F459345
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 525 | 284 | 525 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300049744|Ga0501083_1075290|Ga0501083_1075290_11_400 |
| Length | 129 |
| Sequence | MYPAAAYTSTVDGSDMPRPPVDLLQGTLDLLVLKTLSWGPAHGYAIARWIEQLTGDVLQVGEGSLYPALHRLEARDWIESEWRLSEHNRRAKFYQLTGLGRRQLREETRSWGLLVEAVGKVLRTREQPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 48 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 56 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 84 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 86 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 137 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 138 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 139 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 140 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 141 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 142 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 143 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 144 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 145 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 146 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 147 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 148 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 149 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 150 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 151 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 154 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 155 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 156 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 157 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 158 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 160 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 161 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 165 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 168 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 169 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 176 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 177 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 178 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 180 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 181 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 182 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 183 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 184 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 185 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 186 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 187 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 188 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 189 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 231 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 232 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 233 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 234 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 235 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 236 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 237 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 259 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 260 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 262 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 267 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 268 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 284 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.33 |
| Rhizosphere | 97.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10215359 | 3300005290 | Unclassified | 1058 |
| 2 | Ga0065715_10239422 | 3300005293 | Bacteria | 1204 |
| 3 | Ga0070658_10079569 | 3300005327 | Bacteria | 2691 |
| 4 | Ga0070658_10723431 | 3300005327 | Unclassified | 864 |
| 5 | Ga0070676_10669729 | 3300005328 | Unclassified | 755 |
| 6 | Ga0070670_100615237 | 3300005331 | Bacteria | 973 |
| 7 | Ga0070677_10155604 | 3300005333 | Bacteria | 1068 |
| 8 | Ga0068869_101319739 | 3300005334 | Unclassified | 637 |
| 9 | Ga0068869_101336998 | 3300005334 | Bacteria | 633 |
| 10 | Ga0070680_100050521 | 3300005336 | Bacteria | 3392 |
| 11 | Ga0070680_101491244 | 3300005336 | Bacteria | 586 |
| 12 | Ga0070689_100089760 | 3300005340 | Bacteria | 2421 |
| 13 | Ga0070691_10011449 | 3300005341 | Bacteria | 4051 |
| 14 | Ga0070687_100620795 | 3300005343 | Bacteria | 745 |
| 15 | Ga0070687_100680508 | 3300005343 | Bacteria | 716 |
| 16 | Ga0070668_100714195 | 3300005347 | Bacteria | 885 |
| 17 | Ga0070668_101176908 | 3300005347 | Bacteria | 694 |
| 18 | Ga0070669_100006088 | 3300005353 | Bacteria | 8704 |
| 19 | Ga0070669_100048016 | 3300005353 | Bacteria | 3115 |
| 20 | Ga0070669_100170913 | 3300005353 | Bacteria | 1694 |
| 21 | Ga0070675_100345315 | 3300005354 | Unclassified | 1319 |
| 22 | Ga0070675_100644481 | 3300005354 | Bacteria | 962 |
| 23 | Ga0070675_100677754 | 3300005354 | Bacteria | 938 |
| 24 | Ga0070674_100797691 | 3300005356 | Bacteria | 815 |
| 25 | Ga0070673_100121798 | 3300005364 | Bacteria | 2177 |
| 26 | Ga0070688_100146186 | 3300005365 | Unclassified | 1611 |
| 27 | Ga0070688_100194217 | 3300005365 | Unclassified | 1416 |
| 28 | Ga0070688_100652293 | 3300005365 | Bacteria | 811 |
| 29 | Ga0070709_10038976 | 3300005434 | Unclassified | 2913 |
| 30 | Ga0070709_10132087 | 3300005434 | Bacteria | 1706 |
| 31 | Ga0070709_10242739 | 3300005434 | Unclassified | 1294 |
| 32 | Ga0070709_10597096 | 3300005434 | Bacteria | 849 |
| 33 | Ga0070714_100195359 | 3300005435 | Unclassified | 1848 |
| 34 | Ga0070713_100048884 | 3300005436 | Unclassified | 3486 |
| 35 | Ga0070713_100768194 | 3300005436 | Unclassified | 923 |
| 36 | Ga0070710_10011232 | 3300005437 | Bacteria | 4421 |
| 37 | Ga0070701_11238948 | 3300005438 | Unclassified | 531 |
| 38 | Ga0070711_100043659 | 3300005439 | Bacteria | 3037 |
| 39 | Ga0070711_100184597 | 3300005439 | Bacteria | 1598 |
| 40 | Ga0070700_100308589 | 3300005441 | Bacteria | 1158 |
