236
150 Ga0075429_100099109 3300006880 Bacteria 2542
151 Ga0097620_100012062 3300006931 Bacteria 8683
152 Ga0097620_100088308 3300006931 Bacteria 3149
153 Ga0097620_100088550 3300006931 Bacteria 3145
154 Ga0097620_100226495 3300006931 Bacteria 1957
155 Ga0097620_100704189 3300006931 Unclassified 1100
156 Ga0097620_100704265 3300006931 Bacteria 1100
157 Ga0097620_102365239 3300006931 Unclassified 586
158 Ga0105251_10129258 3300009011 Unclassified 1145
159 Ga0105240_10207491 3300009093 Bacteria 2292
160 Ga0105240_11640797 3300009093 Bacteria 672
161 Ga0111539_10072578 3300009094 Unclassified 4059
162 Ga0111539_10619093 3300009094 Bacteria 1261
163 Ga0105247_10072435 3300009101 Unclassified 2157
164 Ga0105247_10283967 3300009101 Unclassified 1143
165 Ga0105247_10671557 3300009101 Unclassified 777
166 Ga0114129_10005287 3300009147 Bacteria 18217
167 Ga0114129_10027868 3300009147 Bacteria 7999
168 Ga0114129_10035685 3300009147 Bacteria 7024
169 Ga0114129_10170643 3300009147 Unclassified 2966
170 Ga0114129_10195542 3300009147 Bacteria 2743
171 Ga0114129_10939140 3300009147 Bacteria 1093
172 Ga0114129_11175724 3300009147 Unclassified 957
173 Ga0114129_11269206 3300009147 Unclassified 914
174 Ga0105243_10548850 3300009148 Bacteria 1104
175 Ga0105243_11606745 3300009148 Unclassified 677
176 Ga0105241_10104498 3300009174 Bacteria 2257
177 Ga0105241_10123008 3300009174 Bacteria 2092
178 Ga0105241_10162692 3300009174 Unclassified 1836
179 Ga0105241_10307185 3300009174 Bacteria 1363
180 Ga0105241_10309221 3300009174 Unclassified 1359
181 Ga0105241_10314383 3300009174 Bacteria 1348
182 Ga0105241_10415732 3300009174 Unclassified 1182
183 Ga0105241_11287003 3300009174 Unclassified 696
184 Ga0105242_10254950 3300009176 Bacteria 1582
185 Ga0105242_10929200 3300009176 Unclassified 872
186 Ga0105242_13001336 3300009176 Unclassified 522
187 Ga0105248_10003960 3300009177 Bacteria 16380
188 Ga0105248_10004713 3300009177 Bacteria 15092
189 Ga0105248_10009706 3300009177 Bacteria 10601
190 Ga0105248_10158934 3300009177 Unclassified 2550
191 Ga0105248_10186896 3300009177 Bacteria 2335
192 Ga0105248_10334029 3300009177 Bacteria 1707
193 Ga0105248_10652006 3300009177 Unclassified 1188
194 Ga0105248_11372903 3300009177 Unclassified 799
195 Ga0105248_12764813 3300009177 Unclassified 560
196 Ga0105237_10000218 3300009545 Bacteria 80923
197 Ga0105237_11368745 3300009545 Bacteria 714
198 Ga0105249_10579523 3300009553 Unclassified 1175
199 Ga0105249_10776453 3300009553 Unclassified 1021
200 Ga0105239_10130040 3300010375 Unclassified 2800
201 Ga0105239_10610936 3300010375 Bacteria 1244
202 Ga0105239_11157002 3300010375 Bacteria 891
203 Ga0105239_13405389 3300010375 Unclassified 517
204 Ga0105246_10138404 3300011119 Bacteria 1827
205 Ga0105246_10161990 3300011119 Bacteria 1705
206 Ga0105246_10184885 3300011119 Bacteria 1608
207 Ga0105246_10186137 3300011119 Unclassified 1603
208 Ga0157373_10003516 3300013100 Bacteria 11845
209 Ga0157373_10203951 3300013100 Bacteria 1394
210 Ga0157373_10364058 3300013100 Bacteria 1033
211 Ga0157373_10725287 3300013100 Unclassified 729
212 Ga0157374_10043193 3300013296 Bacteria 4163
213 Ga0157374_12617485 3300013296 Unclassified 532
214 Ga0157378_10220353 3300013297 Bacteria 1803
215 Ga0157378_10378696 3300013297 Bacteria 1389
216 Ga0163162_10001781 3300013306 Bacteria 20195
217 Ga0163162_10041264 3300013306 Unclassified 4616
218 Ga0163162_10109030 3300013306 Bacteria 2865
219 Ga0157372_10003659 3300013307 Bacteria 16524
220 Ga0157372_10515404 3300013307 Bacteria 1394
221 Ga0157372_11071197 3300013307 Unclassified 933
222 Ga0157372_11849867 3300013307 Unclassified 694
223 Ga0157372_12051322 3300013307 Unclassified 657
224 Ga0157375_10004640 3300013308 Bacteria 11943
225 Ga0157375_10187794 3300013308 Bacteria 2221
226 Ga0157375_10335010 3300013308 Bacteria 1678
