F459382
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 526 | 247 | 1052 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300005616|Ga0068852_101399826|Ga0068852_1013998262 |
| Length | 139 |
| Sequence | LENNGVQYRSSLSARLSVVFYIILCFEIGVFLTVLPWWPQGMWGLSDWGNNYFLLYAARKTGQGLQTVVASGWVRGAVTGVGLLNLGMAFWEIFHFNQTVRALDSQAGSQVRPTGNGTETGTTDHVSDNERPNISDNNA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 24 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 57 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 58 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 59 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 88 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 89 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 134 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 135 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 136 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 137 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 138 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 139 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 140 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 143 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 144 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 145 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 146 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 148 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038698 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 | Metagenome | Rhizosphere |
| 154 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 155 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 156 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 157 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 158 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 159 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 160 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 161 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 162 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 163 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 167 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 168 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 169 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 170 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 171 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 172 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 173 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 174 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 175 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 176 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 177 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 178 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 179 | 3300049518 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control | Metagenome | Rhizosphere |
| 180 | 3300049519 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought | Metagenome | Rhizosphere |
| 181 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 182 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 183 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 184 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 185 | 3300049524 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control | Metagenome | Rhizosphere |
| 186 | 3300049526 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control | Metagenome | Rhizosphere |
| 187 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 188 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 189 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 192 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 193 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 194 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 195 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 196 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 197 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 198 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 199 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 200 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 201 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 202 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 203 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 204 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 205 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 206 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 207 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 208 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 209 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 210 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 211 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 213 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 215 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 216 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 217 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 218 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 219 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 220 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 221 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 222 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 223 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 224 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 225 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 226 | 3300049761 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control | Metagenome | Rhizosphere |
| 227 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 228 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 229 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 230 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 231 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 232 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 233 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 234 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 235 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 236 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.18 |
| Rhizosphere | 95.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 48.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068852_101399826 | 3300005616 | Bacteria | 721 |
| 2 | JGI25406J46586_10167017 | 3300003203 | Unclassified | 641 |
| 3 | JGI25406J46586_10183362 | 3300003203 | Unclassified | 610 |
| 4 | Ga0065714_10064478 | 3300005288 | Bacteria | 56205 |
| 5 | Ga0065704_10109683 | 3300005289 | Unclassified | 1998 |
| 6 | Ga0065704_10125594 | 3300005289 | Unclassified | 1701 |
| 7 | Ga0065712_10000121 | 3300005290 | Bacteria | 103063 |
| 8 | Ga0065712_10287493 | 3300005290 | Unclassified | 884 |
| 9 | Ga0065715_10022813 | 3300005293 | Viruses | 1972 |
| 10 | Ga0065715_10162772 | 3300005293 | Bacteria | 1613 |
| 11 | Ga0070690_100918041 | 3300005330 | Unclassified | 686 |