| 41 | Ga0070694_100237143 | 3300005444 | Unclassified | 1374 |
| 42 | Ga0070694_101206820 | 3300005444 | Bacteria | 634 |
| 43 | Ga0070708_100552344 | 3300005445 | Bacteria | 1086 |
| 44 | Ga0070708_101562941 | 3300005445 | Unclassified | 614 |
| 45 | Ga0070662_100762742 | 3300005457 | Bacteria | 821 |
| 46 | Ga0070681_10113327 | 3300005458 | Bacteria | 2651 |
| 47 | Ga0070681_10155300 | 3300005458 | Unclassified | 2214 |
| 48 | Ga0070681_10157874 | 3300005458 | Bacteria | 2192 |
| 49 | Ga0070681_10316334 | 3300005458 | Unclassified | 1471 |
| 50 | Ga0068867_100101346 | 3300005459 | Bacteria | 2200 |
| 51 | Ga0070706_100452480 | 3300005467 | Bacteria | 1195 |
| 52 | Ga0070707_101837658 | 3300005468 | Bacteria | 573 |
| 53 | Ga0070707_102286392 | 3300005468 | Bacteria | 508 |
| 54 | Ga0070698_100130073 | 3300005471 | Bacteria | 2473 |
| 55 | Ga0070698_100341027 | 3300005471 | Unclassified | 1430 |
| 56 | Ga0070699_100601749 | 3300005518 | Unclassified | 1002 |
| 57 | Ga0070679_100039986 | 3300005530 | Bacteria | 4663 |
| 58 | Ga0070679_100126247 | 3300005530 | Bacteria | 2541 |
| 59 | Ga0070679_101357104 | 3300005530 | Unclassified | 657 |
| 60 | Ga0070684_100025126 | 3300005535 | Bacteria | 5003 |
| 61 | Ga0070684_100351305 | 3300005535 | Bacteria | 1356 |
| 62 | Ga0070684_100351797 | 3300005535 | Bacteria | 1355 |
| 63 | Ga0070697_100566293 | 3300005536 | Bacteria | 997 |
| 64 | Ga0068853_100563314 | 3300005539 | Bacteria | 1080 |
| 65 | Ga0070672_100019796 | 3300005543 | Bacteria | 4894 |
| 66 | Ga0070665_100432484 | 3300005548 | Unclassified | 1325 |
| 67 | Ga0070704_100070324 | 3300005549 | Unclassified | 2539 |
| 68 | Ga0070704_101767485 | 3300005549 | Bacteria | 572 |
| 69 | Ga0070664_100414574 | 3300005564 | Bacteria | 1233 |
| 70 | Ga0068857_100199740 | 3300005577 | Bacteria | 1823 |
| 71 | Ga0068852_100212429 | 3300005616 | Bacteria | 1836 |
| 72 | Ga0068859_100158376 | 3300005617 | Unclassified | 2343 |
| 73 | Ga0068859_100523459 | 3300005617 | Bacteria | 1281 |
| 74 | Ga0068864_101792664 | 3300005618 | Bacteria | 619 |
| 75 | Ga0068861_100051345 | 3300005719 | Bacteria | 3130 |
| 76 | Ga0068861_101268819 | 3300005719 | Bacteria | 715 |
| 77 | Ga0068861_101660738 | 3300005719 | Bacteria | 631 |
| 78 | Ga0068870_10055211 | 3300005840 | Bacteria | 2116 |
| 79 | Ga0068863_101874959 | 3300005841 | Bacteria | 609 |
| 80 | Ga0068860_102173632 | 3300005843 | Bacteria | 576 |
| 81 | Ga0068862_100018966 | 3300005844 | Bacteria | 5734 |
| 82 | Ga0068862_100048668 | 3300005844 | Bacteria | 3619 |
| 83 | Ga0068862_100762296 | 3300005844 | Bacteria | 942 |
| 84 | Ga0068862_101014616 | 3300005844 | Unclassified | 821 |
| 85 | Ga0068862_102205464 | 3300005844 | Unclassified | 562 |
| 86 | Ga0070717_10061975 | 3300006028 | Unclassified | 3101 |
| 87 | Ga0070717_10293449 | 3300006028 | Unclassified | 1444 |
| 88 | Ga0075432_10491786 | 3300006058 | Bacteria | 545 |
| 89 | Ga0070712_100148559 | 3300006175 | Unclassified | 1796 |
| 90 | Ga0070712_100558606 | 3300006175 | Unclassified | 965 |
| 91 | Ga0075428_100008863 | 3300006844 | Bacteria | 11158 |
| 92 | Ga0075428_100068705 | 3300006844 | Bacteria | 3875 |
| 93 | Ga0075428_100152759 | 3300006844 | Bacteria | 2508 |
| 94 | Ga0075428_100910165 | 3300006844 | Unclassified | 933 |
| 95 | Ga0075430_100205677 | 3300006846 | Bacteria | 1634 |
| 96 | Ga0075431_100008852 | 3300006847 | Bacteria | 10085 |
| 97 | Ga0075431_100167563 | 3300006847 | Bacteria | 2258 |
| 98 | Ga0075431_100204858 | 3300006847 | Unclassified | 2017 |
| 99 | Ga0075431_100363338 | 3300006847 | Bacteria | 1454 |
| 100 | Ga0075433_10128812 | 3300006852 | Unclassified | 2248 |
| 101 | Ga0075434_100018262 | 3300006871 | Bacteria | 6772 |
| 102 | Ga0075434_100288152 | 3300006871 | Bacteria | 1662 |
| 103 | Ga0075434_100453160 | 3300006871 | Unclassified | 1304 |
| 104 | Ga0075434_101431880 | 3300006871 | Bacteria | 701 |
| 105 | Ga0075434_101465174 | 3300006871 | Bacteria | 692 |
| 106 | Ga0075429_100061451 | 3300006880 | Bacteria | 3273 |
| 107 | Ga0075429_100082402 | 3300006880 | Bacteria | 2804 |
| 108 | Ga0075429_100350905 | 3300006880 | Unclassified | 1292 |
| 109 | Ga0075429_100617352 | 3300006880 | Bacteria | 950 |
| 110 | Ga0068865_100077994 | 3300006881 | Bacteria | 2369 |
| 111 | Ga0075436_100079393 | 3300006914 | Bacteria | 2273 |
| 112 | Ga0097620_100158368 | 3300006931 | Unclassified | 2343 |
| 113 | Ga0097620_100523440 | 3300006931 | Bacteria | 1281 |
| 114 | Ga0075435_100029236 | 3300007076 | Unclassified | 4325 |
| 115 | Ga0075435_100284441 | 3300007076 | Unclassified | 1412 |
| 116 | Ga0111539_10005356 | 3300009094 | Bacteria | 16593 |
| 117 | Ga0111539_10008461 | 3300009094 | Bacteria | 13084 |
| 118 | Ga0111539_10048429 | 3300009094 | Bacteria | 5074 |
| 119 | Ga0111539_10071240 | 3300009094 | Bacteria | 4102 |
| 120 | Ga0111539_10201886 | 3300009094 | Bacteria | 2318 |
| 121 | Ga0105245_10857998 | 3300009098 | Unclassified | 948 |
| 122 | Ga0114129_10008837 | 3300009147 | Bacteria | 14375 |
| 123 | Ga0114129_10024621 | 3300009147 | Bacteria | 8530 |
| 124 | Ga0114129_10443507 | 3300009147 | Bacteria | 1704 |
| 125 | Ga0114129_11073951 | 3300009147 | Bacteria | 1009 |
| 126 | Ga0105243_10074625 | 3300009148 | Bacteria | 2751 |
| 127 | Ga0105241_10581627 | 3300009174 | Bacteria | 1009 |
| 128 | Ga0105241_11084309 | 3300009174 | Bacteria | 753 |
| 129 | Ga0105248_10136698 | 3300009177 | Bacteria | 2765 |
| 130 | Ga0105237_10457816 | 3300009545 | Bacteria | 1282 |
| 131 | Ga0105238_10021908 | 3300009551 | Bacteria | 6510 |
| 132 | Ga0105238_10087199 | 3300009551 | Unclassified | 3108 |
| 133 | Ga0105249_10004049 | 3300009553 | Bacteria | 12641 |
| 134 | Ga0105249_10011352 | 3300009553 | Bacteria | 7823 |
| 135 | Ga0105249_10290252 | 3300009553 | Unclassified | 1637 |
| 136 | Ga0105249_10305682 | 3300009553 | Unclassified | 1597 |
| 137 | Ga0105249_11743076 | 3300009553 | Bacteria | 695 |
| 138 | Ga0105239_10704586 | 3300010375 | Bacteria | 1154 |
| 139 | Ga0105246_11138110 | 3300011119 | Bacteria | 715 |