227 Ga0157375_10745965 3300013308 Unclassified 1131
228 Ga0157375_12635108 3300013308 Bacteria 601
229 Ga0157375_13698052 3300013308 Unclassified 509
230 Ga0163163_10004770 3300014325 Bacteria 11634
231 Ga0163163_10007150 3300014325 Bacteria 9819
232 Ga0163163_10023305 3300014325 Bacteria 5873
233 Ga0163163_10080952 3300014325 Bacteria 3248
234 Ga0163163_10282246 3300014325 Unclassified 1712
235 Ga0163163_10482720 3300014325 Bacteria 1300
236 Ga0163163_10787659 3300014325 Bacteria 1014
237 Ga0157380_10001508 3300014326 Bacteria 15268
238 Ga0157380_10339866 3300014326 Bacteria 1400
239 Ga0157380_10732757 3300014326 Unclassified 998
240 Ga0157380_11241905 3300014326 Unclassified 790
241 Ga0157377_10239513 3300014745 Unclassified 1170
242 Ga0157377_10616872 3300014745 Unclassified 776
243 Ga0157377_10670252 3300014745 Unclassified 749
244 Ga0157379_10120549 3300014968 Bacteria 2359
245 Ga0157379_10660057 3300014968 Viruses 980
246 Ga0157379_11810209 3300014968 Unclassified 600
247 Ga0157376_10054357 3300014969 Bacteria 3338
248 Ga0157376_10260872 3300014969 Bacteria 1623
249 Ga0182007_10171529 3300015262 Unclassified 746
250 Ga0182005_1270628 3300015265 Bacteria 531
251 Ga0207656_10006073 3300025321 Bacteria 4322
252 Ga0207653_10002952 3300025885 Bacteria 5397
253 Ga0207710_10037922 3300025900 Bacteria 2130
254 Ga0207710_10254744 3300025900 Unclassified 878
255 Ga0207688_10295238 3300025901 Unclassified 990
256 Ga0207645_10594709 3300025907 Unclassified 751
257 Ga0207643_10002208 3300025908 Bacteria 10605
258 Ga0207643_10461221 3300025908 Bacteria 809
259 Ga0207684_10000704 3300025910 Bacteria 39445
260 Ga0207684_10062269 3300025910 Bacteria 3168
261 Ga0207654_10247973 3300025911 Bacteria 1192
262 Ga0207654_10840155 3300025911 Unclassified 664
263 Ga0207707_10000050 3300025912 Bacteria 117404
264 Ga0207707_10023668 3300025912 Bacteria 5371
265 Ga0207671_10026421 3300025914 Unclassified 4351
266 Ga0207662_10122719 3300025918 Unclassified 1630
267 Ga0207662_10150082 3300025918 Unclassified 1482
268 Ga0207649_10250293 3300025920 Bacteria 1276
269 Ga0207649_10346893 3300025920 Bacteria 1098
270 Ga0207649_10637646 3300025920 Bacteria 822
271 Ga0207649_10755024 3300025920 Bacteria 757
272 Ga0207652_10000170 3300025921 Bacteria 70017
273 Ga0207681_10637406 3300025923 Bacteria 883
274 Ga0207650_10228380 3300025925 Unclassified 1500
275 Ga0207650_10273999 3300025925 Unclassified 1372
276 Ga0207690_11213099 3300025932 Unclassified 630
277 Ga0207686_10012213 3300025934 Unclassified 4718
278 Ga0207686_10497328 3300025934 Unclassified 945
279 Ga0207709_10007813 3300025935 Bacteria 5927
280 Ga0207670_10000411 3300025936 Bacteria 24367
281 Ga0207704_10641312 3300025938 Viruses 874
282 Ga0207665_10131805 3300025939 Unclassified 1775
283 Ga0207691_10067002 3300025940 Bacteria 3247
284 Ga0207691_10876707 3300025940 Unclassified 752
285 Ga0207691_11100110 3300025940 Unclassified 661
286 Ga0207711_10008164 3300025941 Bacteria 8764
287 Ga0207711_10647727 3300025941 Unclassified 986
288 Ga0207711_11246567 3300025941 Unclassified 685
289 Ga0207689_10440428 3300025942 Unclassified 1088
290 Ga0207689_10615436 3300025942 Unclassified 914
291 Ga0207679_10900827 3300025945 Unclassified 809
292 Ga0207651_10247748 3300025960 Unclassified 1456
293 Ga0207651_10648170 3300025960 Unclassified 927
294 Ga0207651_11250154 3300025960 Unclassified 667
295 Ga0207651_11375215 3300025960 Bacteria 635
296 Ga0207640_10080712 3300025981 Bacteria 2221
297 Ga0207640_10847331 3300025981 Unclassified 795
298 Ga0207640_11379750 3300025981 Unclassified 631
299 Ga0207677_10639879 3300026023 Unclassified 937
300 Ga0207677_10802290 3300026023 Unclassified 843
301 Ga0207703_10014576 3300026035 Bacteria 6134
302 Ga0207703_10203502 3300026035 Unclassified 1760
303 Ga0207708_10000130 3300026075 Bacteria 58987
304 Ga0207708_10036670 3300026075 Bacteria 3733