| 12 | Ga0070670_100928507 | 3300005331 | Unclassified | 790 |
| 13 | Ga0070670_101143510 | 3300005331 | Unclassified | 710 |
| 14 | Ga0068869_100452085 | 3300005334 | Bacteria | 1065 |
| 15 | Ga0070680_100017998 | 3300005336 | Bacteria | 5580 |
| 16 | Ga0070680_100477365 | 3300005336 | Unclassified | 1066 |
| 17 | Ga0070680_101123161 | 3300005336 | Bacteria | 679 |
| 18 | Ga0070689_100001007 | 3300005340 | Bacteria | 17652 |
| 19 | Ga0070689_100833661 | 3300005340 | Unclassified | 813 |
| 20 | Ga0070689_101093471 | 3300005340 | Unclassified | 712 |
| 21 | Ga0070687_101405260 | 3300005343 | Unclassified | 522 |
| 22 | Ga0070661_100459047 | 3300005344 | Bacteria | 1014 |
| 23 | Ga0070661_100534165 | 3300005344 | Bacteria | 942 |
| 24 | Ga0070661_100880598 | 3300005344 | Unclassified | 738 |
| 25 | Ga0070692_10306853 | 3300005345 | Unclassified | 971 |
| 26 | Ga0070692_10387533 | 3300005345 | Unclassified | 879 |
| 27 | Ga0070692_10727824 | 3300005345 | Bacteria | 670 |
| 28 | Ga0070692_11029790 | 3300005345 | Unclassified | 577 |
| 29 | Ga0070668_100312247 | 3300005347 | Unclassified | 1321 |
| 30 | Ga0070673_100747043 | 3300005364 | Unclassified | 901 |
| 31 | Ga0070673_101189261 | 3300005364 | Unclassified | 714 |
| 32 | Ga0070673_101363624 | 3300005364 | Unclassified | 667 |
| 33 | Ga0070673_101516384 | 3300005364 | Bacteria | 632 |
| 34 | Ga0070659_101415365 | 3300005366 | Unclassified | 618 |
| 35 | Ga0070705_100026001 | 3300005440 | Bacteria | 3182 |
| 36 | Ga0070705_100103396 | 3300005440 | Bacteria | 1804 |
| 37 | Ga0070705_100326546 | 3300005440 | Bacteria | 1110 |
| 38 | Ga0070705_100537399 | 3300005440 | Unclassified | 894 |
| 39 | Ga0070705_100756889 | 3300005440 | Unclassified | 769 |
| 40 | Ga0070705_101213134 | 3300005440 | Bacteria | 622 |
| 41 | Ga0070700_100000068 | 3300005441 | Bacteria | 74024 |
| 42 | Ga0070700_101031541 | 3300005441 | Unclassified | 678 |
| 43 | Ga0070700_101502055 | 3300005441 | Unclassified | 573 |
| 44 | Ga0070694_100012173 | 3300005444 | Bacteria | 5345 |
| 45 | Ga0070694_100306264 | 3300005444 | Bacteria | 1219 |
| 46 | Ga0070694_100317245 | 3300005444 | Bacteria | 1199 |
| 47 | Ga0070694_100663136 | 3300005444 | Bacteria | 845 |
| 48 | Ga0070694_100674583 | 3300005444 | Unclassified | 838 |
| 49 | Ga0070694_101120649 | 3300005444 | Unclassified | 657 |
| 50 | Ga0070694_101497810 | 3300005444 | Unclassified | 571 |
| 51 | Ga0070694_101589488 | 3300005444 | Bacteria | 555 |
| 52 | Ga0070694_101672635 | 3300005444 | Bacteria | 541 |
| 53 | Ga0070663_101648216 | 3300005455 | Unclassified | 573 |
| 54 | Ga0070681_10002491 | 3300005458 | Bacteria | 16858 |
| 55 | Ga0070681_10155647 | 3300005458 | Unclassified | 2211 |
| 56 | Ga0068867_100148862 | 3300005459 | Bacteria | 1837 |
| 57 | Ga0068867_100551255 | 3300005459 | Bacteria | 999 |
| 58 | Ga0070685_10516836 | 3300005466 | Unclassified | 847 |
| 59 | Ga0070685_10943499 | 3300005466 | Unclassified | 644 |
| 60 | Ga0070706_100292938 | 3300005467 | Bacteria | 1519 |
| 61 | Ga0070707_100078827 | 3300005468 | Bacteria | 3179 |
| 62 | Ga0070707_100444995 | 3300005468 | Bacteria | 1256 |
| 63 | Ga0070698_100062150 | 3300005471 | Bacteria | 3767 |
| 64 | Ga0070699_100002708 | 3300005518 | Bacteria | 15795 |
| 65 | Ga0070699_101183518 | 3300005518 | Unclassified | 701 |
| 66 | Ga0070684_100853424 | 3300005535 | Bacteria | 852 |
| 67 | Ga0070684_101701623 | 3300005535 | Unclassified | 595 |
| 68 | Ga0070697_100711330 | 3300005536 | Unclassified | 886 |
| 69 | Ga0068853_100263973 | 3300005539 | Bacteria | 1584 |
| 70 | Ga0068853_101731262 | 3300005539 | Unclassified | 606 |
| 71 | Ga0070672_101391652 | 3300005543 | Unclassified | 627 |
| 72 | Ga0070695_100052011 | 3300005545 | Unclassified | 2631 |
| 73 | Ga0070695_100109451 | 3300005545 | Bacteria | 1873 |
| 74 | Ga0070695_100448601 | 3300005545 | Unclassified | 988 |
| 75 | Ga0070695_100780662 | 3300005545 | Unclassified | 764 |
| 76 | Ga0070695_100904252 | 3300005545 | Unclassified | 713 |
| 77 | Ga0070695_101016395 | 3300005545 | Unclassified | 675 |
| 78 | Ga0070696_100087268 | 3300005546 | Bacteria | 2216 |
| 79 | Ga0070693_100006779 | 3300005547 | Bacteria | 5560 |
| 80 | Ga0070693_100166307 | 3300005547 | Unclassified | 1409 |
| 81 | Ga0070693_100544790 | 3300005547 | Unclassified | 830 |
| 82 | Ga0070693_100813430 | 3300005547 | Unclassified | 693 |
| 83 | Ga0070693_101501498 | 3300005547 | Unclassified | 527 |
| 84 | Ga0070665_100945412 | 3300005548 | Bacteria | 874 |
| 85 | Ga0070704_100275548 | 3300005549 | Bacteria | 1392 |
| 86 | Ga0070704_100976426 | 3300005549 | Unclassified | 765 |
| 87 | Ga0070664_100252279 | 3300005564 | Bacteria | 1586 |
| 88 | Ga0070664_100873593 | 3300005564 | Bacteria | 842 |
| 89 | Ga0068857_100242725 | 3300005577 | Unclassified | 1650 |
| 90 | Ga0068857_101113978 | 3300005577 | Unclassified | 762 |
| 91 | Ga0068857_101576895 | 3300005577 | Unclassified | 641 |
| 92 | Ga0068854_101671105 | 3300005578 | Unclassified | 582 |
| 93 | Ga0070702_100161751 | 3300005615 | Bacteria | 1448 |
| 94 | Ga0070702_100295785 | 3300005615 | Bacteria | 1118 |
| 95 | Ga0070702_101055343 | 3300005615 | Unclassified | 646 |
| 96 | Ga0068852_101547539 | 3300005616 | Unclassified | 685 |
| 97 | Ga0068859_100012062 | 3300005617 | Bacteria | 8683 |
| 98 | Ga0068859_100088309 | 3300005617 | Bacteria | 3149 |
| 99 | Ga0068859_100088550 | 3300005617 | Bacteria | 3145 |
| 100 | Ga0068859_100226499 | 3300005617 | Bacteria | 1957 |
| 101 | Ga0068859_100704202 | 3300005617 | Unclassified | 1100 |
| 102 | Ga0068859_100704245 | 3300005617 | Bacteria | 1100 |
| 103 | Ga0068864_100003653 | 3300005618 | Bacteria | 12718 |
| 104 | Ga0068864_100038506 | 3300005618 | Bacteria | 4084 |
| 105 | Ga0068864_100350794 | 3300005618 | Bacteria | 1392 |
| 106 | Ga0068864_101221463 | 3300005618 | Unclassified | 751 |
| 107 | Ga0068864_101229917 | 3300005618 | Bacteria | 748 |
| 108 | Ga0068864_101933967 | 3300005618 | Unclassified | 596 |
| 109 | Ga0068861_100006754 | 3300005719 | Bacteria | 7841 |
| 110 | Ga0068861_100268822 | 3300005719 | Bacteria | 1463 |
| 111 | Ga0068861_102486581 | 3300005719 | Unclassified | 521 |
| 112 | Ga0068851_10017471 | 3300005834 | Bacteria | 3446 |
| 113 | Ga0068851_10247230 | 3300005834 | Bacteria | 1011 |
| 114 | Ga0068851_10376228 | 3300005834 | Unclassified | 831 |
| 115 | Ga0068870_10023580 | 3300005840 | Bacteria | 3036 |
| 116 | Ga0068863_100046962 | 3300005841 | Bacteria | 4098 |
| 117 | Ga0068863_100503817 | 3300005841 | Unclassified | 1192 |
| 118 | Ga0068858_100038503 | 3300005842 | Bacteria | 4435 |
| 119 | Ga0068858_100124225 | 3300005842 | Bacteria | 2416 |
| 120 | Ga0068858_100412955 | 3300005842 | Unclassified | 1297 |
| 121 | Ga0068858_100785922 | 3300005842 | Unclassified | 928 |
| 122 | Ga0068858_100894109 | 3300005842 | Unclassified | 868 |
| 123 | Ga0068858_101097170 | 3300005842 | Unclassified | 781 |
| 124 | Ga0068858_101403949 | 3300005842 | Unclassified | 688 |
| 125 | Ga0068860_100274828 | 3300005843 | Bacteria | 1645 |