| 140 | Ga0157371_10136263 | 3300013102 | Bacteria | 1748 |
| 141 | Ga0163162_11369630 | 3300013306 | Bacteria | 805 |
| 142 | Ga0163162_12437799 | 3300013306 | Bacteria | 601 |
| 143 | Ga0157372_10010954 | 3300013307 | Bacteria | 9650 |
| 144 | Ga0157372_10019552 | 3300013307 | Bacteria | 7299 |
| 145 | Ga0157372_10660699 | 3300013307 | Unclassified | 1217 |
| 146 | Ga0157375_10857126 | 3300013308 | Bacteria | 1055 |
| 147 | Ga0163163_10000030 | 3300014325 | Bacteria | 171203 |
| 148 | Ga0157380_10078714 | 3300014326 | Bacteria | 2690 |
| 149 | Ga0157380_10198793 | 3300014326 | Bacteria | 1777 |
| 150 | Ga0157380_10769619 | 3300014326 | Unclassified | 976 |
| 151 | Ga0157380_10907252 | 3300014326 | Bacteria | 908 |
| 152 | Ga0157377_10114049 | 3300014745 | Bacteria | 1629 |
| 153 | Ga0157377_10297540 | 3300014745 | Bacteria | 1064 |
| 154 | Ga0157377_10912321 | 3300014745 | Bacteria | 658 |
| 155 | Ga0157376_10185656 | 3300014969 | Bacteria | 1904 |
| 156 | Ga0182007_10046524 | 3300015262 | Unclassified | 1437 |
| 157 | Ga0163161_11555516 | 3300017792 | Bacteria | 582 |
| 158 | Ga0213875_10003304 | 3300021388 | Bacteria | 9221 |
| 159 | Ga0207697_10246358 | 3300025315 | Bacteria | 790 |
| 160 | Ga0207682_10039988 | 3300025893 | Bacteria | 1909 |
| 161 | Ga0207692_10009464 | 3300025898 | Bacteria | 4072 |
| 162 | Ga0207688_10084929 | 3300025901 | Bacteria | 1813 |
| 163 | Ga0207699_10157079 | 3300025906 | Bacteria | 1511 |
| 164 | Ga0207699_10220540 | 3300025906 | Unclassified | 1294 |
| 165 | Ga0207699_10313497 | 3300025906 | Unclassified | 1098 |
| 166 | Ga0207645_10812404 | 3300025907 | Unclassified | 636 |
| 167 | Ga0207643_10094344 | 3300025908 | Bacteria | 1748 |
| 168 | Ga0207705_10159411 | 3300025909 | Bacteria | 1694 |
| 169 | Ga0207684_10264439 | 3300025910 | Bacteria | 1484 |
| 170 | Ga0207654_10359335 | 3300025911 | Bacteria | 1004 |
| 171 | Ga0207707_10026191 | 3300025912 | Bacteria | 5098 |
| 172 | Ga0207707_10153771 | 3300025912 | Unclassified | 2011 |
| 173 | Ga0207671_10966235 | 3300025914 | Bacteria | 672 |
| 174 | Ga0207693_10017898 | 3300025915 | Bacteria | 5649 |
| 175 | Ga0207693_11352947 | 3300025915 | Unclassified | 531 |
| 176 | Ga0207663_10761933 | 3300025916 | Bacteria | 769 |
| 177 | Ga0207660_10064037 | 3300025917 | Bacteria | 2653 |
| 178 | Ga0207660_11280192 | 3300025917 | Bacteria | 596 |
| 179 | Ga0207660_11515515 | 3300025917 | Bacteria | 542 |
| 180 | Ga0207662_10007501 | 3300025918 | Bacteria | 5939 |
| 181 | Ga0207657_10033664 | 3300025919 | Bacteria | 4616 |
| 182 | Ga0207649_10095539 | 3300025920 | Bacteria | 1956 |
| 183 | Ga0207649_11095522 | 3300025920 | Unclassified | 628 |
| 184 | Ga0207652_10055707 | 3300025921 | Bacteria | 3401 |
| 185 | Ga0207652_10106508 | 3300025921 | Bacteria | 2482 |
| 186 | Ga0207652_10128799 | 3300025921 | Bacteria | 2256 |
| 187 | Ga0207652_10807689 | 3300025921 | Bacteria | 833 |
| 188 | Ga0207681_10022208 | 3300025923 | Bacteria | 4044 |
| 189 | Ga0207681_10069261 | 3300025923 | Bacteria | 2453 |
| 190 | Ga0207681_10169484 | 3300025923 | Bacteria | 1654 |
| 191 | Ga0207694_10049390 | 3300025924 | Bacteria | 3257 |
| 192 | Ga0207694_10096109 | 3300025924 | Unclassified | 2343 |
| 193 | Ga0207650_10678260 | 3300025925 | Bacteria | 870 |
| 194 | Ga0207659_10120353 | 3300025926 | Bacteria | 2011 |
| 195 | Ga0207659_10626417 | 3300025926 | Bacteria | 918 |
| 196 | Ga0207659_11053770 | 3300025926 | Bacteria | 700 |
| 197 | Ga0207700_10059694 | 3300025928 | Unclassified | 2885 |
| 198 | Ga0207700_10088265 | 3300025928 | Unclassified | 2441 |
| 199 | Ga0207700_11255752 | 3300025928 | Bacteria | 660 |
| 200 | Ga0207664_11493590 | 3300025929 | Bacteria | 597 |
| 201 | Ga0207690_10145988 | 3300025932 | Bacteria | 1749 |
| 202 | Ga0207706_10142698 | 3300025933 | Bacteria | 2107 |
| 203 | Ga0207706_11373648 | 3300025933 | Bacteria | 581 |
| 204 | Ga0207709_10232061 | 3300025935 | Bacteria | 1337 |
| 205 | Ga0207704_10034903 | 3300025938 | Bacteria | 2875 |
| 206 | Ga0207704_10232287 | 3300025938 | Bacteria | 1372 |
| 207 | Ga0207691_10256275 | 3300025940 | Bacteria | 1509 |
| 208 | Ga0207689_11703778 | 3300025942 | Bacteria | 522 |
| 209 | Ga0207661_10128959 | 3300025944 | Bacteria | 2163 |
| 210 | Ga0207679_10154510 | 3300025945 | Bacteria | 1872 |
| 211 | Ga0207651_10015089 | 3300025960 | Bacteria | 4480 |
| 212 | Ga0207712_10010343 | 3300025961 | Bacteria | 5921 |
| 213 | Ga0207712_10014842 | 3300025961 | Bacteria | 5015 |
| 214 | Ga0207668_10143982 | 3300025972 | Bacteria | 1836 |
| 215 | Ga0207668_11546550 | 3300025972 | Bacteria | 599 |
| 216 | Ga0207658_11173688 | 3300025986 | Bacteria | 702 |
| 217 | Ga0207639_10517793 | 3300026041 | Bacteria | 1092 |
| 218 | Ga0207639_11094827 | 3300026041 | Bacteria | 747 |
| 219 | Ga0207708_10061937 | 3300026075 | Bacteria | 2857 |
| 220 | Ga0207708_10577460 | 3300026075 | Bacteria | 950 |
| 221 | Ga0207641_11653961 | 3300026088 | Bacteria | 642 |
| 222 | Ga0207648_10069251 | 3300026089 | Bacteria | 3074 |
| 223 | Ga0207676_11460768 | 3300026095 | Bacteria | 680 |
| 224 | Ga0207674_10124874 | 3300026116 | Bacteria | 2539 |
| 225 | Ga0207675_100078714 | 3300026118 | Bacteria | 3089 |
| 226 | Ga0207675_100439882 | 3300026118 | Bacteria | 1290 |
| 227 | Ga0207675_100460641 | 3300026118 | Bacteria | 1261 |
| 228 | Ga0207698_10059379 | 3300026142 | Bacteria | 2969 |
| 229 | Ga0209982_1037195 | 3300027552 | Unclassified | 773 |
| 230 | Ga0207428_10014862 | 3300027907 | Bacteria | 6743 |
| 231 | Ga0207428_10197706 | 3300027907 | Bacteria | 1513 |
| 232 | Ga0207428_10208793 | 3300027907 | Bacteria | 1468 |
| 233 | Ga0268266_10615093 | 3300028379 | Bacteria | 1044 |
| 234 | Ga0268265_10031042 | 3300028380 | Bacteria | 3855 |
| 235 | Ga0268265_10122756 | 3300028380 | Bacteria | 2143 |
| 236 | Ga0268265_11126912 | 3300028380 | Bacteria | 780 |
| 237 | Ga0268265_12022158 | 3300028380 | Unclassified | 583 |
| 238 | Ga0268264_12506090 | 3300028381 | Bacteria | 521 |
| 239 | Ga0265340_10263035 | 3300031247 | Bacteria | 768 |