305 Ga0207641_10068382 3300026088 Bacteria 3045
306 Ga0207641_10490633 3300026088 Bacteria 1192
307 Ga0207648_10120012 3300026089 Bacteria 2311
308 Ga0207648_10328617 3300026089 Bacteria 1375
309 Ga0207648_10405182 3300026089 Unclassified 1236
310 Ga0207676_10030190 3300026095 Unclassified 4066
311 Ga0207676_11113329 3300026095 Unclassified 781
312 Ga0207676_12228304 3300026095 Unclassified 546
313 Ga0207674_10121359 3300026116 Bacteria 2581
314 Ga0207674_10642330 3300026116 Bacteria 1025
315 Ga0207675_100029042 3300026118 Bacteria 5153
316 Ga0207675_100363843 3300026118 Bacteria 1419
317 Ga0207683_11371188 3300026121 Bacteria 654
318 Ga0207698_10403297 3300026142 Bacteria 1307
319 Ga0207428_10053272 3300027907 Unclassified 3227
320 Ga0268265_10960859 3300028380 Unclassified 842
321 Ga0268265_11883974 3300028380 Unclassified 605
322 Ga0268264_10487401 3300028381 Unclassified 1200
323 Ga0268264_11001136 3300028381 Unclassified 842
324 Ga0268264_11116546 3300028381 Unclassified 797
325 Ga0307408_100033757 3300031548 Bacteria 3578
326 Ga0307413_10698712 3300031824 Bacteria 842
327 Ga0307410_10986049 3300031852 Unclassified 726
328 Ga0307406_10263285 3300031901 Unclassified 1306
329 Ga0307407_10141765 3300031903 Bacteria 1551
330 Ga0307412_10002344 3300031911 Bacteria 10489
331 Ga0307412_10018161 3300031911 Bacteria 4225
332 Ga0307409_101997119 3300031995 Unclassified 609
333 Ga0307416_100011472 3300032002 Bacteria 5913
334 Ga0307416_100228217 3300032002 Unclassified 1793
335 Ga0307411_10184514 3300032005 Unclassified 1587
336 Ga0307411_10376676 3300032005 Bacteria 1166
337 Ga0307415_100110751 3300032126 Bacteria 2036
338 Ga0373930_0054771 3300034816 Bacteria 879
339 Ga0373930_0115525 3300034816 Unclassified 649
340 Ga0373930_0164422 3300034816 Unclassified 563
341 Ga0373940_0019452 3300035088 Bacteria 1716
342 Ga0373940_0195611 3300035088 Unclassified 663
343 Ga0373949_0019273 3300035090 Bacteria 1553
344 Ga0373951_0003682 3300035091 Bacteria 3698
345 Ga0373952_0048822 3300035092 Unclassified 1002
346 Ga0373939_0090964 3300035114 Bacteria 1031
347 Ga0373941_0233760 3300035115 Unclassified 711
348 Ga0373942_0028923 3300035207 Bacteria 1451
349 Ga0373962_0176905 3300035242 Unclassified 712
350 Ga0373931_0565366 3300035691 Unclassified 740
351 Ga0395899_0346505 3300037312 Unclassified 995
352 Ga0395900_0246517 3300037418 Bacteria 1790
353 Ga0395900_0902510 3300037418 Unclassified 807
354 Ga0395900_1594996 3300037418 Unclassified 564
355 Ga0395898_0130872 3300037466 Unclassified 2404
356 Ga0395898_0955345 3300037466 Unclassified 794
357 Ga0395905_1420841 3300037471 Unclassified 598
358 Ga0242419_002641 3300038698 Bacteria 1175
359 Ga0242420_010297 3300038996 Bacteria 1550
360 Ga0242420_027179 3300038996 Bacteria 1047
361 Ga0439436_0097755 3300041404 Unclassified 818
362 Ga0451807_0728375 3300041486 Unclassified 586
363 Ga0439448_0033257 3300042005 Unclassified 1645
364 Ga0450889_014253 3300042144 Unclassified 846
365 Ga0439458_0008285 3300042157 Bacteria 2313
366 Ga0439459_0090154 3300042438 Unclassified 736
367 Ga0439464_0097405 3300042439 Unclassified 891
368 Ga0451576_0463459 3300045051 Unclassified 1331
369 Ga0451576_0840800 3300045051 Bacteria 964
370 Ga0451576_1031786 3300045051 Unclassified 862
371 Ga0451576_1282489 3300045051 Bacteria 764
372 Ga0451576_1708602 3300045051 Bacteria 652
373 Ga0495582_0024952 3300046473 Bacteria 3274
374 Ga0495643_0260892 3300046522 Unclassified 805
375 Ga0495658_0159303 3300046683 Unclassified 1391
376 Ga0496101_1011467 3300048904 Unclassified 654
377 Ga0496102_1138843 3300048905 Unclassified 700
378 Ga0496103_0753159 3300048906 Unclassified 616
379 Ga0496104_0673515 3300048907 Unclassified 943
380 Ga0496104_0726743 3300048907 Unclassified 900
381 Ga0496106_0043744 3300048909 Bacteria 3361
382 Ga0496106_0484755 3300048909 Unclassified 993