| 126 | Ga0068860_100302962 | 3300005843 | Unclassified | 1566 |
| 127 | Ga0068860_100844409 | 3300005843 | Bacteria | 930 |
| 128 | Ga0068860_101164206 | 3300005843 | Unclassified | 791 |
| 129 | Ga0068862_101291323 | 3300005844 | Unclassified | 731 |
| 130 | Ga0081455_10910690 | 3300005937 | Unclassified | 547 |
| 131 | Ga0081539_10003751 | 3300005985 | Bacteria | 18049 |
| 132 | Ga0070716_100263936 | 3300006173 | Bacteria | 1180 |
| 133 | Ga0097621_100171585 | 3300006237 | Unclassified | 1870 |
| 134 | Ga0068871_100824054 | 3300006358 | Bacteria | 856 |
| 135 | Ga0075428_100414519 | 3300006844 | Bacteria | 1443 |
| 136 | Ga0075428_101169100 | 3300006844 | Bacteria | 811 |
| 137 | Ga0075428_101610306 | 3300006844 | Unclassified | 679 |
| 138 | Ga0075430_100062015 | 3300006846 | Bacteria | 3141 |
| 139 | Ga0075430_100098592 | 3300006846 | Bacteria | 2441 |
| 140 | Ga0075431_100305785 | 3300006847 | Unclassified | 1606 |
| 141 | Ga0075431_100718924 | 3300006847 | Unclassified | 976 |
| 142 | Ga0075433_10042245 | 3300006852 | Bacteria | 3954 |
| 143 | Ga0075433_10243431 | 3300006852 | Unclassified | 1597 |
| 144 | Ga0075433_10300999 | 3300006852 | Unclassified | 1420 |
| 145 | Ga0075433_10582712 | 3300006852 | Unclassified | 982 |
| 146 | Ga0075433_11076533 | 3300006852 | Unclassified | 699 |
| 147 | Ga0075434_100029971 | 3300006871 | Bacteria | 5356 |
| 148 | Ga0075434_100186634 | 3300006871 | Bacteria | 2094 |
| 149 | Ga0075429_100037218 | 3300006880 | Unclassified | 4236 |
| 150 | Ga0075429_100099109 | 3300006880 | Bacteria | 2542 |
| 151 | Ga0097620_100012062 | 3300006931 | Bacteria | 8683 |
| 152 | Ga0097620_100088308 | 3300006931 | Bacteria | 3149 |
| 153 | Ga0097620_100088550 | 3300006931 | Bacteria | 3145 |
| 154 | Ga0097620_100226495 | 3300006931 | Bacteria | 1957 |
| 155 | Ga0097620_100704189 | 3300006931 | Unclassified | 1100 |
| 156 | Ga0097620_100704265 | 3300006931 | Bacteria | 1100 |
| 157 | Ga0097620_102365239 | 3300006931 | Unclassified | 586 |
| 158 | Ga0105251_10129258 | 3300009011 | Unclassified | 1145 |
| 159 | Ga0105240_10207491 | 3300009093 | Bacteria | 2292 |
| 160 | Ga0105240_11640797 | 3300009093 | Bacteria | 672 |
| 161 | Ga0111539_10072578 | 3300009094 | Unclassified | 4059 |
| 162 | Ga0111539_10619093 | 3300009094 | Bacteria | 1261 |
| 163 | Ga0105247_10072435 | 3300009101 | Unclassified | 2157 |
| 164 | Ga0105247_10283967 | 3300009101 | Unclassified | 1143 |
| 165 | Ga0105247_10671557 | 3300009101 | Unclassified | 777 |
| 166 | Ga0114129_10005287 | 3300009147 | Bacteria | 18217 |
| 167 | Ga0114129_10027868 | 3300009147 | Bacteria | 7999 |
| 168 | Ga0114129_10035685 | 3300009147 | Bacteria | 7024 |
| 169 | Ga0114129_10170643 | 3300009147 | Unclassified | 2966 |
| 170 | Ga0114129_10195542 | 3300009147 | Bacteria | 2743 |
| 171 | Ga0114129_10939140 | 3300009147 | Bacteria | 1093 |
| 172 | Ga0114129_11175724 | 3300009147 | Unclassified | 957 |
| 173 | Ga0114129_11269206 | 3300009147 | Unclassified | 914 |
| 174 | Ga0105243_10548850 | 3300009148 | Bacteria | 1104 |
| 175 | Ga0105243_11606745 | 3300009148 | Unclassified | 677 |
| 176 | Ga0105241_10104498 | 3300009174 | Bacteria | 2257 |
| 177 | Ga0105241_10123008 | 3300009174 | Bacteria | 2092 |
| 178 | Ga0105241_10162692 | 3300009174 | Unclassified | 1836 |
| 179 | Ga0105241_10307185 | 3300009174 | Bacteria | 1363 |
| 180 | Ga0105241_10309221 | 3300009174 | Unclassified | 1359 |
| 181 | Ga0105241_10314383 | 3300009174 | Bacteria | 1348 |
| 182 | Ga0105241_10415732 | 3300009174 | Unclassified | 1182 |
| 183 | Ga0105241_11287003 | 3300009174 | Unclassified | 696 |
| 184 | Ga0105242_10254950 | 3300009176 | Bacteria | 1582 |
| 185 | Ga0105242_10929200 | 3300009176 | Unclassified | 872 |
| 186 | Ga0105242_13001336 | 3300009176 | Unclassified | 522 |
| 187 | Ga0105248_10003960 | 3300009177 | Bacteria | 16380 |
| 188 | Ga0105248_10004713 | 3300009177 | Bacteria | 15092 |
| 189 | Ga0105248_10009706 | 3300009177 | Bacteria | 10601 |
| 190 | Ga0105248_10158934 | 3300009177 | Unclassified | 2550 |
| 191 | Ga0105248_10186896 | 3300009177 | Bacteria | 2335 |
| 192 | Ga0105248_10334029 | 3300009177 | Bacteria | 1707 |
| 193 | Ga0105248_10652006 | 3300009177 | Unclassified | 1188 |
| 194 | Ga0105248_11372903 | 3300009177 | Unclassified | 799 |
| 195 | Ga0105248_12764813 | 3300009177 | Unclassified | 560 |
| 196 | Ga0105237_10000218 | 3300009545 | Bacteria | 80923 |
| 197 | Ga0105237_11368745 | 3300009545 | Bacteria | 714 |
| 198 | Ga0105249_10579523 | 3300009553 | Unclassified | 1175 |
| 199 | Ga0105249_10776453 | 3300009553 | Unclassified | 1021 |
| 200 | Ga0105239_10130040 | 3300010375 | Unclassified | 2800 |
| 201 | Ga0105239_10610936 | 3300010375 | Bacteria | 1244 |
| 202 | Ga0105239_11157002 | 3300010375 | Bacteria | 891 |
| 203 | Ga0105239_13405389 | 3300010375 | Unclassified | 517 |
| 204 | Ga0105246_10138404 | 3300011119 | Bacteria | 1827 |
| 205 | Ga0105246_10161990 | 3300011119 | Bacteria | 1705 |
| 206 | Ga0105246_10184885 | 3300011119 | Bacteria | 1608 |
| 207 | Ga0105246_10186137 | 3300011119 | Unclassified | 1603 |
| 208 | Ga0157373_10003516 | 3300013100 | Bacteria | 11845 |
| 209 | Ga0157373_10203951 | 3300013100 | Bacteria | 1394 |
| 210 | Ga0157373_10364058 | 3300013100 | Bacteria | 1033 |
| 211 | Ga0157373_10725287 | 3300013100 | Unclassified | 729 |
| 212 | Ga0157374_10043193 | 3300013296 | Bacteria | 4163 |
| 213 | Ga0157374_12617485 | 3300013296 | Unclassified | 532 |
| 214 | Ga0157378_10220353 | 3300013297 | Bacteria | 1803 |
| 215 | Ga0157378_10378696 | 3300013297 | Bacteria | 1389 |
| 216 | Ga0163162_10001781 | 3300013306 | Bacteria | 20195 |
| 217 | Ga0163162_10041264 | 3300013306 | Unclassified | 4616 |
| 218 | Ga0163162_10109030 | 3300013306 | Bacteria | 2865 |
| 219 | Ga0157372_10003659 | 3300013307 | Bacteria | 16524 |
| 220 | Ga0157372_10515404 | 3300013307 | Bacteria | 1394 |
| 221 | Ga0157372_11071197 | 3300013307 | Unclassified | 933 |
| 222 | Ga0157372_11849867 | 3300013307 | Unclassified | 694 |
| 223 | Ga0157372_12051322 | 3300013307 | Unclassified | 657 |
| 224 | Ga0157375_10004640 | 3300013308 | Bacteria | 11943 |
| 225 | Ga0157375_10187794 | 3300013308 | Bacteria | 2221 |
| 226 | Ga0157375_10335010 | 3300013308 | Bacteria | 1678 |
| 227 | Ga0157375_10745965 | 3300013308 | Unclassified | 1131 |
| 228 | Ga0157375_12635108 | 3300013308 | Bacteria | 601 |
| 229 | Ga0157375_13698052 | 3300013308 | Unclassified | 509 |
| 230 | Ga0163163_10004770 | 3300014325 | Bacteria | 11634 |
| 231 | Ga0163163_10007150 | 3300014325 | Bacteria | 9819 |
| 232 | Ga0163163_10023305 | 3300014325 | Bacteria | 5873 |
| 233 | Ga0163163_10080952 | 3300014325 | Bacteria | 3248 |
| 234 | Ga0163163_10282246 | 3300014325 | Unclassified | 1712 |
| 235 | Ga0163163_10482720 | 3300014325 | Bacteria | 1300 |
| 236 | Ga0163163_10787659 | 3300014325 | Bacteria | 1014 |
| 237 | Ga0157380_10001508 | 3300014326 | Bacteria | 15268 |
| 238 | Ga0157380_10339866 | 3300014326 | Bacteria | 1400 |