| 240 | Ga0307408_100595784 | 3300031548 | Bacteria | 981 |
| 241 | Ga0307408_100635733 | 3300031548 | Bacteria | 952 |
| 242 | Ga0307408_102523782 | 3300031548 | Bacteria | 500 |
| 243 | Ga0316576_10006305 | 3300031727 | Bacteria | 7370 |
| 244 | Ga0316578_10185201 | 3300031728 | Bacteria | 1255 |
| 245 | Ga0307405_10044191 | 3300031731 | Bacteria | 2723 |
| 246 | Ga0307405_10150268 | 3300031731 | Bacteria | 1637 |
| 247 | Ga0307405_12002520 | 3300031731 | Unclassified | 518 |
| 248 | Ga0307413_10013834 | 3300031824 | Bacteria | 4075 |
| 249 | Ga0307413_10311791 | 3300031824 | Bacteria | 1198 |
| 250 | Ga0307410_10020109 | 3300031852 | Bacteria | 4077 |
| 251 | Ga0307410_10047437 | 3300031852 | Bacteria | 2871 |
| 252 | Ga0307406_11305764 | 3300031901 | Bacteria | 633 |
| 253 | Ga0307407_10114010 | 3300031903 | Bacteria | 1702 |
| 254 | Ga0307412_10018931 | 3300031911 | Bacteria | 4157 |
| 255 | Ga0307412_10097900 | 3300031911 | Bacteria | 2068 |
| 256 | Ga0307412_10249305 | 3300031911 | Unclassified | 1378 |
| 257 | Ga0307412_10379663 | 3300031911 | Bacteria | 1144 |
| 258 | Ga0307409_100125475 | 3300031995 | Bacteria | 2182 |
| 259 | Ga0307416_100027099 | 3300032002 | Bacteria | 4237 |
| 260 | Ga0307411_10059233 | 3300032005 | Bacteria | 2538 |
| 261 | Ga0307411_10309116 | 3300032005 | Unclassified | 1271 |
| 262 | Ga0307415_100007834 | 3300032126 | Bacteria | 5872 |
| 263 | Ga0307415_100085204 | 3300032126 | Bacteria | 2270 |
| 264 | Ga0307415_100094343 | 3300032126 | Unclassified | 2175 |
| 265 | Ga0307415_100483221 | 3300032126 | Bacteria | 1079 |
| 266 | Ga0307415_101101224 | 3300032126 | Bacteria | 744 |
| 267 | Ga0373926_0060162 | 3300035083 | Unclassified | 1383 |
| 268 | Ga0373926_0117866 | 3300035083 | Bacteria | 1000 |
| 269 | Ga0373934_0028194 | 3300035086 | Unclassified | 2186 |
| 270 | Ga0373951_0051492 | 3300035091 | Bacteria | 1014 |
| 271 | Ga0373923_0162258 | 3300035111 | Unclassified | 1020 |
| 272 | Ga0373932_0163031 | 3300035112 | Bacteria | 772 |
| 273 | Ga0373936_0205068 | 3300035113 | Bacteria | 871 |
| 274 | Ga0373953_0011146 | 3300035117 | Unclassified | 3147 |
| 275 | Ga0373954_0088481 | 3300035118 | Bacteria | 1485 |
| 276 | Ga0373954_0211444 | 3300035118 | Unclassified | 953 |
| 277 | Ga0373956_0081917 | 3300035119 | Unclassified | 1481 |
| 278 | Ga0373956_0374700 | 3300035119 | Unclassified | 679 |
| 279 | Ga0373956_0387921 | 3300035119 | Unclassified | 666 |
| 280 | Ga0373957_0048067 | 3300035120 | Unclassified | 1625 |
| 281 | Ga0373957_0086980 | 3300035120 | Bacteria | 1238 |
| 282 | Ga0373943_0024273 | 3300035170 | Bacteria | 2826 |
| 283 | Ga0373943_0131977 | 3300035170 | Unclassified | 1337 |
| 284 | Ga0373946_0154460 | 3300035171 | Unclassified | 1073 |
| 285 | Ga0373955_0016600 | 3300035172 | Unclassified | 3628 |
| 286 | Ga0373955_0042663 | 3300035172 | Bacteria | 2437 |
| 287 | Ga0373955_0505699 | 3300035172 | Unclassified | 738 |
| 288 | Ga0373955_0545325 | 3300035172 | Unclassified | 709 |
| 289 | Ga0373924_0071745 | 3300035410 | Unclassified | 1462 |
| 290 | Ga0373924_0202110 | 3300035410 | Bacteria | 877 |
| 291 | Ga0373924_0290559 | 3300035410 | Unclassified | 725 |
| 292 | Ga0373931_0574100 | 3300035691 | Bacteria | 735 |
| 293 | Ga0373931_1075809 | 3300035691 | Bacteria | 547 |
| 294 | Ga0373935_0019625 | 3300035692 | Unclassified | 4122 |
| 295 | Ga0373935_0289916 | 3300035692 | Bacteria | 1154 |
| 296 | Ga0373927_0027429 | 3300035695 | Unclassified | 3718 |
| 297 | Ga0373927_0071281 | 3300035695 | Bacteria | 2249 |
| 298 | Ga0373927_0202184 | 3300035695 | Unclassified | 1304 |
| 299 | Ga0373933_0053620 | 3300035724 | Unclassified | 2415 |
| 300 | Ga0373933_0153332 | 3300035724 | Bacteria | 1460 |
| 301 | Ga0373947_0073202 | 3300035725 | Archaea | 2105 |
| 302 | Ga0373947_0256740 | 3300035725 | Unclassified | 1157 |
| 303 | Ga0373937_0003750 | 3300036401 | Bacteria | 12844 |
| 304 | Ga0373937_0055140 | 3300036401 | Unclassified | 3648 |
| 305 | Ga0373937_0154546 | 3300036401 | Bacteria | 2150 |
| 306 | Ga0373937_1461325 | 3300036401 | Unclassified | 631 |
| 307 | Ga0373937_2079691 | 3300036401 | Unclassified | 514 |
| 308 | Ga0316584_0045002 | 3300036712 | Bacteria | 3293 |
| 309 | Ga0373925_0004615 | 3300037068 | Bacteria | 10399 |
| 310 | Ga0373925_0134977 | 3300037068 | Bacteria | 1927 |
| 311 | Ga0395900_0039603 | 3300037418 | Bacteria | 4856 |
| 312 | Ga0395905_0174044 | 3300037471 | Bacteria | 2021 |
| 313 | Ga0436364_0380945 | 3300037853 | Bacteria | 1687 |
| 314 | Ga0436364_0864787 | 3300037853 | Bacteria | 12689 |
| 315 | Ga0436365_0389660 | 3300039437 | Bacteria | 11420 |
| 316 | Ga0439453_0028445 | 3300041408 | Bacteria | 1046 |
| 317 | Ga0439453_0181606 | 3300041408 | Bacteria | 514 |
| 318 | Ga0439461_0198115 | 3300041410 | Unclassified | 539 |
| 319 | Ga0451807_0764093 | 3300041486 | Unclassified | 743 |
| 320 | Ga0439431_0165447 | 3300041997 | Unclassified | 633 |
| 321 | Ga0439443_033627 | 3300042003 | Unclassified | 854 |
| 322 | Ga0439448_0138422 | 3300042005 | Unclassified | 842 |
| 323 | Ga0439456_079924 | 3300042013 | Unclassified | 729 |
| 324 | Ga0450919_015336 | 3300042121 | Unclassified | 865 |
| 325 | Ga0450898_012561 | 3300042134 | Unclassified | 1401 |
| 326 | Ga0439435_0012197 | 3300042436 | Bacteria | 2076 |
| 327 | Ga0439435_0127013 | 3300042436 | Unclassified | 803 |
| 328 | Ga0439435_0311994 | 3300042436 | Bacteria | 540 |
| 329 | Ga0450893_0039032 | 3300042532 | Unclassified | 866 |
| 330 | Ga0466957_0845639 | 3300044842 | Bacteria | 652 |
| 331 | Ga0451576_0050509 | 3300045051 | Bacteria | 4361 |
| 332 | Ga0451576_0755784 | 3300045051 | Bacteria | 1021 |
| 333 | Ga0495592_0033456 | 3300046454 | Unclassified | 3877 |
| 334 | Ga0495592_0346357 | 3300046454 | Bacteria | 954 |
| 335 | Ga0495592_0624555 | 3300046454 | Bacteria | 655 |
| 336 | Ga0495629_0010526 | 3300046459 | Bacteria | 6729 |
| 337 | Ga0495629_0014541 | 3300046459 | Bacteria | 5664 |
| 338 | Ga0495629_0183892 | 3300046459 | Unclassified | 1448 |