383 Ga0496107_0550524 3300048910 Unclassified 854
384 Ga0496108_0266108 3300048911 Bacteria 1492
385 Ga0496108_0530007 3300048911 Unclassified 1028
386 Ga0496108_0847639 3300048911 Unclassified 787
387 Ga0496108_0917616 3300048911 Unclassified 751
388 Ga0496109_0998103 3300048912 Unclassified 775
389 Ga0496110_0529316 3300048913 Bacteria 1072
390 Ga0496112_0042112 3300048915 Bacteria 4468
391 Ga0496112_0278693 3300048915 Bacteria 1620
392 Ga0496112_0327586 3300048915 Unclassified 1476
393 Ga0496112_0469912 3300048915 Unclassified 1195
394 Ga0496112_0495236 3300048915 Unclassified 1158
395 Ga0496112_0712929 3300048915 Unclassified 931
396 Ga0496113_0414319 3300048916 Unclassified 1082
397 Ga0501291_006885 3300049514 Bacteria 1527
398 Ga0501291_011315 3300049514 Bacteria 1284
399 Ga0501291_120497 3300049514 Unclassified 568
400 Ga0501291_141355 3300049514 Unclassified 537
401 Ga0501292_003900 3300049515 Unclassified 2015
402 Ga0501295_064273 3300049518 Unclassified 809
403 Ga0501296_000282 3300049519 Bacteria 5230
404 Ga0501296_052418 3300049519 Bacteria 600
405 Ga0501297_006153 3300049520 Bacteria 1275
406 Ga0501298_000267 3300049521 Bacteria 6798
407 Ga0501298_001215 3300049521 Bacteria 3750
408 Ga0501298_059649 3300049521 Unclassified 806
409 Ga0501299_017802 3300049522 Bacteria 1271
410 Ga0501299_105736 3300049522 Unclassified 659
411 Ga0501300_017864 3300049523 Bacteria 1036
412 Ga0501300_053478 3300049523 Unclassified 627
413 Ga0501301_042568 3300049524 Unclassified 519
414 Ga0501303_016912 3300049526 Unclassified 743
415 Ga0501038_0000253 3300049574 Bacteria 45383
416 Ga0501048_0824358 3300049582 Bacteria 667
417 Ga0501068_1181048 3300049584 Unclassified 507
418 Ga0501077_0975501 3300049593 Unclassified 545
419 Ga0501198_010277 3300049649 Bacteria 1382
420 Ga0501202_006946 3300049652 Bacteria 2038
421 Ga0501202_029067 3300049652 Bacteria 1144
422 Ga0501202_038087 3300049652 Unclassified 1029
423 Ga0501206_003799 3300049653 Bacteria 1917
424 Ga0501206_005868 3300049653 Bacteria 1588
425 Ga0501207_004275 3300049654 Bacteria 1934
426 Ga0501209_079043 3300049656 Unclassified 946
427 Ga0501214_002822 3300049659 Bacteria 1494
428 Ga0501216_003988 3300049660 Bacteria 2173
429 Ga0501217_000895 3300049661 Bacteria 5312
430 Ga0501217_021214 3300049661 Bacteria 1532
431 Ga0501217_075045 3300049661 Unclassified 927
432 Ga0501223_003524 3300049663 Bacteria 3396
433 Ga0501223_009462 3300049663 Bacteria 1974
434 Ga0501223_036905 3300049663 Unclassified 950
435 Ga0501224_021069 3300049664 Unclassified 971
436 Ga0501227_016907 3300049665 Bacteria 1642
437 Ga0501227_016987 3300049665 Bacteria 1639
438 Ga0501227_116257 3300049665 Unclassified 720
439 Ga0501230_006226 3300049667 Bacteria 1723
440 Ga0501230_047160 3300049667 Bacteria 849
441 Ga0501233_001770 3300049668 Bacteria 3728
442 Ga0501233_012557 3300049668 Bacteria 1703
443 Ga0501233_128288 3300049668 Unclassified 691
444 Ga0501235_001974 3300049669 Unclassified 4393
445 Ga0501235_012889 3300049669 Bacteria 1840
446 Ga0501235_035783 3300049669 Bacteria 1128
447 Ga0501236_037151 3300049670 Unclassified 794
448 Ga0501240_040074 3300049673 Unclassified 777
449 Ga0501242_004004 3300049674 Bacteria 1621
450 Ga0501243_099048 3300049675 Unclassified 586
451 Ga0501249_002427 3300049679 Unclassified 3768
452 Ga0501249_061689 3300049679 Bacteria 869
453 Ga0501250_005598 3300049680 Bacteria 1296
454 Ga0501250_021044 3300049680 Unclassified 845
455 Ga0501251_060162 3300049681 Unclassified 624
456 Ga0501252_094547 3300049682 Unclassified 510
457 Ga0501253_045306 3300049683 Unclassified 903
458 Ga0501253_163607 3300049683 Unclassified 569
459 Ga0501255_032429 3300049684 Bacteria 733
460 Ga0501257_063510 3300049686 Unclassified 935
461 Ga0501259_003342 3300049688 Bacteria 2563
462 Ga0501259_006744 3300049688 Bacteria 1830