| 239 | Ga0157380_10732757 | 3300014326 | Unclassified | 998 |
| 240 | Ga0157380_11241905 | 3300014326 | Unclassified | 790 |
| 241 | Ga0157377_10239513 | 3300014745 | Unclassified | 1170 |
| 242 | Ga0157377_10616872 | 3300014745 | Unclassified | 776 |
| 243 | Ga0157377_10670252 | 3300014745 | Unclassified | 749 |
| 244 | Ga0157379_10120549 | 3300014968 | Bacteria | 2359 |
| 245 | Ga0157379_10660057 | 3300014968 | Viruses | 980 |
| 246 | Ga0157379_11810209 | 3300014968 | Unclassified | 600 |
| 247 | Ga0157376_10054357 | 3300014969 | Bacteria | 3338 |
| 248 | Ga0157376_10260872 | 3300014969 | Bacteria | 1623 |
| 249 | Ga0182007_10171529 | 3300015262 | Unclassified | 746 |
| 250 | Ga0182005_1270628 | 3300015265 | Bacteria | 531 |
| 251 | Ga0207656_10006073 | 3300025321 | Bacteria | 4322 |
| 252 | Ga0207653_10002952 | 3300025885 | Bacteria | 5397 |
| 253 | Ga0207710_10037922 | 3300025900 | Bacteria | 2130 |
| 254 | Ga0207710_10254744 | 3300025900 | Unclassified | 878 |
| 255 | Ga0207688_10295238 | 3300025901 | Unclassified | 990 |
| 256 | Ga0207645_10594709 | 3300025907 | Unclassified | 751 |
| 257 | Ga0207643_10002208 | 3300025908 | Bacteria | 10605 |
| 258 | Ga0207643_10461221 | 3300025908 | Bacteria | 809 |
| 259 | Ga0207684_10000704 | 3300025910 | Bacteria | 39445 |
| 260 | Ga0207684_10062269 | 3300025910 | Bacteria | 3168 |
| 261 | Ga0207654_10247973 | 3300025911 | Bacteria | 1192 |
| 262 | Ga0207654_10840155 | 3300025911 | Unclassified | 664 |
| 263 | Ga0207707_10000050 | 3300025912 | Bacteria | 117404 |
| 264 | Ga0207707_10023668 | 3300025912 | Bacteria | 5371 |
| 265 | Ga0207671_10026421 | 3300025914 | Unclassified | 4351 |
| 266 | Ga0207662_10122719 | 3300025918 | Unclassified | 1630 |
| 267 | Ga0207662_10150082 | 3300025918 | Unclassified | 1482 |
| 268 | Ga0207649_10250293 | 3300025920 | Bacteria | 1276 |
| 269 | Ga0207649_10346893 | 3300025920 | Bacteria | 1098 |
| 270 | Ga0207649_10637646 | 3300025920 | Bacteria | 822 |
| 271 | Ga0207649_10755024 | 3300025920 | Bacteria | 757 |
| 272 | Ga0207652_10000170 | 3300025921 | Bacteria | 70017 |
| 273 | Ga0207681_10637406 | 3300025923 | Bacteria | 883 |
| 274 | Ga0207650_10228380 | 3300025925 | Unclassified | 1500 |
| 275 | Ga0207650_10273999 | 3300025925 | Unclassified | 1372 |
| 276 | Ga0207690_11213099 | 3300025932 | Unclassified | 630 |
| 277 | Ga0207686_10012213 | 3300025934 | Unclassified | 4718 |
| 278 | Ga0207686_10497328 | 3300025934 | Unclassified | 945 |
| 279 | Ga0207709_10007813 | 3300025935 | Bacteria | 5927 |
| 280 | Ga0207670_10000411 | 3300025936 | Bacteria | 24367 |
| 281 | Ga0207704_10641312 | 3300025938 | Viruses | 874 |
| 282 | Ga0207665_10131805 | 3300025939 | Unclassified | 1775 |
| 283 | Ga0207691_10067002 | 3300025940 | Bacteria | 3247 |
| 284 | Ga0207691_10876707 | 3300025940 | Unclassified | 752 |
| 285 | Ga0207691_11100110 | 3300025940 | Unclassified | 661 |
| 286 | Ga0207711_10008164 | 3300025941 | Bacteria | 8764 |
| 287 | Ga0207711_10647727 | 3300025941 | Unclassified | 986 |
| 288 | Ga0207711_11246567 | 3300025941 | Unclassified | 685 |
| 289 | Ga0207689_10440428 | 3300025942 | Unclassified | 1088 |
| 290 | Ga0207689_10615436 | 3300025942 | Unclassified | 914 |
| 291 | Ga0207679_10900827 | 3300025945 | Unclassified | 809 |
| 292 | Ga0207651_10247748 | 3300025960 | Unclassified | 1456 |
| 293 | Ga0207651_10648170 | 3300025960 | Unclassified | 927 |
| 294 | Ga0207651_11250154 | 3300025960 | Unclassified | 667 |
| 295 | Ga0207651_11375215 | 3300025960 | Bacteria | 635 |
| 296 | Ga0207640_10080712 | 3300025981 | Bacteria | 2221 |
| 297 | Ga0207640_10847331 | 3300025981 | Unclassified | 795 |
| 298 | Ga0207640_11379750 | 3300025981 | Unclassified | 631 |
| 299 | Ga0207677_10639879 | 3300026023 | Unclassified | 937 |
| 300 | Ga0207677_10802290 | 3300026023 | Unclassified | 843 |
| 301 | Ga0207703_10014576 | 3300026035 | Bacteria | 6134 |
| 302 | Ga0207703_10203502 | 3300026035 | Unclassified | 1760 |
| 303 | Ga0207708_10000130 | 3300026075 | Bacteria | 58987 |
| 304 | Ga0207708_10036670 | 3300026075 | Bacteria | 3733 |
| 305 | Ga0207641_10068382 | 3300026088 | Bacteria | 3045 |
| 306 | Ga0207641_10490633 | 3300026088 | Bacteria | 1192 |
| 307 | Ga0207648_10120012 | 3300026089 | Bacteria | 2311 |
| 308 | Ga0207648_10328617 | 3300026089 | Bacteria | 1375 |
| 309 | Ga0207648_10405182 | 3300026089 | Unclassified | 1236 |
| 310 | Ga0207676_10030190 | 3300026095 | Unclassified | 4066 |
| 311 | Ga0207676_11113329 | 3300026095 | Unclassified | 781 |
| 312 | Ga0207676_12228304 | 3300026095 | Unclassified | 546 |
| 313 | Ga0207674_10121359 | 3300026116 | Bacteria | 2581 |
| 314 | Ga0207674_10642330 | 3300026116 | Bacteria | 1025 |
| 315 | Ga0207675_100029042 | 3300026118 | Bacteria | 5153 |
| 316 | Ga0207675_100363843 | 3300026118 | Bacteria | 1419 |
| 317 | Ga0207683_11371188 | 3300026121 | Bacteria | 654 |
| 318 | Ga0207698_10403297 | 3300026142 | Bacteria | 1307 |
| 319 | Ga0207428_10053272 | 3300027907 | Unclassified | 3227 |
| 320 | Ga0268265_10960859 | 3300028380 | Unclassified | 842 |
| 321 | Ga0268265_11883974 | 3300028380 | Unclassified | 605 |
| 322 | Ga0268264_10487401 | 3300028381 | Unclassified | 1200 |
| 323 | Ga0268264_11001136 | 3300028381 | Unclassified | 842 |
| 324 | Ga0268264_11116546 | 3300028381 | Unclassified | 797 |
| 325 | Ga0307408_100033757 | 3300031548 | Bacteria | 3578 |
| 326 | Ga0307413_10698712 | 3300031824 | Bacteria | 842 |
| 327 | Ga0307410_10986049 | 3300031852 | Unclassified | 726 |
| 328 | Ga0307406_10263285 | 3300031901 | Unclassified | 1306 |
| 329 | Ga0307407_10141765 | 3300031903 | Bacteria | 1551 |
| 330 | Ga0307412_10002344 | 3300031911 | Bacteria | 10489 |
| 331 | Ga0307412_10018161 | 3300031911 | Bacteria | 4225 |
| 332 | Ga0307409_101997119 | 3300031995 | Unclassified | 609 |
| 333 | Ga0307416_100011472 | 3300032002 | Bacteria | 5913 |
| 334 | Ga0307416_100228217 | 3300032002 | Unclassified | 1793 |
| 335 | Ga0307411_10184514 | 3300032005 | Unclassified | 1587 |
| 336 | Ga0307411_10376676 | 3300032005 | Bacteria | 1166 |
| 337 | Ga0307415_100110751 | 3300032126 | Bacteria | 2036 |
| 338 | Ga0373930_0054771 | 3300034816 | Bacteria | 879 |
| 339 | Ga0373930_0115525 | 3300034816 | Unclassified | 649 |
| 340 | Ga0373930_0164422 | 3300034816 | Unclassified | 563 |
| 341 | Ga0373940_0019452 | 3300035088 | Bacteria | 1716 |
| 342 | Ga0373940_0195611 | 3300035088 | Unclassified | 663 |
| 343 | Ga0373949_0019273 | 3300035090 | Bacteria | 1553 |
| 344 | Ga0373951_0003682 | 3300035091 | Bacteria | 3698 |
| 345 | Ga0373952_0048822 | 3300035092 | Unclassified | 1002 |
| 346 | Ga0373939_0090964 | 3300035114 | Bacteria | 1031 |
| 347 | Ga0373941_0233760 | 3300035115 | Unclassified | 711 |
| 348 | Ga0373942_0028923 | 3300035207 | Bacteria | 1451 |
| 349 | Ga0373962_0176905 | 3300035242 | Unclassified | 712 |
| 350 | Ga0373931_0565366 | 3300035691 | Unclassified | 740 |
| 351 | Ga0395899_0346505 | 3300037312 | Unclassified | 995 |
| 352 | Ga0395900_0246517 | 3300037418 | Bacteria | 1790 |