| 339 | Ga0495651_0073785 | 3300046462 | Unclassified | 2589 |
| 340 | Ga0495651_0097434 | 3300046462 | Bacteria | 2196 |
| 341 | Ga0495651_0118725 | 3300046462 | Bacteria | 1946 |
| 342 | Ga0495653_0175997 | 3300046463 | Unclassified | 1472 |
| 343 | Ga0495580_0015956 | 3300046472 | Bacteria | 5652 |
| 344 | Ga0495580_0067785 | 3300046472 | Unclassified | 2496 |
| 345 | Ga0495580_0142069 | 3300046472 | Unclassified | 1664 |
| 346 | Ga0495582_0006192 | 3300046473 | Bacteria | 6661 |
| 347 | Ga0495582_0132629 | 3300046473 | Bacteria | 1408 |
| 348 | Ga0495639_0009872 | 3300046475 | Bacteria | 4099 |
| 349 | Ga0495639_0325507 | 3300046475 | Unclassified | 769 |
| 350 | Ga0495664_0548819 | 3300046477 | Unclassified | 689 |
| 351 | Ga0495594_0084182 | 3300046499 | Bacteria | 1778 |
| 352 | Ga0495608_0137543 | 3300046511 | Unclassified | 1560 |
| 353 | Ga0495608_0388413 | 3300046511 | Bacteria | 855 |
| 354 | Ga0495618_0503076 | 3300046514 | Unclassified | 730 |
| 355 | Ga0495620_0354705 | 3300046515 | Unclassified | 556 |
| 356 | Ga0495628_0065300 | 3300046516 | Unclassified | 2847 |
| 357 | Ga0495628_0259282 | 3300046516 | Unclassified | 1296 |
| 358 | Ga0495630_0012952 | 3300046517 | Bacteria | 6058 |
| 359 | Ga0495630_0247338 | 3300046517 | Unclassified | 1362 |
| 360 | Ga0495630_0266931 | 3300046517 | Bacteria | 1307 |
| 361 | Ga0495630_0686239 | 3300046517 | Unclassified | 784 |
| 362 | Ga0495644_0442140 | 3300046523 | Unclassified | 517 |
| 363 | Ga0495652_0054080 | 3300046529 | Bacteria | 3420 |
| 364 | Ga0495652_0231509 | 3300046529 | Bacteria | 1381 |
| 365 | Ga0495665_0054809 | 3300046531 | Unclassified | 2106 |
| 366 | Ga0495665_0221230 | 3300046531 | Bacteria | 979 |
| 367 | Ga0495586_0202875 | 3300046535 | Unclassified | 1124 |
| 368 | Ga0495586_0322415 | 3300046535 | Unclassified | 886 |
| 369 | Ga0495587_0023721 | 3300046536 | Bacteria | 3769 |
| 370 | Ga0495587_0033301 | 3300046536 | Unclassified | 3111 |
| 371 | Ga0495598_0111578 | 3300046537 | Bacteria | 917 |
| 372 | Ga0495621_0014471 | 3300046539 | Bacteria | 2497 |
| 373 | Ga0495645_0041681 | 3300046543 | Unclassified | 3348 |
| 374 | Ga0495622_0473737 | 3300046557 | Unclassified | 536 |
| 375 | Ga0495667_0043306 | 3300046559 | Unclassified | 2983 |
| 376 | Ga0495667_0082522 | 3300046559 | Bacteria | 2088 |
| 377 | Ga0495667_0156825 | 3300046559 | Bacteria | 1465 |
| 378 | Ga0495635_0007021 | 3300046663 | Bacteria | 7868 |
| 379 | Ga0495635_0167840 | 3300046663 | Unclassified | 1493 |
| 380 | Ga0495635_0358076 | 3300046663 | Unclassified | 973 |
| 381 | Ga0495635_0466969 | 3300046663 | Unclassified | 833 |
| 382 | Ga0495635_0675453 | 3300046663 | Unclassified | 671 |
| 383 | Ga0495635_1092610 | 3300046663 | Bacteria | 505 |
| 384 | Ga0495588_0002561 | 3300046674 | Bacteria | 7771 |
| 385 | Ga0495588_0052421 | 3300046674 | Bacteria | 2103 |
| 386 | Ga0495657_0058919 | 3300046675 | Bacteria | 2548 |
| 387 | Ga0495599_0034424 | 3300046678 | Unclassified | 3182 |
| 388 | Ga0495599_0054700 | 3300046678 | Bacteria | 2500 |
| 389 | Ga0495623_0012316 | 3300046679 | Bacteria | 5536 |
| 390 | Ga0495623_0258481 | 3300046679 | Unclassified | 976 |
| 391 | Ga0495623_0730858 | 3300046679 | Bacteria | 505 |
| 392 | Ga0495646_0075225 | 3300046680 | Bacteria | 1980 |
| 393 | Ga0495658_0001372 | 3300046683 | Bacteria | 12767 |
| 394 | Ga0495658_0009502 | 3300046683 | Bacteria | 4850 |
| 395 | Ga0495613_0011253 | 3300046689 | Bacteria | 6648 |
| 396 | Ga0495613_0281710 | 3300046689 | Bacteria | 1154 |
| 397 | Ga0495613_0625876 | 3300046689 | Bacteria | 714 |
| 398 | Ga0495600_0022969 | 3300046809 | Unclassified | 4010 |
| 399 | Ga0495600_0130752 | 3300046809 | Bacteria | 1632 |
| 400 | Ga0495600_0513807 | 3300046809 | Unclassified | 735 |
| 401 | Ga0495581_0009525 | 3300047315 | Bacteria | 5621 |
| 402 | Ga0495604_0008532 | 3300047317 | Bacteria | 8091 |
| 403 | Ga0495674_0070612 | 3300047319 | Unclassified | 3017 |
| 404 | Ga0495674_0207255 | 3300047319 | Bacteria | 1625 |
| 405 | Ga0495675_0007268 | 3300047444 | Bacteria | 6824 |
| 406 | Ga0495675_0144996 | 3300047444 | Bacteria | 1470 |
| 407 | Ga0495684_0009853 | 3300047471 | Bacteria | 7374 |
| 408 | Ga0495684_0050200 | 3300047471 | Unclassified | 3186 |
| 409 | Ga0495684_0297734 | 3300047471 | Bacteria | 1159 |
| 410 | Ga0495684_0381205 | 3300047471 | Bacteria | 994 |
| 411 | Ga0495684_0714001 | 3300047471 | Unclassified | 663 |
| 412 | Ga0495593_0000060 | 3300047673 | Bacteria | 45391 |
| 413 | Ga0495593_0059614 | 3300047673 | Bacteria | 2000 |
| 414 | Ga0495602_0711334 | 3300048088 | Unclassified | 681 |
| 415 | Ga0495614_0441410 | 3300048089 | Unclassified | 615 |
| 416 | Ga0496101_0100496 | 3300048904 | Bacteria | 2164 |
| 417 | Ga0496104_0633502 | 3300048907 | Bacteria | 978 |
| 418 | Ga0496106_0388699 | 3300048909 | Bacteria | 1121 |
| 419 | Ga0496107_0105777 | 3300048910 | Bacteria | 2066 |
| 420 | Ga0496114_0109722 | 3300048917 | Bacteria | 2363 |
| 421 | Ga0496115_0003763 | 3300048918 | Bacteria | 10902 |
| 422 | Ga0501300_088233 | 3300049523 | Unclassified | 517 |
| 423 | Ga0501032_0014708 | 3300049569 | Bacteria | 5537 |
| 424 | Ga0501032_0123567 | 3300049569 | Unclassified | 1710 |
| 425 | Ga0501033_0225628 | 3300049570 | Unclassified | 1332 |
| 426 | Ga0501034_0018990 | 3300049571 | Bacteria | 7041 |
| 427 | Ga0501034_0046437 | 3300049571 | Bacteria | 4388 |
| 428 | Ga0501034_0442343 | 3300049571 | Unclassified | 1219 |
| 429 | Ga0501034_0657209 | 3300049571 | Bacteria | 949 |
| 430 | Ga0501034_1410936 | 3300049571 | Bacteria | 571 |
| 431 | Ga0501036_0026308 | 3300049572 | Unclassified | 4910 |
| 432 | Ga0501036_0090790 | 3300049572 | Unclassified | 2580 |
| 433 | Ga0501037_0018603 | 3300049573 | Bacteria | 5119 |
| 434 | Ga0501037_0175610 | 3300049573 | Bacteria | 1521 |
| 435 | Ga0501037_0279573 | 3300049573 | Unclassified | 1163 |
| 436 | Ga0501038_0068325 | 3300049574 | Bacteria | 3020 |
| 437 | Ga0501038_0069369 | 3300049574 | Bacteria | 2994 |
| 438 | Ga0501039_0015539 | 3300049575 | Bacteria | 5826 |