463 Ga0501259_029879 3300049688 Unclassified 1022
464 Ga0501260_001971 3300049689 Unclassified 1740
465 Ga0501260_025547 3300049689 Unclassified 659
466 Ga0501261_028849 3300049690 Unclassified 831
467 Ga0501261_039254 3300049690 Unclassified 741
468 Ga0501261_082814 3300049690 Unclassified 583
469 Ga0501221_019701 3300049704 Bacteria 1312
470 Ga0501225_0000908 3300049705 Bacteria 9216
471 Ga0501225_0013521 3300049705 Bacteria 2284
472 Ga0501225_0062848 3300049705 Unclassified 1046
473 Ga0501234_006122 3300049707 Bacteria 1884
474 Ga0501234_010835 3300049707 Bacteria 1421
475 Ga0501234_018995 3300049707 Bacteria 1088
476 Ga0501234_030597 3300049707 Unclassified 869
477 Ga0501245_029694 3300049708 Bacteria 898
478 Ga0501245_054529 3300049708 Unclassified 716
479 Ga0501241_019831 3300049758 Bacteria 1236
480 Ga0501262_010847 3300049759 Bacteria 1145
481 Ga0501263_016675 3300049760 Bacteria 958
482 Ga0501264_028125 3300049761 Unclassified 633
483 Ga0501266_028420 3300049763 Bacteria 789
484 Ga0501266_029474 3300049763 Unclassified 778
485 Ga0501270_143583 3300049767 Unclassified 538
486 Ga0501271_005289 3300049768 Bacteria 1253
487 Ga0501271_055593 3300049768 Unclassified 546
488 Ga0501273_006382 3300049770 Unclassified 1363
489 Ga0501275_008172 3300049772 Bacteria 1071
490 Ga0501279_009656 3300049775 Bacteria 1294
491 Ga0501279_019663 3300049775 Unclassified 956
492 Ga0501279_043059 3300049775 Unclassified 698
493 Ga0501283_022264 3300049779 Unclassified 1021
494 Ga0501283_030929 3300049779 Bacteria 897
495 Ga0501204_006583 3300049850 Bacteria 1293
496 Ga0501212_001517 3300049851 Bacteria 2630
497 Ga0501212_062178 3300049851 Unclassified 648
498 Ga0501226_001043 3300049853 Bacteria 3590
499 nmdc:mga05p37_123328_c1 3300050507 Bacteria 3182
500 nmdc:mga05p37_1288319_c1 3300050507 Bacteria 746
501 nmdc:mga05p37_160816_c1 3300050507 Bacteria 2743
502 nmdc:mga05p37_290621_c1 3300050507 Bacteria 1946
503 nmdc:mga05p37_42760_c1 3300050507 Bacteria 5569
504 nmdc:mga05p37_843709_c1 3300050507 Bacteria 996
505 nmdc:mga09592_502114_c1 3300050508 Unclassified 1044
506 nmdc:mga09592_798248_c1 3300050508 Bacteria 799
507 nmdc:mga0qj67_137229_c1 3300050509 Bacteria 1982
508 nmdc:mga06r32_122023_c2 3300050510 Bacteria 1901
509 nmdc:mga06r32_68185_c1 3300050510 Bacteria 3436
510 nmdc:mga08y16_106967_c1 3300050511 Bacteria 2911
511 nmdc:mga08y16_78707_c1 3300050511 Bacteria 3437
512 nmdc:mga0n895_101294_c1 3300050512 Bacteria 2890
513 nmdc:mga0n895_397694_c1 3300050512 Unclassified 1393
514 nmdc:mga0n895_520888_c1 3300050512 Bacteria 1196
515 nmdc:mga0n895_995947_c1 3300050512 Unclassified 819
516 nmdc:mga0rr50_65054_c1 3300050513 Unclassified 2761
517 nmdc:mga08x19_30486_c1 3300050514 Bacteria 3388
518 nmdc:mga0a205_1415875_c1 3300050515 Bacteria 543
519 nmdc:mga0a205_16663_c1 3300050515 Bacteria 6883
520 nmdc:mga0a205_168063_c1 3300050515 Bacteria 2089
521 nmdc:mga0a205_260922_c1 3300050515 Bacteria 1610
522 nmdc:mga0a205_29833_c1 3300050515 Bacteria 5219
523 nmdc:mga0a205_764969_c1 3300050515 Unclassified 814
524 nmdc:mga0a205_8701_c1 3300050515 Bacteria 9243
525 Ga0587084_089190 3300059477 Unclassified 609
526 Ga0530510_0027540 3300061734 Unclassified 4072
527 Ga0068852_101399826
528 JGI25406J46586_10167017
529 JGI25406J46586_10183362
530 Ga0065714_10064478
531 Ga0065704_10109683
532 Ga0065704_10125594
533 Ga0065712_10000121
534 Ga0065712_10287493
535 Ga0065715_10022813
536 Ga0065715_10162772
537 Ga0070690_100918041
538 Ga0070670_100928507
539 Ga0070670_101143510
540 Ga0068869_100452085
541 Ga0070680_100017998
542 Ga0070680_100477365
543 Ga0070680_101123161
544 Ga0070689_100001007
545 Ga0070689_100833661
546 Ga0070689_101093471
547 Ga0070687_101405260
548 Ga0070661_100459047
549 Ga0070661_100534165
550 Ga0070661_100880598
551 Ga0070692_10306853
552 Ga0070692_10387533
553 Ga0070692_10727824
554 Ga0070692_11029790