| 353 | Ga0395900_0902510 | 3300037418 | Unclassified | 807 |
| 354 | Ga0395900_1594996 | 3300037418 | Unclassified | 564 |
| 355 | Ga0395898_0130872 | 3300037466 | Unclassified | 2404 |
| 356 | Ga0395898_0955345 | 3300037466 | Unclassified | 794 |
| 357 | Ga0395905_1420841 | 3300037471 | Unclassified | 598 |
| 358 | Ga0242419_002641 | 3300038698 | Bacteria | 1175 |
| 359 | Ga0242420_010297 | 3300038996 | Bacteria | 1550 |
| 360 | Ga0242420_027179 | 3300038996 | Bacteria | 1047 |
| 361 | Ga0439436_0097755 | 3300041404 | Unclassified | 818 |
| 362 | Ga0451807_0728375 | 3300041486 | Unclassified | 586 |
| 363 | Ga0439448_0033257 | 3300042005 | Unclassified | 1645 |
| 364 | Ga0450889_014253 | 3300042144 | Unclassified | 846 |
| 365 | Ga0439458_0008285 | 3300042157 | Bacteria | 2313 |
| 366 | Ga0439459_0090154 | 3300042438 | Unclassified | 736 |
| 367 | Ga0439464_0097405 | 3300042439 | Unclassified | 891 |
| 368 | Ga0451576_0463459 | 3300045051 | Unclassified | 1331 |
| 369 | Ga0451576_0840800 | 3300045051 | Bacteria | 964 |
| 370 | Ga0451576_1031786 | 3300045051 | Unclassified | 862 |
| 371 | Ga0451576_1282489 | 3300045051 | Bacteria | 764 |
| 372 | Ga0451576_1708602 | 3300045051 | Bacteria | 652 |
| 373 | Ga0495582_0024952 | 3300046473 | Bacteria | 3274 |
| 374 | Ga0495643_0260892 | 3300046522 | Unclassified | 805 |
| 375 | Ga0495658_0159303 | 3300046683 | Unclassified | 1391 |
| 376 | Ga0496101_1011467 | 3300048904 | Unclassified | 654 |
| 377 | Ga0496102_1138843 | 3300048905 | Unclassified | 700 |
| 378 | Ga0496103_0753159 | 3300048906 | Unclassified | 616 |
| 379 | Ga0496104_0673515 | 3300048907 | Unclassified | 943 |
| 380 | Ga0496104_0726743 | 3300048907 | Unclassified | 900 |
| 381 | Ga0496106_0043744 | 3300048909 | Bacteria | 3361 |
| 382 | Ga0496106_0484755 | 3300048909 | Unclassified | 993 |
| 383 | Ga0496107_0550524 | 3300048910 | Unclassified | 854 |
| 384 | Ga0496108_0266108 | 3300048911 | Bacteria | 1492 |
| 385 | Ga0496108_0530007 | 3300048911 | Unclassified | 1028 |
| 386 | Ga0496108_0847639 | 3300048911 | Unclassified | 787 |
| 387 | Ga0496108_0917616 | 3300048911 | Unclassified | 751 |
| 388 | Ga0496109_0998103 | 3300048912 | Unclassified | 775 |
| 389 | Ga0496110_0529316 | 3300048913 | Bacteria | 1072 |
| 390 | Ga0496112_0042112 | 3300048915 | Bacteria | 4468 |
| 391 | Ga0496112_0278693 | 3300048915 | Bacteria | 1620 |
| 392 | Ga0496112_0327586 | 3300048915 | Unclassified | 1476 |
| 393 | Ga0496112_0469912 | 3300048915 | Unclassified | 1195 |
| 394 | Ga0496112_0495236 | 3300048915 | Unclassified | 1158 |
| 395 | Ga0496112_0712929 | 3300048915 | Unclassified | 931 |
| 396 | Ga0496113_0414319 | 3300048916 | Unclassified | 1082 |
| 397 | Ga0501291_006885 | 3300049514 | Bacteria | 1527 |
| 398 | Ga0501291_011315 | 3300049514 | Bacteria | 1284 |
| 399 | Ga0501291_120497 | 3300049514 | Unclassified | 568 |
| 400 | Ga0501291_141355 | 3300049514 | Unclassified | 537 |
| 401 | Ga0501292_003900 | 3300049515 | Unclassified | 2015 |
| 402 | Ga0501295_064273 | 3300049518 | Unclassified | 809 |
| 403 | Ga0501296_000282 | 3300049519 | Bacteria | 5230 |
| 404 | Ga0501296_052418 | 3300049519 | Bacteria | 600 |
| 405 | Ga0501297_006153 | 3300049520 | Bacteria | 1275 |
| 406 | Ga0501298_000267 | 3300049521 | Bacteria | 6798 |
| 407 | Ga0501298_001215 | 3300049521 | Bacteria | 3750 |
| 408 | Ga0501298_059649 | 3300049521 | Unclassified | 806 |
| 409 | Ga0501299_017802 | 3300049522 | Bacteria | 1271 |
| 410 | Ga0501299_105736 | 3300049522 | Unclassified | 659 |
| 411 | Ga0501300_017864 | 3300049523 | Bacteria | 1036 |
| 412 | Ga0501300_053478 | 3300049523 | Unclassified | 627 |
| 413 | Ga0501301_042568 | 3300049524 | Unclassified | 519 |
| 414 | Ga0501303_016912 | 3300049526 | Unclassified | 743 |
| 415 | Ga0501038_0000253 | 3300049574 | Bacteria | 45383 |
| 416 | Ga0501048_0824358 | 3300049582 | Bacteria | 667 |
| 417 | Ga0501068_1181048 | 3300049584 | Unclassified | 507 |
| 418 | Ga0501077_0975501 | 3300049593 | Unclassified | 545 |
| 419 | Ga0501198_010277 | 3300049649 | Bacteria | 1382 |
| 420 | Ga0501202_006946 | 3300049652 | Bacteria | 2038 |
| 421 | Ga0501202_029067 | 3300049652 | Bacteria | 1144 |
| 422 | Ga0501202_038087 | 3300049652 | Unclassified | 1029 |
| 423 | Ga0501206_003799 | 3300049653 | Bacteria | 1917 |
| 424 | Ga0501206_005868 | 3300049653 | Bacteria | 1588 |
| 425 | Ga0501207_004275 | 3300049654 | Bacteria | 1934 |
| 426 | Ga0501209_079043 | 3300049656 | Unclassified | 946 |
| 427 | Ga0501214_002822 | 3300049659 | Bacteria | 1494 |
| 428 | Ga0501216_003988 | 3300049660 | Bacteria | 2173 |
| 429 | Ga0501217_000895 | 3300049661 | Bacteria | 5312 |
| 430 | Ga0501217_021214 | 3300049661 | Bacteria | 1532 |
| 431 | Ga0501217_075045 | 3300049661 | Unclassified | 927 |
| 432 | Ga0501223_003524 | 3300049663 | Bacteria | 3396 |
| 433 | Ga0501223_009462 | 3300049663 | Bacteria | 1974 |
| 434 | Ga0501223_036905 | 3300049663 | Unclassified | 950 |
| 435 | Ga0501224_021069 | 3300049664 | Unclassified | 971 |
| 436 | Ga0501227_016907 | 3300049665 | Bacteria | 1642 |
| 437 | Ga0501227_016987 | 3300049665 | Bacteria | 1639 |
| 438 | Ga0501227_116257 | 3300049665 | Unclassified | 720 |
| 439 | Ga0501230_006226 | 3300049667 | Bacteria | 1723 |
| 440 | Ga0501230_047160 | 3300049667 | Bacteria | 849 |
| 441 | Ga0501233_001770 | 3300049668 | Bacteria | 3728 |
| 442 | Ga0501233_012557 | 3300049668 | Bacteria | 1703 |
| 443 | Ga0501233_128288 | 3300049668 | Unclassified | 691 |
| 444 | Ga0501235_001974 | 3300049669 | Unclassified | 4393 |
| 445 | Ga0501235_012889 | 3300049669 | Bacteria | 1840 |
| 446 | Ga0501235_035783 | 3300049669 | Bacteria | 1128 |
| 447 | Ga0501236_037151 | 3300049670 | Unclassified | 794 |
| 448 | Ga0501240_040074 | 3300049673 | Unclassified | 777 |
| 449 | Ga0501242_004004 | 3300049674 | Bacteria | 1621 |
| 450 | Ga0501243_099048 | 3300049675 | Unclassified | 586 |
| 451 | Ga0501249_002427 | 3300049679 | Unclassified | 3768 |
| 452 | Ga0501249_061689 | 3300049679 | Bacteria | 869 |
| 453 | Ga0501250_005598 | 3300049680 | Bacteria | 1296 |
| 454 | Ga0501250_021044 | 3300049680 | Unclassified | 845 |
| 455 | Ga0501251_060162 | 3300049681 | Unclassified | 624 |
| 456 | Ga0501252_094547 | 3300049682 | Unclassified | 510 |
| 457 | Ga0501253_045306 | 3300049683 | Unclassified | 903 |
| 458 | Ga0501253_163607 | 3300049683 | Unclassified | 569 |
| 459 | Ga0501255_032429 | 3300049684 | Bacteria | 733 |
| 460 | Ga0501257_063510 | 3300049686 | Unclassified | 935 |
| 461 | Ga0501259_003342 | 3300049688 | Bacteria | 2563 |
| 462 | Ga0501259_006744 | 3300049688 | Bacteria | 1830 |
| 463 | Ga0501259_029879 | 3300049688 | Unclassified | 1022 |
| 464 | Ga0501260_001971 | 3300049689 | Unclassified | 1740 |
| 465 | Ga0501260_025547 | 3300049689 | Unclassified | 659 |
| 466 | Ga0501261_028849 | 3300049690 | Unclassified | 831 |
| 467 | Ga0501261_039254 | 3300049690 | Unclassified | 741 |
| 468 | Ga0501261_082814 | 3300049690 | Unclassified | 583 |