| 439 | Ga0501043_0008735 | 3300049579 | Bacteria | 7974 |
| 440 | Ga0501043_0032762 | 3300049579 | Bacteria | 4086 |
| 441 | Ga0501043_0073963 | 3300049579 | Unclassified | 2676 |
| 442 | Ga0501046_0060607 | 3300049580 | Unclassified | 2960 |
| 443 | Ga0501046_0080200 | 3300049580 | Bacteria | 2522 |
| 444 | Ga0501046_0129772 | 3300049580 | Bacteria | 1912 |
| 445 | Ga0501047_0000816 | 3300049581 | Bacteria | 32399 |
| 446 | Ga0501047_0063049 | 3300049581 | Unclassified | 3575 |
| 447 | Ga0501047_0084766 | 3300049581 | Bacteria | 3045 |
| 448 | Ga0501047_0150617 | 3300049581 | Unclassified | 2202 |
| 449 | Ga0501048_0578298 | 3300049582 | Unclassified | 806 |
| 450 | Ga0501067_0130560 | 3300049583 | Unclassified | 1398 |
| 451 | Ga0501068_0048079 | 3300049584 | Bacteria | 2575 |
| 452 | Ga0501068_0067811 | 3300049584 | Bacteria | 2175 |
| 453 | Ga0501069_0032378 | 3300049585 | Unclassified | 2877 |
| 454 | Ga0501069_0179444 | 3300049585 | Bacteria | 1224 |
| 455 | Ga0501070_0362274 | 3300049586 | Unclassified | 1176 |
| 456 | Ga0501070_0415941 | 3300049586 | Bacteria | 1086 |
| 457 | Ga0501071_0870807 | 3300049587 | Bacteria | 695 |
| 458 | Ga0501072_0020667 | 3300049588 | Bacteria | 5101 |
| 459 | Ga0501072_1065991 | 3300049588 | Unclassified | 629 |
| 460 | Ga0501072_1449725 | 3300049588 | Unclassified | 530 |
| 461 | Ga0501073_0012265 | 3300049589 | Bacteria | 6253 |
| 462 | Ga0501073_0027190 | 3300049589 | Bacteria | 4094 |
| 463 | Ga0501073_0349766 | 3300049589 | Unclassified | 1020 |
| 464 | Ga0501073_0507441 | 3300049589 | Bacteria | 834 |
| 465 | Ga0501074_0521682 | 3300049590 | Bacteria | 841 |
| 466 | Ga0501074_0736735 | 3300049590 | Bacteria | 695 |
| 467 | Ga0501076_0730809 | 3300049592 | Bacteria | 817 |
| 468 | Ga0501077_0029288 | 3300049593 | Bacteria | 3501 |
| 469 | Ga0501077_0445081 | 3300049593 | Bacteria | 829 |
| 470 | Ga0501077_0766394 | 3300049593 | Unclassified | 620 |
| 471 | Ga0501217_049395 | 3300049661 | Unclassified | 1095 |
| 472 | Ga0501233_107889 | 3300049668 | Unclassified | 742 |
| 473 | Ga0501235_073251 | 3300049669 | Unclassified | 812 |
| 474 | Ga0501243_147535 | 3300049675 | Unclassified | 500 |
| 475 | Ga0501079_0041100 | 3300049741 | Bacteria | 3569 |
| 476 | Ga0501079_0204315 | 3300049741 | Unclassified | 1543 |
| 477 | Ga0501079_0957302 | 3300049741 | Bacteria | 674 |
| 478 | Ga0501080_0014268 | 3300049742 | Bacteria | 7317 |
| 479 | Ga0501081_1546564 | 3300049743 | Bacteria | 504 |
| 480 | Ga0501083_0006188 | 3300049744 | Bacteria | 8491 |
| 481 | Ga0501083_0447683 | 3300049744 | Bacteria | 840 |
| 482 | Ga0501083_1075290 | 3300049744 | Unclassified | 524 |
| 483 | Ga0501270_083742 | 3300049767 | Unclassified | 639 |
| 484 | Ga0501272_073941 | 3300049769 | Bacteria | 502 |
| 485 | Ga0501035_0050489 | 3300049822 | Bacteria | 3727 |
| 486 | Ga0501035_0380168 | 3300049822 | Bacteria | 1178 |
| 487 | Ga0501044_0080266 | 3300049823 | Bacteria | 3304 |
| 488 | Ga0501044_0088415 | 3300049823 | Bacteria | 3127 |
| 489 | nmdc:mga05p37_114056_c1 | 3300050507 | Bacteria | 3322 |
| 490 | nmdc:mga05p37_203761_c1 | 3300050507 | Bacteria | 2394 |
| 491 | nmdc:mga05p37_31256_c1 | 3300050507 | Bacteria | 6504 |
| 492 | nmdc:mga09592_1067165_c1 | 3300050508 | Bacteria | 673 |
| 493 | nmdc:mga09592_257056_c1 | 3300050508 | Unclassified | 1514 |
| 494 | nmdc:mga09592_320546_c1 | 3300050508 | Unclassified | 1343 |
| 495 | nmdc:mga09592_592555_c1 | 3300050508 | Bacteria | 950 |
| 496 | nmdc:mga09592_729355_c1 | 3300050508 | Bacteria | 842 |
| 497 | nmdc:mga06r32_1963096_c1 | 3300050510 | Unclassified | 519 |
| 498 | nmdc:mga06r32_220700_c1 | 3300050510 | Unclassified | 1884 |
| 499 | nmdc:mga06r32_229471_c1 | 3300050510 | Bacteria | 1844 |
| 500 | nmdc:mga06r32_853520_c1 | 3300050510 | Bacteria | 869 |
| 501 | nmdc:mga06r32_930564_c1 | 3300050510 | Unclassified | 824 |
| 502 | nmdc:mga06r32_9351_c1 | 3300050510 | Bacteria | 8836 |
| 503 | nmdc:mga08y16_278955_c1 | 3300050511 | Bacteria | 1724 |
| 504 | nmdc:mga08y16_28966_c1 | 3300050511 | Bacteria | 5837 |
| 505 | nmdc:mga08y16_409051_c1 | 3300050511 | Bacteria | 1388 |
| 506 | nmdc:mga08y16_6063_c1 | 3300050511 | Bacteria | 12673 |
| 507 | nmdc:mga0n895_1148354_c1 | 3300050512 | Unclassified | 752 |
| 508 | nmdc:mga0n895_1269426_c1 | 3300050512 | Bacteria | 708 |
| 509 | nmdc:mga0n895_293895_c1 | 3300050512 | Unclassified | 1647 |
| 510 | nmdc:mga0n895_5211_c1 | 3300050512 | Bacteria | 10824 |
| 511 | nmdc:mga0rr50_1108083_c1 | 3300050513 | Bacteria | 673 |
| 512 | nmdc:mga0rr50_409923_c1 | 3300050513 | Unclassified | 1146 |
| 513 | nmdc:mga08x19_184093_c1 | 3300050514 | Unclassified | 1427 |
| 514 | nmdc:mga0a205_49087_c1 | 3300050515 | Bacteria | 4073 |
| 515 | nmdc:mga0a205_97737_c1 | 3300050515 | Unclassified | 2835 |
| 516 | Ga0495601_0093087 | 3300053077 | Bacteria | 1941 |
| 517 | Ga0495612_0012624 | 3300053078 | Unclassified | 3406 |
| 518 | Ga0495595_0029730 | 3300053084 | Unclassified | 2447 |
| 519 | Ga0501084_0001977 | 3300054114 | Bacteria | 16378 |
| 520 | Ga0501084_0077611 | 3300054114 | Bacteria | 2784 |
| 521 | Ga0501084_1045634 | 3300054114 | Unclassified | 686 |
| 522 | Ga0501082_0024532 | 3300060353 | Bacteria | 5198 |
| 523 | Ga0501082_0043249 | 3300060353 | Bacteria | 3884 |
| 524 | Ga0466962_0647883 | 3300061719 | Bacteria | 540 |
| 525 | Ga0530510_0565371 | 3300061734 | Bacteria | 864 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005293 | Ga0065715_10239422 | Ga0065715_102394221 | 103 |
| 2 | 3300005327 | Ga0070658_10079569 | Ga0070658_100795692 | 103 |
| 3 | 3300005327 | Ga0070658_10723431 | Ga0070658_107234312 | 103 |
| 4 | 3300005328 | Ga0070676_10669729 | Ga0070676_106697292 | 103 |
| 5 | 3300005331 | Ga0070670_100615237 | Ga0070670_1006152372 | 103 |
| 6 | 3300005333 | Ga0070677_10155604 | Ga0070677_101556042 | 103 |
| 7 | 3300005334 | Ga0068869_101319739 | Ga0068869_1013197391 | 103 |
| 8 | 3300005334 | Ga0068869_101336998 | Ga0068869_1013369981 | 103 |
| 9 | 3300005336 | Ga0070680_100050521 | Ga0070680_1000505212 | 103 |