555 Ga0070668_100312247
556 Ga0070673_100747043
557 Ga0070673_101189261
558 Ga0070673_101363624
559 Ga0070673_101516384
560 Ga0070659_101415365
561 Ga0070705_100026001
562 Ga0070705_100103396
563 Ga0070705_100326546
564 Ga0070705_100537399
565 Ga0070705_100756889
566 Ga0070705_101213134
567 Ga0070700_100000068
568 Ga0070700_101031541
569 Ga0070700_101502055
570 Ga0070694_100012173
571 Ga0070694_100306264
572 Ga0070694_100317245
573 Ga0070694_100663136
574 Ga0070694_100674583
575 Ga0070694_101120649
576 Ga0070694_101497810
577 Ga0070694_101589488
578 Ga0070694_101672635
579 Ga0070663_101648216
580 Ga0070681_10002491
581 Ga0070681_10155647
582 Ga0068867_100148862
583 Ga0068867_100551255
584 Ga0070685_10516836
585 Ga0070685_10943499
586 Ga0070706_100292938
587 Ga0070707_100078827
588 Ga0070707_100444995
589 Ga0070698_100062150
590 Ga0070699_100002708
591 Ga0070699_101183518
592 Ga0070684_100853424
593 Ga0070684_101701623
594 Ga0070697_100711330
595 Ga0068853_100263973
596 Ga0068853_101731262
597 Ga0070672_101391652
598 Ga0070695_100052011
599 Ga0070695_100109451
600 Ga0070695_100448601
601 Ga0070695_100780662
602 Ga0070695_100904252
603 Ga0070695_101016395
604 Ga0070696_100087268
605 Ga0070693_100006779
606 Ga0070693_100166307
607 Ga0070693_100544790
608 Ga0070693_100813430
609 Ga0070693_101501498
610 Ga0070665_100945412
611 Ga0070704_100275548
612 Ga0070704_100976426
613 Ga0070664_100252279
614 Ga0070664_100873593
615 Ga0068857_100242725
616 Ga0068857_101113978
617 Ga0068857_101576895
618 Ga0068854_101671105
619 Ga0070702_100161751
620 Ga0070702_100295785
621 Ga0070702_101055343
622 Ga0068852_101547539
623 Ga0068859_100012062
624 Ga0068859_100088309
625 Ga0068859_100088550
626 Ga0068859_100226499
627 Ga0068859_100704202
628 Ga0068859_100704245
629 Ga0068864_100003653
630 Ga0068864_100038506
631 Ga0068864_100350794
632 Ga0068864_101221463
633 Ga0068864_101229917
634 Ga0068864_101933967
635 Ga0068861_100006754
636 Ga0068861_100268822
637 Ga0068861_102486581
638 Ga0068851_10017471
639 Ga0068851_10247230
640 Ga0068851_10376228
641 Ga0068870_10023580
642 Ga0068863_100046962
643 Ga0068863_100503817
644 Ga0068858_100038503
645 Ga0068858_100124225
646 Ga0068858_100412955
647 Ga0068858_100785922
648 Ga0068858_100894109
649 Ga0068858_101097170
650 Ga0068858_101403949
651 Ga0068860_100274828
652 Ga0068860_100302962
653 Ga0068860_100844409
654 Ga0068860_101164206
655 Ga0068862_101291323
656 Ga0081455_10910690
657 Ga0081539_10003751
658 Ga0070716_100263936
659 Ga0097621_100171585
660 Ga0068871_100824054
661 Ga0075428_100414519
662 Ga0075428_101169100
663 Ga0075428_101610306
664 Ga0075430_100062015
665 Ga0075430_100098592
666 Ga0075431_100305785
667 Ga0075431_100718924
668 Ga0075433_10042245
669 Ga0075433_10243431
670 Ga0075433_10300999
671 Ga0075433_10582712
672 Ga0075433_11076533
673 Ga0075434_100029971
674 Ga0075434_100186634
675 Ga0075429_100037218
676 Ga0075429_100099109
677 Ga0097620_100012062
678 Ga0097620_100088308
679 Ga0097620_100088550
680 Ga0097620_100226495
681 Ga0097620_100704189
682 Ga0097620_100704265
683 Ga0097620_102365239
684 Ga0105251_10129258
685 Ga0105240_10207491
686 Ga0105240_11640797
687 Ga0111539_10072578
688 Ga0111539_10619093
689 Ga0105247_10072435
690 Ga0105247_10283967
691 Ga0105247_10671557
692 Ga0114129_10005287
693 Ga0114129_10027868
694 Ga0114129_10035685
695 Ga0114129_10170643
696 Ga0114129_10195542
697 Ga0114129_10939140
698 Ga0114129_11175724
699 Ga0114129_11269206
700 Ga0105243_10548850
701 Ga0105243_11606745
702 Ga0105241_10104498
703 Ga0105241_10123008
704 Ga0105241_10162692
705 Ga0105241_10307185
706 Ga0105241_10309221
707 Ga0105241_10314383
708 Ga0105241_10415732
709 Ga0105241_11287003
710 Ga0105242_10254950
711 Ga0105242_10929200
712 Ga0105242_13001336
713 Ga0105248_10003960
714 Ga0105248_10004713
715 Ga0105248_10009706
716 Ga0105248_10158934