| 469 | Ga0501221_019701 | 3300049704 | Bacteria | 1312 |
| 470 | Ga0501225_0000908 | 3300049705 | Bacteria | 9216 |
| 471 | Ga0501225_0013521 | 3300049705 | Bacteria | 2284 |
| 472 | Ga0501225_0062848 | 3300049705 | Unclassified | 1046 |
| 473 | Ga0501234_006122 | 3300049707 | Bacteria | 1884 |
| 474 | Ga0501234_010835 | 3300049707 | Bacteria | 1421 |
| 475 | Ga0501234_018995 | 3300049707 | Bacteria | 1088 |
| 476 | Ga0501234_030597 | 3300049707 | Unclassified | 869 |
| 477 | Ga0501245_029694 | 3300049708 | Bacteria | 898 |
| 478 | Ga0501245_054529 | 3300049708 | Unclassified | 716 |
| 479 | Ga0501241_019831 | 3300049758 | Bacteria | 1236 |
| 480 | Ga0501262_010847 | 3300049759 | Bacteria | 1145 |
| 481 | Ga0501263_016675 | 3300049760 | Bacteria | 958 |
| 482 | Ga0501264_028125 | 3300049761 | Unclassified | 633 |
| 483 | Ga0501266_028420 | 3300049763 | Bacteria | 789 |
| 484 | Ga0501266_029474 | 3300049763 | Unclassified | 778 |
| 485 | Ga0501270_143583 | 3300049767 | Unclassified | 538 |
| 486 | Ga0501271_005289 | 3300049768 | Bacteria | 1253 |
| 487 | Ga0501271_055593 | 3300049768 | Unclassified | 546 |
| 488 | Ga0501273_006382 | 3300049770 | Unclassified | 1363 |
| 489 | Ga0501275_008172 | 3300049772 | Bacteria | 1071 |
| 490 | Ga0501279_009656 | 3300049775 | Bacteria | 1294 |
| 491 | Ga0501279_019663 | 3300049775 | Unclassified | 956 |
| 492 | Ga0501279_043059 | 3300049775 | Unclassified | 698 |
| 493 | Ga0501283_022264 | 3300049779 | Unclassified | 1021 |
| 494 | Ga0501283_030929 | 3300049779 | Bacteria | 897 |
| 495 | Ga0501204_006583 | 3300049850 | Bacteria | 1293 |
| 496 | Ga0501212_001517 | 3300049851 | Bacteria | 2630 |
| 497 | Ga0501212_062178 | 3300049851 | Unclassified | 648 |
| 498 | Ga0501226_001043 | 3300049853 | Bacteria | 3590 |
| 499 | nmdc:mga05p37_123328_c1 | 3300050507 | Bacteria | 3182 |
| 500 | nmdc:mga05p37_1288319_c1 | 3300050507 | Bacteria | 746 |
| 501 | nmdc:mga05p37_160816_c1 | 3300050507 | Bacteria | 2743 |
| 502 | nmdc:mga05p37_290621_c1 | 3300050507 | Bacteria | 1946 |
| 503 | nmdc:mga05p37_42760_c1 | 3300050507 | Bacteria | 5569 |
| 504 | nmdc:mga05p37_843709_c1 | 3300050507 | Bacteria | 996 |
| 505 | nmdc:mga09592_502114_c1 | 3300050508 | Unclassified | 1044 |
| 506 | nmdc:mga09592_798248_c1 | 3300050508 | Bacteria | 799 |
| 507 | nmdc:mga0qj67_137229_c1 | 3300050509 | Bacteria | 1982 |
| 508 | nmdc:mga06r32_122023_c2 | 3300050510 | Bacteria | 1901 |
| 509 | nmdc:mga06r32_68185_c1 | 3300050510 | Bacteria | 3436 |
| 510 | nmdc:mga08y16_106967_c1 | 3300050511 | Bacteria | 2911 |
| 511 | nmdc:mga08y16_78707_c1 | 3300050511 | Bacteria | 3437 |
| 512 | nmdc:mga0n895_101294_c1 | 3300050512 | Bacteria | 2890 |
| 513 | nmdc:mga0n895_397694_c1 | 3300050512 | Unclassified | 1393 |
| 514 | nmdc:mga0n895_520888_c1 | 3300050512 | Bacteria | 1196 |
| 515 | nmdc:mga0n895_995947_c1 | 3300050512 | Unclassified | 819 |
| 516 | nmdc:mga0rr50_65054_c1 | 3300050513 | Unclassified | 2761 |
| 517 | nmdc:mga08x19_30486_c1 | 3300050514 | Bacteria | 3388 |
| 518 | nmdc:mga0a205_1415875_c1 | 3300050515 | Bacteria | 543 |
| 519 | nmdc:mga0a205_16663_c1 | 3300050515 | Bacteria | 6883 |
| 520 | nmdc:mga0a205_168063_c1 | 3300050515 | Bacteria | 2089 |
| 521 | nmdc:mga0a205_260922_c1 | 3300050515 | Bacteria | 1610 |
| 522 | nmdc:mga0a205_29833_c1 | 3300050515 | Bacteria | 5219 |
| 523 | nmdc:mga0a205_764969_c1 | 3300050515 | Unclassified | 814 |
| 524 | nmdc:mga0a205_8701_c1 | 3300050515 | Bacteria | 9243 |
| 525 | Ga0587084_089190 | 3300059477 | Unclassified | 609 |
| 526 | Ga0530510_0027540 | 3300061734 | Unclassified | 4072 |
| 527 | Ga0068852_101399826 | |||
| 528 | JGI25406J46586_10167017 | |||
| 529 | JGI25406J46586_10183362 | |||
| 530 | Ga0065714_10064478 | |||
| 531 | Ga0065704_10109683 | |||
| 532 | Ga0065704_10125594 | |||
| 533 | Ga0065712_10000121 | |||
| 534 | Ga0065712_10287493 | |||
| 535 | Ga0065715_10022813 | |||
| 536 | Ga0065715_10162772 | |||
| 537 | Ga0070690_100918041 | |||
| 538 | Ga0070670_100928507 | |||
| 539 | Ga0070670_101143510 | |||
| 540 | Ga0068869_100452085 | |||
| 541 | Ga0070680_100017998 | |||
| 542 | Ga0070680_100477365 | |||
| 543 | Ga0070680_101123161 | |||
| 544 | Ga0070689_100001007 | |||
| 545 | Ga0070689_100833661 | |||
| 546 | Ga0070689_101093471 | |||
| 547 | Ga0070687_101405260 | |||
| 548 | Ga0070661_100459047 | |||
| 549 | Ga0070661_100534165 | |||
| 550 | Ga0070661_100880598 | |||
| 551 | Ga0070692_10306853 | |||
| 552 | Ga0070692_10387533 | |||
| 553 | Ga0070692_10727824 | |||
| 554 | Ga0070692_11029790 | |||
| 555 | Ga0070668_100312247 | |||
| 556 | Ga0070673_100747043 | |||
| 557 | Ga0070673_101189261 | |||
| 558 | Ga0070673_101363624 | |||
| 559 | Ga0070673_101516384 | |||
| 560 | Ga0070659_101415365 | |||
| 561 | Ga0070705_100026001 | |||
| 562 | Ga0070705_100103396 | |||
| 563 | Ga0070705_100326546 | |||
| 564 | Ga0070705_100537399 | |||
| 565 | Ga0070705_100756889 | |||
| 566 | Ga0070705_101213134 | |||
| 567 | Ga0070700_100000068 | |||
| 568 | Ga0070700_101031541 | |||
| 569 | Ga0070700_101502055 | |||
| 570 | Ga0070694_100012173 | |||
| 571 | Ga0070694_100306264 | |||
| 572 | Ga0070694_100317245 | |||
| 573 | Ga0070694_100663136 | |||
| 574 | Ga0070694_100674583 | |||
| 575 | Ga0070694_101120649 | |||
| 576 | Ga0070694_101497810 | |||
| 577 | Ga0070694_101589488 | |||
| 578 | Ga0070694_101672635 | |||
| 579 | Ga0070663_101648216 | |||
| 580 | Ga0070681_10002491 | |||
| 581 | Ga0070681_10155647 | |||
| 582 | Ga0068867_100148862 | |||
| 583 | Ga0068867_100551255 | |||
| 584 | Ga0070685_10516836 | |||
| 585 | Ga0070685_10943499 | |||
| 586 | Ga0070706_100292938 | |||
| 587 | Ga0070707_100078827 | |||
| 588 | Ga0070707_100444995 | |||
| 589 | Ga0070698_100062150 | |||
| 590 | Ga0070699_100002708 | |||
| 591 | Ga0070699_101183518 | |||
| 592 | Ga0070684_100853424 | |||
| 593 | Ga0070684_101701623 | |||
| 594 | Ga0070697_100711330 | |||
| 595 | Ga0068853_100263973 | |||
| 596 | Ga0068853_101731262 | |||
| 597 | Ga0070672_101391652 | |||
| 598 | Ga0070695_100052011 | |||
| 599 | Ga0070695_100109451 | |||
| 600 | Ga0070695_100448601 | |||
| 601 | Ga0070695_100780662 | |||
| 602 | Ga0070695_100904252 | |||
| 603 | Ga0070695_101016395 | |||
| 604 | Ga0070696_100087268 | |||
| 605 | Ga0070693_100006779 | |||
| 606 | Ga0070693_100166307 | |||
| 607 | Ga0070693_100544790 | |||
| 608 | Ga0070693_100813430 | |||
| 609 | Ga0070693_101501498 | |||
| 610 | Ga0070665_100945412 | |||
| 611 | Ga0070704_100275548 | |||
| 612 | Ga0070704_100976426 | |||
| 613 | Ga0070664_100252279 | |||
| 614 | Ga0070664_100873593 | |||
| 615 | Ga0068857_100242725 | |||
| 616 | Ga0068857_101113978 | |||
| 617 | Ga0068857_101576895 | |||
| 618 | Ga0068854_101671105 | |||
| 619 | Ga0070702_100161751 | |||
| 620 | Ga0070702_100295785 | |||
| 621 | Ga0070702_101055343 | |||
| 622 | Ga0068852_101547539 | |||
| 623 | Ga0068859_100012062 | |||
| 624 | Ga0068859_100088309 | |||
| 625 | Ga0068859_100088550 | |||
| 626 | Ga0068859_100226499 | |||