| 10 | 3300005336 | Ga0070680_101491244 | Ga0070680_1014912441 | 103 |
| 11 | 3300005341 | Ga0070691_10011449 | Ga0070691_100114492 | 103 |
| 12 | 3300005343 | Ga0070687_100620795 | Ga0070687_1006207952 | 103 |
| 13 | 3300005343 | Ga0070687_100680508 | Ga0070687_1006805081 | 103 |
| 14 | 3300005347 | Ga0070668_100714195 | Ga0070668_1007141952 | 103 |
| 15 | 3300005347 | Ga0070668_101176908 | Ga0070668_1011769082 | 103 |
| 16 | 3300005353 | Ga0070669_100006088 | Ga0070669_1000060883 | 103 |
| 17 | 3300005353 | Ga0070669_100048016 | Ga0070669_1000480162 | 103 |
| 18 | 3300005353 | Ga0070669_100170913 | Ga0070669_1001709132 | 103 |
| 19 | 3300005354 | Ga0070675_100644481 | Ga0070675_1006444811 | 103 |
| 20 | 3300005354 | Ga0070675_100677754 | Ga0070675_1006777542 | 103 |
| 21 | 3300005356 | Ga0070674_100797691 | Ga0070674_1007976912 | 103 |
| 22 | 3300005364 | Ga0070673_100121798 | Ga0070673_1001217982 | 103 |
| 23 | 3300005365 | Ga0070688_100146186 | Ga0070688_1001461862 | 103 |
| 24 | 3300005434 | Ga0070709_10038976 | Ga0070709_100389763 | 103 |
| 25 | 3300005434 | Ga0070709_10132087 | Ga0070709_101320872 | 103 |
| 26 | 3300005434 | Ga0070709_10242739 | Ga0070709_102427392 | 103 |
| 27 | 3300005434 | Ga0070709_10597096 | Ga0070709_105970962 | 103 |
| 28 | 3300005435 | Ga0070714_100195359 | Ga0070714_1001953592 | 103 |
| 29 | 3300005436 | Ga0070713_100048884 | Ga0070713_1000488842 | 103 |
| 30 | 3300005436 | Ga0070713_100768194 | Ga0070713_1007681941 | 103 |
| 31 | 3300005437 | Ga0070710_10011232 | Ga0070710_100112321 | 103 |
| 32 | 3300005438 | Ga0070701_11238948 | Ga0070701_112389481 | 103 |
| 33 | 3300005439 | Ga0070711_100043659 | Ga0070711_1000436592 | 103 |
| 34 | 3300005439 | Ga0070711_100184597 | Ga0070711_1001845972 | 103 |
| 35 | 3300005441 | Ga0070700_100308589 | Ga0070700_1003085892 | 103 |
| 36 | 3300005444 | Ga0070694_100237143 | Ga0070694_1002371432 | 103 |
| 37 | 3300005444 | Ga0070694_101206820 | Ga0070694_1012068202 | 103 |
| 38 | 3300005445 | Ga0070708_100552344 | Ga0070708_1005523442 | 103 |
| 39 | 3300005445 | Ga0070708_101562941 | Ga0070708_1015629411 | 103 |
| 40 | 3300005457 | Ga0070662_100762742 | Ga0070662_1007627422 | 103 |
| 41 | 3300005458 | Ga0070681_10113327 | Ga0070681_101133272 | 103 |
| 42 | 3300005458 | Ga0070681_10155300 | Ga0070681_101553002 | 103 |
| 43 | 3300005458 | Ga0070681_10157874 | Ga0070681_101578742 | 103 |
| 44 | 3300005458 | Ga0070681_10316334 | Ga0070681_103163342 | 103 |
| 45 | 3300005459 | Ga0068867_100101346 | Ga0068867_1001013464 | 103 |
| 46 | 3300005467 | Ga0070706_100452480 | Ga0070706_1004524801 | 103 |
| 47 | 3300005468 | Ga0070707_101837658 | Ga0070707_1018376581 | 103 |
| 48 | 3300005468 | Ga0070707_102286392 | Ga0070707_1022863922 | 103 |
| 49 | 3300005471 | Ga0070698_100130073 | Ga0070698_1001300732 | 103 |
| 50 | 3300005471 | Ga0070698_100341027 | Ga0070698_1003410272 | 103 |
| 51 | 3300005518 | Ga0070699_100601749 | Ga0070699_1006017492 | 103 |
| 52 | 3300005530 | Ga0070679_100039986 | Ga0070679_1000399862 | 103 |
| 53 | 3300005530 | Ga0070679_100126247 | Ga0070679_1001262472 | 103 |
| 54 | 3300005530 | Ga0070679_101357104 | Ga0070679_1013571041 | 103 |
| 55 | 3300005535 | Ga0070684_100025126 | Ga0070684_1000251262 | 103 |
| 56 | 3300005535 | Ga0070684_100351305 | Ga0070684_1003513052 | 103 |
| 57 | 3300005535 | Ga0070684_100351797 | Ga0070684_1003517972 | 103 |
| 58 | 3300005536 | Ga0070697_100566293 | Ga0070697_1005662932 | 103 |
| 59 | 3300005539 | Ga0068853_100563314 | Ga0068853_1005633142 | 103 |
| 60 | 3300005543 | Ga0070672_100019796 | Ga0070672_1000197962 | 103 |
| 61 | 3300005548 | Ga0070665_100432484 | Ga0070665_1004324842 | 103 |
| 62 | 3300005549 | Ga0070704_100070324 | Ga0070704_1000703242 | 103 |
| 63 | 3300005549 | Ga0070704_101767485 | Ga0070704_1017674852 | 103 |
| 64 | 3300005564 | Ga0070664_100414574 | Ga0070664_1004145742 | 103 |
| 65 | 3300005577 | Ga0068857_100199740 | Ga0068857_1001997402 | 103 |
| 66 | 3300005616 | Ga0068852_100212429 | Ga0068852_1002124292 | 103 |
| 67 | 3300005617 | Ga0068859_100158376 | Ga0068859_1001583763 | 103 |
| 68 | 3300005617 | Ga0068859_100523459 | Ga0068859_1005234591 | 103 |
| 69 | 3300005618 | Ga0068864_101792664 | Ga0068864_1017926642 | 103 |
| 70 | 3300005719 | Ga0068861_100051345 | Ga0068861_1000513452 | 103 |
| 71 | 3300005719 | Ga0068861_101268819 | Ga0068861_1012688191 | 103 |
| 72 | 3300005719 | Ga0068861_101660738 | Ga0068861_1016607382 | 103 |
| 73 | 3300005840 | Ga0068870_10055211 | Ga0068870_100552112 | 103 |
| 74 | 3300005841 | Ga0068863_101874959 | Ga0068863_1018749591 | 103 |
| 75 | 3300005843 | Ga0068860_102173632 | Ga0068860_1021736322 | 103 |
| 76 | 3300005844 | Ga0068862_100018966 | Ga0068862_1000189661 | 103 |
| 77 | 3300005844 | Ga0068862_100048668 | Ga0068862_1000486682 | 103 |
| 78 | 3300005844 | Ga0068862_100762296 | Ga0068862_1007622961 | 103 |
| 79 | 3300005844 | Ga0068862_101014616 | Ga0068862_1010146162 | 103 |
| 80 | 3300005844 | Ga0068862_102205464 | Ga0068862_1022054641 | 103 |
| 81 | 3300006028 | Ga0070717_10061975 | Ga0070717_100619752 | 103 |
| 82 | 3300006028 | Ga0070717_10293449 | Ga0070717_102934492 | 103 |
| 83 | 3300006058 | Ga0075432_10491786 | Ga0075432_104917862 | 103 |
| 84 | 3300006175 | Ga0070712_100148559 | Ga0070712_1001485592 | 103 |
| 85 | 3300006175 | Ga0070712_100558606 | Ga0070712_1005586062 | 103 |
| 86 | 3300006844 | Ga0075428_100008863 | Ga0075428_1000088633 | 103 |
| 87 | 3300006844 | Ga0075428_100068705 | Ga0075428_1000687052 | 103 |
| 88 | 3300006844 | Ga0075428_100152759 | Ga0075428_1001527592 | 103 |
| 89 | 3300006844 | Ga0075428_100910165 | Ga0075428_1009101652 | 103 |
| 90 | 3300006846 | Ga0075430_100205677 | Ga0075430_1002056772 | 103 |
| 91 | 3300006847 | Ga0075431_100008852 | Ga0075431_1000088529 | 103 |
| 92 | 3300006847 | Ga0075431_100167563 | Ga0075431_1001675632 | 103 |
| 93 | 3300006847 | Ga0075431_100204858 | Ga0075431_1002048583 | 103 |
| 94 | 3300006847 | Ga0075431_100363338 | Ga0075431_1003633382 | 103 |
| 95 | 3300006852 | Ga0075433_10128812 | Ga0075433_101288121 | 103 |