717 Ga0105248_10186896
718 Ga0105248_10334029
719 Ga0105248_10652006
720 Ga0105248_11372903
721 Ga0105248_12764813
722 Ga0105237_10000218
723 Ga0105237_11368745
724 Ga0105249_10579523
725 Ga0105249_10776453
726 Ga0105239_10130040
727 Ga0105239_10610936
728 Ga0105239_11157002
729 Ga0105239_13405389
730 Ga0105246_10138404
731 Ga0105246_10161990
732 Ga0105246_10184885
733 Ga0105246_10186137
734 Ga0157373_10003516
735 Ga0157373_10203951
736 Ga0157373_10364058
737 Ga0157373_10725287
738 Ga0157374_10043193
739 Ga0157374_12617485
740 Ga0157378_10220353
741 Ga0157378_10378696
742 Ga0163162_10001781
743 Ga0163162_10041264
744 Ga0163162_10109030
745 Ga0157372_10003659
746 Ga0157372_10515404
747 Ga0157372_11071197
748 Ga0157372_11849867
749 Ga0157372_12051322
750 Ga0157375_10004640
751 Ga0157375_10187794
752 Ga0157375_10335010
753 Ga0157375_10745965
754 Ga0157375_12635108
755 Ga0157375_13698052
756 Ga0163163_10004770
757 Ga0163163_10007150
758 Ga0163163_10023305
759 Ga0163163_10080952
760 Ga0163163_10282246
761 Ga0163163_10482720
762 Ga0163163_10787659
763 Ga0157380_10001508
764 Ga0157380_10339866
765 Ga0157380_10732757
766 Ga0157380_11241905
767 Ga0157377_10239513
768 Ga0157377_10616872
769 Ga0157377_10670252
770 Ga0157379_10120549
771 Ga0157379_10660057
772 Ga0157379_11810209
773 Ga0157376_10054357
774 Ga0157376_10260872
775 Ga0182007_10171529
776 Ga0182005_1270628
777 Ga0207656_10006073
778 Ga0207653_10002952
779 Ga0207710_10037922
780 Ga0207710_10254744
781 Ga0207688_10295238
782 Ga0207645_10594709
783 Ga0207643_10002208
784 Ga0207643_10461221
785 Ga0207684_10000704
786 Ga0207684_10062269
787 Ga0207654_10247973
788 Ga0207654_10840155
789 Ga0207707_10000050
790 Ga0207707_10023668
791 Ga0207671_10026421
792 Ga0207662_10122719
793 Ga0207662_10150082
794 Ga0207649_10250293
795 Ga0207649_10346893
796 Ga0207649_10637646
797 Ga0207649_10755024
798 Ga0207652_10000170
799 Ga0207681_10637406
800 Ga0207650_10228380
801 Ga0207650_10273999
802 Ga0207690_11213099
803 Ga0207686_10012213
804 Ga0207686_10497328
805 Ga0207709_10007813
806 Ga0207670_10000411
807 Ga0207704_10641312
808 Ga0207665_10131805
809 Ga0207691_10067002
810 Ga0207691_10876707
811 Ga0207691_11100110
812 Ga0207711_10008164
813 Ga0207711_10647727
814 Ga0207711_11246567
815 Ga0207689_10440428
816 Ga0207689_10615436
817 Ga0207679_10900827
818 Ga0207651_10247748
819 Ga0207651_10648170
820 Ga0207651_11250154
821 Ga0207651_11375215
822 Ga0207640_10080712
823 Ga0207640_10847331
824 Ga0207640_11379750
825 Ga0207677_10639879
826 Ga0207677_10802290
827 Ga0207703_10014576
828 Ga0207703_10203502
829 Ga0207708_10000130
830 Ga0207708_10036670
831 Ga0207641_10068382
832 Ga0207641_10490633
833 Ga0207648_10120012
834 Ga0207648_10328617
835 Ga0207648_10405182
836 Ga0207676_10030190
837 Ga0207676_11113329
838 Ga0207676_12228304
839 Ga0207674_10121359
840 Ga0207674_10642330
841 Ga0207675_100029042
842 Ga0207675_100363843
843 Ga0207683_11371188
844 Ga0207698_10403297
845 Ga0207428_10053272
846 Ga0268265_10960859
847 Ga0268265_11883974
848 Ga0268264_10487401
849 Ga0268264_11001136
850 Ga0268264_11116546
851 Ga0307408_100033757
852 Ga0307413_10698712
853 Ga0307410_10986049
854 Ga0307406_10263285
855 Ga0307407_10141765
856 Ga0307412_10002344
857 Ga0307412_10018161
858 Ga0307409_101997119
859 Ga0307416_100011472
860 Ga0307416_100228217
861 Ga0307411_10184514
862 Ga0307411_10376676
863 Ga0307415_100110751
864 Ga0373930_0054771
865 Ga0373930_0115525
866 Ga0373930_0164422
867 Ga0373940_0019452
868 Ga0373940_0195611
869 Ga0373949_0019273
870 Ga0373951_0003682
871 Ga0373952_0048822
872 Ga0373939_0090964
873 Ga0373941_0233760
874 Ga0373942_0028923
875 Ga0373962_0176905
876 Ga0373931_0565366
877 Ga0395899_0346505
878 Ga0395900_0246517
879 Ga0395900_0902510
880 Ga0395900_1594996
881 Ga0395898_0130872
882 Ga0395898_0955345
883 Ga0395905_1420841
884 Ga0242419_002641