| 627 | Ga0068859_100704202 | |||
| 628 | Ga0068859_100704245 | |||
| 629 | Ga0068864_100003653 | |||
| 630 | Ga0068864_100038506 | |||
| 631 | Ga0068864_100350794 | |||
| 632 | Ga0068864_101221463 | |||
| 633 | Ga0068864_101229917 | |||
| 634 | Ga0068864_101933967 | |||
| 635 | Ga0068861_100006754 | |||
| 636 | Ga0068861_100268822 | |||
| 637 | Ga0068861_102486581 | |||
| 638 | Ga0068851_10017471 | |||
| 639 | Ga0068851_10247230 | |||
| 640 | Ga0068851_10376228 | |||
| 641 | Ga0068870_10023580 | |||
| 642 | Ga0068863_100046962 | |||
| 643 | Ga0068863_100503817 | |||
| 644 | Ga0068858_100038503 | |||
| 645 | Ga0068858_100124225 | |||
| 646 | Ga0068858_100412955 | |||
| 647 | Ga0068858_100785922 | |||
| 648 | Ga0068858_100894109 | |||
| 649 | Ga0068858_101097170 | |||
| 650 | Ga0068858_101403949 | |||
| 651 | Ga0068860_100274828 | |||
| 652 | Ga0068860_100302962 | |||
| 653 | Ga0068860_100844409 | |||
| 654 | Ga0068860_101164206 | |||
| 655 | Ga0068862_101291323 | |||
| 656 | Ga0081455_10910690 | |||
| 657 | Ga0081539_10003751 | |||
| 658 | Ga0070716_100263936 | |||
| 659 | Ga0097621_100171585 | |||
| 660 | Ga0068871_100824054 | |||
| 661 | Ga0075428_100414519 | |||
| 662 | Ga0075428_101169100 | |||
| 663 | Ga0075428_101610306 | |||
| 664 | Ga0075430_100062015 | |||
| 665 | Ga0075430_100098592 | |||
| 666 | Ga0075431_100305785 | |||
| 667 | Ga0075431_100718924 | |||
| 668 | Ga0075433_10042245 | |||
| 669 | Ga0075433_10243431 | |||
| 670 | Ga0075433_10300999 | |||
| 671 | Ga0075433_10582712 | |||
| 672 | Ga0075433_11076533 | |||
| 673 | Ga0075434_100029971 | |||
| 674 | Ga0075434_100186634 | |||
| 675 | Ga0075429_100037218 | |||
| 676 | Ga0075429_100099109 | |||
| 677 | Ga0097620_100012062 | |||
| 678 | Ga0097620_100088308 | |||
| 679 | Ga0097620_100088550 | |||
| 680 | Ga0097620_100226495 | |||
| 681 | Ga0097620_100704189 | |||
| 682 | Ga0097620_100704265 | |||
| 683 | Ga0097620_102365239 | |||
| 684 | Ga0105251_10129258 | |||
| 685 | Ga0105240_10207491 | |||
| 686 | Ga0105240_11640797 | |||
| 687 | Ga0111539_10072578 | |||
| 688 | Ga0111539_10619093 | |||
| 689 | Ga0105247_10072435 | |||
| 690 | Ga0105247_10283967 | |||
| 691 | Ga0105247_10671557 | |||
| 692 | Ga0114129_10005287 | |||
| 693 | Ga0114129_10027868 | |||
| 694 | Ga0114129_10035685 | |||
| 695 | Ga0114129_10170643 | |||
| 696 | Ga0114129_10195542 | |||
| 697 | Ga0114129_10939140 | |||
| 698 | Ga0114129_11175724 | |||
| 699 | Ga0114129_11269206 | |||
| 700 | Ga0105243_10548850 | |||
| 701 | Ga0105243_11606745 | |||
| 702 | Ga0105241_10104498 | |||
| 703 | Ga0105241_10123008 | |||
| 704 | Ga0105241_10162692 | |||
| 705 | Ga0105241_10307185 | |||
| 706 | Ga0105241_10309221 | |||
| 707 | Ga0105241_10314383 | |||
| 708 | Ga0105241_10415732 | |||
| 709 | Ga0105241_11287003 | |||
| 710 | Ga0105242_10254950 | |||
| 711 | Ga0105242_10929200 | |||
| 712 | Ga0105242_13001336 | |||
| 713 | Ga0105248_10003960 | |||
| 714 | Ga0105248_10004713 | |||
| 715 | Ga0105248_10009706 | |||
| 716 | Ga0105248_10158934 | |||
| 717 | Ga0105248_10186896 | |||
| 718 | Ga0105248_10334029 | |||
| 719 | Ga0105248_10652006 | |||
| 720 | Ga0105248_11372903 | |||
| 721 | Ga0105248_12764813 | |||
| 722 | Ga0105237_10000218 | |||
| 723 | Ga0105237_11368745 | |||
| 724 | Ga0105249_10579523 | |||
| 725 | Ga0105249_10776453 | |||
| 726 | Ga0105239_10130040 | |||
| 727 | Ga0105239_10610936 | |||
| 728 | Ga0105239_11157002 | |||
| 729 | Ga0105239_13405389 | |||
| 730 | Ga0105246_10138404 | |||
| 731 | Ga0105246_10161990 | |||
| 732 | Ga0105246_10184885 | |||
| 733 | Ga0105246_10186137 | |||
| 734 | Ga0157373_10003516 | |||
| 735 | Ga0157373_10203951 | |||
| 736 | Ga0157373_10364058 | |||
| 737 | Ga0157373_10725287 | |||
| 738 | Ga0157374_10043193 | |||
| 739 | Ga0157374_12617485 | |||
| 740 | Ga0157378_10220353 | |||
| 741 | Ga0157378_10378696 | |||
| 742 | Ga0163162_10001781 | |||
| 743 | Ga0163162_10041264 | |||
| 744 | Ga0163162_10109030 | |||
| 745 | Ga0157372_10003659 | |||
| 746 | Ga0157372_10515404 | |||
| 747 | Ga0157372_11071197 | |||
| 748 | Ga0157372_11849867 | |||
| 749 | Ga0157372_12051322 | |||
| 750 | Ga0157375_10004640 | |||
| 751 | Ga0157375_10187794 | |||
| 752 | Ga0157375_10335010 | |||
| 753 | Ga0157375_10745965 | |||
| 754 | Ga0157375_12635108 | |||
| 755 | Ga0157375_13698052 | |||
| 756 | Ga0163163_10004770 | |||
| 757 | Ga0163163_10007150 | |||
| 758 | Ga0163163_10023305 | |||
| 759 | Ga0163163_10080952 | |||
| 760 | Ga0163163_10282246 | |||
| 761 | Ga0163163_10482720 | |||
| 762 | Ga0163163_10787659 | |||
| 763 | Ga0157380_10001508 | |||
| 764 | Ga0157380_10339866 | |||
| 765 | Ga0157380_10732757 | |||
| 766 | Ga0157380_11241905 | |||
| 767 | Ga0157377_10239513 | |||
| 768 | Ga0157377_10616872 | |||
| 769 | Ga0157377_10670252 | |||
| 770 | Ga0157379_10120549 | |||
| 771 | Ga0157379_10660057 | |||
| 772 | Ga0157379_11810209 | |||
| 773 | Ga0157376_10054357 | |||
| 774 | Ga0157376_10260872 | |||
| 775 | Ga0182007_10171529 | |||
| 776 | Ga0182005_1270628 | |||
| 777 | Ga0207656_10006073 | |||
| 778 | Ga0207653_10002952 | |||
| 779 | Ga0207710_10037922 | |||
| 780 | Ga0207710_10254744 | |||
| 781 | Ga0207688_10295238 | |||
| 782 | Ga0207645_10594709 | |||
| 783 | Ga0207643_10002208 | |||
| 784 | Ga0207643_10461221 | |||
| 785 | Ga0207684_10000704 | |||
| 786 | Ga0207684_10062269 | |||
| 787 | Ga0207654_10247973 | |||
| 788 | Ga0207654_10840155 | |||
| 789 | Ga0207707_10000050 | |||
| 790 | Ga0207707_10023668 | |||
| 791 | Ga0207671_10026421 | |||
| 792 | Ga0207662_10122719 | |||
| 793 | Ga0207662_10150082 | |||
| 794 | Ga0207649_10250293 | |||
| 795 | Ga0207649_10346893 | |||
| 796 | Ga0207649_10637646 | |||
| 797 | Ga0207649_10755024 | |||
| 798 | Ga0207652_10000170 | |||
| 799 | Ga0207681_10637406 | |||
| 800 | Ga0207650_10228380 | |||
| 801 | Ga0207650_10273999 | |||
| 802 | Ga0207690_11213099 | |||
| 803 | Ga0207686_10012213 | |||
| 804 | Ga0207686_10497328 | |||
| 805 | Ga0207709_10007813 | |||
| 806 | Ga0207670_10000411 | |||
| 807 | Ga0207704_10641312 | |||
| 808 | Ga0207665_10131805 | |||
| 809 | Ga0207691_10067002 | |||
| 810 | Ga0207691_10876707 | |||
| 811 | Ga0207691_11100110 | |||
| 812 | Ga0207711_10008164 | |||
| 813 | Ga0207711_10647727 | |||
| 814 | Ga0207711_11246567 | |||
| 815 | Ga0207689_10440428 | |||
| 816 | Ga0207689_10615436 | |||
| 817 | Ga0207679_10900827 | |||
| 818 | Ga0207651_10247748 | |||
| 819 | Ga0207651_10648170 | |||
| 820 | Ga0207651_11250154 | |||
| 821 | Ga0207651_11375215 | |||
| 822 | Ga0207640_10080712 | |||
| 823 | Ga0207640_10847331 | |||
| 824 | Ga0207640_11379750 | |||
| 825 | Ga0207677_10639879 | |||
| 826 | Ga0207677_10802290 | |||
| 827 | Ga0207703_10014576 | |||
| 828 | Ga0207703_10203502 | |||
| 829 | Ga0207708_10000130 | |||
| 830 | Ga0207708_10036670 | |||
| 831 | Ga0207641_10068382 | |||
| 832 | Ga0207641_10490633 | |||
| 833 | Ga0207648_10120012 | |||
| 834 | Ga0207648_10328617 | |||
| 835 | Ga0207648_10405182 | |||
| 836 | Ga0207676_10030190 | |||
| 837 | Ga0207676_11113329 | |||