885 Ga0242420_010297
886 Ga0242420_027179
887 Ga0439436_0097755
888 Ga0451807_0728375
889 Ga0439448_0033257
890 Ga0450889_014253
891 Ga0439458_0008285
892 Ga0439459_0090154
893 Ga0439464_0097405
894 Ga0451576_0463459
895 Ga0451576_0840800
896 Ga0451576_1031786
897 Ga0451576_1282489
898 Ga0451576_1708602
899 Ga0495582_0024952
900 Ga0495643_0260892
901 Ga0495658_0159303
902 Ga0496101_1011467
903 Ga0496102_1138843
904 Ga0496103_0753159
905 Ga0496104_0673515
906 Ga0496104_0726743
907 Ga0496106_0043744
908 Ga0496106_0484755
909 Ga0496107_0550524
910 Ga0496108_0266108
911 Ga0496108_0530007
912 Ga0496108_0847639
913 Ga0496108_0917616
914 Ga0496109_0998103
915 Ga0496110_0529316
916 Ga0496112_0042112
917 Ga0496112_0278693
918 Ga0496112_0327586
919 Ga0496112_0469912
920 Ga0496112_0495236
921 Ga0496112_0712929
922 Ga0496113_0414319
923 Ga0501291_006885
924 Ga0501291_011315
925 Ga0501291_120497
926 Ga0501291_141355
927 Ga0501292_003900
928 Ga0501295_064273
929 Ga0501296_000282
930 Ga0501296_052418
931 Ga0501297_006153
932 Ga0501298_000267
933 Ga0501298_001215
934 Ga0501298_059649
935 Ga0501299_017802
936 Ga0501299_105736
937 Ga0501300_017864
938 Ga0501300_053478
939 Ga0501301_042568
940 Ga0501303_016912
941 Ga0501038_0000253
942 Ga0501048_0824358
943 Ga0501068_1181048
944 Ga0501077_0975501
945 Ga0501198_010277
946 Ga0501202_006946
947 Ga0501202_029067
948 Ga0501202_038087
949 Ga0501206_003799
950 Ga0501206_005868
951 Ga0501207_004275
952 Ga0501209_079043
953 Ga0501214_002822
954 Ga0501216_003988
955 Ga0501217_000895
956 Ga0501217_021214
957 Ga0501217_075045
958 Ga0501223_003524
959 Ga0501223_009462
960 Ga0501223_036905
961 Ga0501224_021069
962 Ga0501227_016907
963 Ga0501227_016987
964 Ga0501227_116257
965 Ga0501230_006226
966 Ga0501230_047160
967 Ga0501233_001770
968 Ga0501233_012557
969 Ga0501233_128288
970 Ga0501235_001974
971 Ga0501235_012889
972 Ga0501235_035783
973 Ga0501236_037151
974 Ga0501240_040074
975 Ga0501242_004004
976 Ga0501243_099048
977 Ga0501249_002427
978 Ga0501249_061689
979 Ga0501250_005598
980 Ga0501250_021044
981 Ga0501251_060162
982 Ga0501252_094547
983 Ga0501253_045306
984 Ga0501253_163607
985 Ga0501255_032429
986 Ga0501257_063510
987 Ga0501259_003342
988 Ga0501259_006744
989 Ga0501259_029879
990 Ga0501260_001971
991 Ga0501260_025547
992 Ga0501261_028849
993 Ga0501261_039254
994 Ga0501261_082814
995 Ga0501221_019701
996 Ga0501225_0000908
997 Ga0501225_0013521
998 Ga0501225_0062848
999 Ga0501234_006122
1000 Ga0501234_010835
1001 Ga0501234_018995
1002 Ga0501234_030597
1003 Ga0501245_029694
1004 Ga0501245_054529
1005 Ga0501241_019831
1006 Ga0501262_010847
1007 Ga0501263_016675
1008 Ga0501264_028125
1009 Ga0501266_028420
1010 Ga0501266_029474
1011 Ga0501270_143583
1012 Ga0501271_005289
1013 Ga0501271_055593
1014 Ga0501273_006382
1015 Ga0501275_008172
1016 Ga0501279_009656
1017 Ga0501279_019663
1018 Ga0501279_043059
1019 Ga0501283_022264
1020 Ga0501283_030929
1021 Ga0501204_006583
1022 Ga0501212_001517
1023 Ga0501212_062178
1024 Ga0501226_001043
1025 nmdc:mga05p37_123328_c1
1026 nmdc:mga05p37_1288319_c1
1027 nmdc:mga05p37_160816_c1
1028 nmdc:mga05p37_290621_c1
1029 nmdc:mga05p37_42760_c1
1030 nmdc:mga05p37_843709_c1
1031 nmdc:mga09592_502114_c1
1032 nmdc:mga09592_798248_c1
1033 nmdc:mga0qj67_137229_c1
1034 nmdc:mga06r32_122023_c2
1035 nmdc:mga06r32_68185_c1
1036 nmdc:mga08y16_106967_c1
1037 nmdc:mga08y16_78707_c1
1038 nmdc:mga0n895_101294_c1
1039 nmdc:mga0n895_397694_c1
1040 nmdc:mga0n895_520888_c1
1041 nmdc:mga0n895_995947_c1
1042 nmdc:mga0rr50_65054_c1
1043 nmdc:mga08x19_30486_c1
1044 nmdc:mga0a205_1415875_c1
1045 nmdc:mga0a205_16663_c1
1046 nmdc:mga0a205_168063_c1
1047 nmdc:mga0a205_260922_c1
1048 nmdc:mga0a205_29833_c1
1049 nmdc:mga0a205_764969_c1
1050 nmdc:mga0a205_8701_c1
1051 Ga0587084_089190
1052 Ga0530510_0027540

MSA Aligner

Family Sequences

Map