| 838 | Ga0207676_12228304 | |||
| 839 | Ga0207674_10121359 | |||
| 840 | Ga0207674_10642330 | |||
| 841 | Ga0207675_100029042 | |||
| 842 | Ga0207675_100363843 | |||
| 843 | Ga0207683_11371188 | |||
| 844 | Ga0207698_10403297 | |||
| 845 | Ga0207428_10053272 | |||
| 846 | Ga0268265_10960859 | |||
| 847 | Ga0268265_11883974 | |||
| 848 | Ga0268264_10487401 | |||
| 849 | Ga0268264_11001136 | |||
| 850 | Ga0268264_11116546 | |||
| 851 | Ga0307408_100033757 | |||
| 852 | Ga0307413_10698712 | |||
| 853 | Ga0307410_10986049 | |||
| 854 | Ga0307406_10263285 | |||
| 855 | Ga0307407_10141765 | |||
| 856 | Ga0307412_10002344 | |||
| 857 | Ga0307412_10018161 | |||
| 858 | Ga0307409_101997119 | |||
| 859 | Ga0307416_100011472 | |||
| 860 | Ga0307416_100228217 | |||
| 861 | Ga0307411_10184514 | |||
| 862 | Ga0307411_10376676 | |||
| 863 | Ga0307415_100110751 | |||
| 864 | Ga0373930_0054771 | |||
| 865 | Ga0373930_0115525 | |||
| 866 | Ga0373930_0164422 | |||
| 867 | Ga0373940_0019452 | |||
| 868 | Ga0373940_0195611 | |||
| 869 | Ga0373949_0019273 | |||
| 870 | Ga0373951_0003682 | |||
| 871 | Ga0373952_0048822 | |||
| 872 | Ga0373939_0090964 | |||
| 873 | Ga0373941_0233760 | |||
| 874 | Ga0373942_0028923 | |||
| 875 | Ga0373962_0176905 | |||
| 876 | Ga0373931_0565366 | |||
| 877 | Ga0395899_0346505 | |||
| 878 | Ga0395900_0246517 | |||
| 879 | Ga0395900_0902510 | |||
| 880 | Ga0395900_1594996 | |||
| 881 | Ga0395898_0130872 | |||
| 882 | Ga0395898_0955345 | |||
| 883 | Ga0395905_1420841 | |||
| 884 | Ga0242419_002641 | |||
| 885 | Ga0242420_010297 | |||
| 886 | Ga0242420_027179 | |||
| 887 | Ga0439436_0097755 | |||
| 888 | Ga0451807_0728375 | |||
| 889 | Ga0439448_0033257 | |||
| 890 | Ga0450889_014253 | |||
| 891 | Ga0439458_0008285 | |||
| 892 | Ga0439459_0090154 | |||
| 893 | Ga0439464_0097405 | |||
| 894 | Ga0451576_0463459 | |||
| 895 | Ga0451576_0840800 | |||
| 896 | Ga0451576_1031786 | |||
| 897 | Ga0451576_1282489 | |||
| 898 | Ga0451576_1708602 | |||
| 899 | Ga0495582_0024952 | |||
| 900 | Ga0495643_0260892 | |||
| 901 | Ga0495658_0159303 | |||
| 902 | Ga0496101_1011467 | |||
| 903 | Ga0496102_1138843 | |||
| 904 | Ga0496103_0753159 | |||
| 905 | Ga0496104_0673515 | |||
| 906 | Ga0496104_0726743 | |||
| 907 | Ga0496106_0043744 | |||
| 908 | Ga0496106_0484755 | |||
| 909 | Ga0496107_0550524 | |||
| 910 | Ga0496108_0266108 | |||
| 911 | Ga0496108_0530007 | |||
| 912 | Ga0496108_0847639 | |||
| 913 | Ga0496108_0917616 | |||
| 914 | Ga0496109_0998103 | |||
| 915 | Ga0496110_0529316 | |||
| 916 | Ga0496112_0042112 | |||
| 917 | Ga0496112_0278693 | |||
| 918 | Ga0496112_0327586 | |||
| 919 | Ga0496112_0469912 | |||
| 920 | Ga0496112_0495236 | |||
| 921 | Ga0496112_0712929 | |||
| 922 | Ga0496113_0414319 | |||
| 923 | Ga0501291_006885 | |||
| 924 | Ga0501291_011315 | |||
| 925 | Ga0501291_120497 | |||
| 926 | Ga0501291_141355 | |||
| 927 | Ga0501292_003900 | |||
| 928 | Ga0501295_064273 | |||
| 929 | Ga0501296_000282 | |||
| 930 | Ga0501296_052418 | |||
| 931 | Ga0501297_006153 | |||
| 932 | Ga0501298_000267 | |||
| 933 | Ga0501298_001215 | |||
| 934 | Ga0501298_059649 | |||
| 935 | Ga0501299_017802 | |||
| 936 | Ga0501299_105736 | |||
| 937 | Ga0501300_017864 | |||
| 938 | Ga0501300_053478 | |||
| 939 | Ga0501301_042568 | |||
| 940 | Ga0501303_016912 | |||
| 941 | Ga0501038_0000253 | |||
| 942 | Ga0501048_0824358 | |||
| 943 | Ga0501068_1181048 | |||
| 944 | Ga0501077_0975501 | |||
| 945 | Ga0501198_010277 | |||
| 946 | Ga0501202_006946 | |||
| 947 | Ga0501202_029067 | |||
| 948 | Ga0501202_038087 | |||
| 949 | Ga0501206_003799 | |||
| 950 | Ga0501206_005868 | |||
| 951 | Ga0501207_004275 | |||
| 952 | Ga0501209_079043 | |||
| 953 | Ga0501214_002822 | |||
| 954 | Ga0501216_003988 | |||
| 955 | Ga0501217_000895 | |||
| 956 | Ga0501217_021214 | |||
| 957 | Ga0501217_075045 | |||
| 958 | Ga0501223_003524 | |||
| 959 | Ga0501223_009462 | |||
| 960 | Ga0501223_036905 | |||
| 961 | Ga0501224_021069 | |||
| 962 | Ga0501227_016907 | |||
| 963 | Ga0501227_016987 | |||
| 964 | Ga0501227_116257 | |||
| 965 | Ga0501230_006226 | |||
| 966 | Ga0501230_047160 | |||
| 967 | Ga0501233_001770 | |||
| 968 | Ga0501233_012557 | |||
| 969 | Ga0501233_128288 | |||
| 970 | Ga0501235_001974 | |||
| 971 | Ga0501235_012889 | |||
| 972 | Ga0501235_035783 | |||
| 973 | Ga0501236_037151 | |||
| 974 | Ga0501240_040074 | |||
| 975 | Ga0501242_004004 | |||
| 976 | Ga0501243_099048 | |||
| 977 | Ga0501249_002427 | |||
| 978 | Ga0501249_061689 | |||
| 979 | Ga0501250_005598 | |||
| 980 | Ga0501250_021044 | |||
| 981 | Ga0501251_060162 | |||
| 982 | Ga0501252_094547 | |||
| 983 | Ga0501253_045306 | |||
| 984 | Ga0501253_163607 | |||
| 985 | Ga0501255_032429 | |||
| 986 | Ga0501257_063510 | |||
| 987 | Ga0501259_003342 | |||
| 988 | Ga0501259_006744 | |||
| 989 | Ga0501259_029879 | |||
| 990 | Ga0501260_001971 | |||
| 991 | Ga0501260_025547 | |||
| 992 | Ga0501261_028849 | |||
| 993 | Ga0501261_039254 | |||
| 994 | Ga0501261_082814 | |||
| 995 | Ga0501221_019701 | |||
| 996 | Ga0501225_0000908 | |||
| 997 | Ga0501225_0013521 | |||
| 998 | Ga0501225_0062848 | |||
| 999 | Ga0501234_006122 | |||
| 1000 | Ga0501234_010835 | |||
| 1001 | Ga0501234_018995 | |||
| 1002 | Ga0501234_030597 | |||
| 1003 | Ga0501245_029694 | |||
| 1004 | Ga0501245_054529 | |||
| 1005 | Ga0501241_019831 | |||
| 1006 | Ga0501262_010847 | |||
| 1007 | Ga0501263_016675 | |||
| 1008 | Ga0501264_028125 | |||
| 1009 | Ga0501266_028420 | |||
| 1010 | Ga0501266_029474 | |||
| 1011 | Ga0501270_143583 | |||
| 1012 | Ga0501271_005289 | |||
| 1013 | Ga0501271_055593 | |||
| 1014 | Ga0501273_006382 | |||
| 1015 | Ga0501275_008172 | |||
| 1016 | Ga0501279_009656 | |||
| 1017 | Ga0501279_019663 | |||
| 1018 | Ga0501279_043059 | |||
| 1019 | Ga0501283_022264 | |||
| 1020 | Ga0501283_030929 | |||
| 1021 | Ga0501204_006583 | |||
| 1022 | Ga0501212_001517 | |||
| 1023 | Ga0501212_062178 | |||
| 1024 | Ga0501226_001043 | |||
| 1025 | nmdc:mga05p37_123328_c1 | |||
| 1026 | nmdc:mga05p37_1288319_c1 | |||
| 1027 | nmdc:mga05p37_160816_c1 | |||
| 1028 | nmdc:mga05p37_290621_c1 | |||
| 1029 | nmdc:mga05p37_42760_c1 | |||
| 1030 | nmdc:mga05p37_843709_c1 | |||
| 1031 | nmdc:mga09592_502114_c1 | |||
| 1032 | nmdc:mga09592_798248_c1 | |||
| 1033 | nmdc:mga0qj67_137229_c1 | |||
| 1034 | nmdc:mga06r32_122023_c2 | |||
| 1035 | nmdc:mga06r32_68185_c1 | |||
| 1036 | nmdc:mga08y16_106967_c1 | |||
| 1037 | nmdc:mga08y16_78707_c1 | |||
| 1038 | nmdc:mga0n895_101294_c1 | |||
| 1039 | nmdc:mga0n895_397694_c1 | |||
| 1040 | nmdc:mga0n895_520888_c1 | |||
| 1041 | nmdc:mga0n895_995947_c1 | |||
| 1042 | nmdc:mga0rr50_65054_c1 | |||
| 1043 | nmdc:mga08x19_30486_c1 | |||
| 1044 | nmdc:mga0a205_1415875_c1 | |||
| 1045 | nmdc:mga0a205_16663_c1 | |||
| 1046 | nmdc:mga0a205_168063_c1 | |||
| 1047 | nmdc:mga0a205_260922_c1 | |||
| 1048 | nmdc:mga0a205_29833_c1 | |||
| 1049 | nmdc:mga0a205_764969_c1 | |||
| 1050 | nmdc:mga0a205_8701_c1 | |||
| 1051 | Ga0587084_089190 | |||
| 1052 | Ga0530510_0027540 |