| 96 | 3300006871 | Ga0075434_100018262 | Ga0075434_1000182624 | 103 |
| 97 | 3300006871 | Ga0075434_100288152 | Ga0075434_1002881522 | 103 |
| 98 | 3300006871 | Ga0075434_100453160 | Ga0075434_1004531602 | 103 |
| 99 | 3300006871 | Ga0075434_101431880 | Ga0075434_1014318802 | 103 |
| 100 | 3300006871 | Ga0075434_101465174 | Ga0075434_1014651742 | 103 |
| 101 | 3300006880 | Ga0075429_100061451 | Ga0075429_1000614512 | 103 |
| 102 | 3300006880 | Ga0075429_100082402 | Ga0075429_1000824022 | 103 |
| 103 | 3300006880 | Ga0075429_100350905 | Ga0075429_1003509052 | 103 |
| 104 | 3300006880 | Ga0075429_100617352 | Ga0075429_1006173522 | 103 |
| 105 | 3300006881 | Ga0068865_100077994 | Ga0068865_1000779942 | 103 |
| 106 | 3300006914 | Ga0075436_100079393 | Ga0075436_1000793932 | 103 |
| 107 | 3300006931 | Ga0097620_100158368 | Ga0097620_1001583683 | 103 |
| 108 | 3300006931 | Ga0097620_100523440 | Ga0097620_1005234401 | 103 |
| 109 | 3300007076 | Ga0075435_100029236 | Ga0075435_1000292362 | 103 |
| 110 | 3300007076 | Ga0075435_100284441 | Ga0075435_1002844411 | 103 |
| 111 | 3300009094 | Ga0111539_10005356 | Ga0111539_100053563 | 103 |
| 112 | 3300009094 | Ga0111539_10008461 | Ga0111539_100084619 | 103 |
| 113 | 3300009094 | Ga0111539_10048429 | Ga0111539_100484294 | 103 |
| 114 | 3300009094 | Ga0111539_10071240 | Ga0111539_100712402 | 103 |
| 115 | 3300009094 | Ga0111539_10201886 | Ga0111539_102018862 | 103 |
| 116 | 3300009098 | Ga0105245_10857998 | Ga0105245_108579982 | 103 |
| 117 | 3300009147 | Ga0114129_10008837 | Ga0114129_100088373 | 103 |
| 118 | 3300009147 | Ga0114129_10024621 | Ga0114129_100246218 | 103 |
| 119 | 3300009147 | Ga0114129_10443507 | Ga0114129_104435072 | 103 |
| 120 | 3300009147 | Ga0114129_11073951 | Ga0114129_110739512 | 103 |
| 121 | 3300009148 | Ga0105243_10074625 | Ga0105243_100746252 | 103 |
| 122 | 3300009174 | Ga0105241_10581627 | Ga0105241_105816271 | 103 |
| 123 | 3300009174 | Ga0105241_11084309 | Ga0105241_110843092 | 103 |
| 124 | 3300009177 | Ga0105248_10136698 | Ga0105248_101366981 | 103 |
| 125 | 3300009545 | Ga0105237_10457816 | Ga0105237_104578162 | 103 |
| 126 | 3300009551 | Ga0105238_10021908 | Ga0105238_100219084 | 103 |
| 127 | 3300009551 | Ga0105238_10087199 | Ga0105238_100871992 | 103 |
| 128 | 3300009553 | Ga0105249_10004049 | Ga0105249_100040495 | 103 |
| 129 | 3300009553 | Ga0105249_10011352 | Ga0105249_100113526 | 103 |
| 130 | 3300009553 | Ga0105249_10290252 | Ga0105249_102902522 | 103 |
| 131 | 3300009553 | Ga0105249_11743076 | Ga0105249_117430762 | 103 |
| 132 | 3300010375 | Ga0105239_10704586 | Ga0105239_107045862 | 103 |
| 133 | 3300011119 | Ga0105246_11138110 | Ga0105246_111381102 | 103 |
| 134 | 3300013102 | Ga0157371_10136263 | Ga0157371_101362632 | 103 |
| 135 | 3300013306 | Ga0163162_11369630 | Ga0163162_113696302 | 103 |
| 136 | 3300013306 | Ga0163162_12437799 | Ga0163162_124377992 | 103 |
| 137 | 3300013307 | Ga0157372_10010954 | Ga0157372_1001095413 | 103 |
| 138 | 3300013307 | Ga0157372_10019552 | Ga0157372_100195527 | 103 |
| 139 | 3300013307 | Ga0157372_10660699 | Ga0157372_106606991 | 103 |
| 140 | 3300013308 | Ga0157375_10857126 | Ga0157375_108571261 | 103 |
| 141 | 3300014325 | Ga0163163_10000030 | Ga0163163_1000003042 | 103 |
| 142 | 3300014326 | Ga0157380_10078714 | Ga0157380_100787143 | 103 |
| 143 | 3300014326 | Ga0157380_10198793 | Ga0157380_101987933 | 103 |
| 144 | 3300014326 | Ga0157380_10769619 | Ga0157380_107696191 | 103 |
| 145 | 3300014745 | Ga0157377_10114049 | Ga0157377_101140492 | 103 |
| 146 | 3300014745 | Ga0157377_10297540 | Ga0157377_102975402 | 103 |
| 147 | 3300014745 | Ga0157377_10912321 | Ga0157377_109123211 | 103 |
| 148 | 3300014969 | Ga0157376_10185656 | Ga0157376_101856562 | 103 |
| 149 | 3300015262 | Ga0182007_10046524 | Ga0182007_100465241 | 103 |
| 150 | 3300017792 | Ga0163161_11555516 | Ga0163161_115555162 | 103 |
| 151 | 3300021388 | Ga0213875_10003304 | Ga0213875_100033048 | 103 |
| 152 | 3300025315 | Ga0207697_10246358 | Ga0207697_102463582 | 103 |
| 153 | 3300025893 | Ga0207682_10039988 | Ga0207682_100399882 | 103 |
| 154 | 3300025898 | Ga0207692_10009464 | Ga0207692_100094641 | 103 |
| 155 | 3300025901 | Ga0207688_10084929 | Ga0207688_100849291 | 103 |
| 156 | 3300025906 | Ga0207699_10157079 | Ga0207699_101570792 | 103 |
| 157 | 3300025906 | Ga0207699_10220540 | Ga0207699_102205402 | 103 |
| 158 | 3300025906 | Ga0207699_10313497 | Ga0207699_103134972 | 103 |
| 159 | 3300025907 | Ga0207645_10812404 | Ga0207645_108124041 | 103 |
| 160 | 3300025908 | Ga0207643_10094344 | Ga0207643_100943441 | 103 |
| 161 | 3300025909 | Ga0207705_10159411 | Ga0207705_101594112 | 103 |
| 162 | 3300025910 | Ga0207684_10264439 | Ga0207684_102644392 | 103 |
| 163 | 3300025911 | Ga0207654_10359335 | Ga0207654_103593352 | 103 |
| 164 | 3300025912 | Ga0207707_10026191 | Ga0207707_100261912 | 103 |
| 165 | 3300025912 | Ga0207707_10153771 | Ga0207707_101537712 | 103 |
| 166 | 3300025914 | Ga0207671_10966235 | Ga0207671_109662352 | 103 |
| 167 | 3300025915 | Ga0207693_10017898 | Ga0207693_100178982 | 103 |
| 168 | 3300025915 | Ga0207693_11352947 | Ga0207693_113529471 | 103 |
| 169 | 3300025916 | Ga0207663_10761933 | Ga0207663_107619331 | 103 |
| 170 | 3300025917 | Ga0207660_10064037 | Ga0207660_100640372 | 103 |
| 171 | 3300025917 | Ga0207660_11280192 | Ga0207660_112801921 | 103 |
| 172 | 3300025917 | Ga0207660_11515515 | Ga0207660_115155151 | 103 |
| 173 | 3300025918 | Ga0207662_10007501 | Ga0207662_100075014 | 103 |
| 174 | 3300025919 | Ga0207657_10033664 | Ga0207657_100336642 | 103 |
| 175 | 3300025920 | Ga0207649_10095539 | Ga0207649_100955391 | 103 |
| 176 | 3300025920 | Ga0207649_11095522 | Ga0207649_110955222 | 103 |
| 177 | 3300025921 | Ga0207652_10055707 | Ga0207652_100557072 | 103 |
| 178 | 3300025921 | Ga0207652_10106508 | Ga0207652_101065082 | 103 |
| 179 | 3300025921 | Ga0207652_10128799 | Ga0207652_101287993 | 103 |
| 180 | 3300025921 | Ga0207652_10807689 | Ga0207652_108076891 | 103 |
| 181 | 3300025923 | Ga0207681_10022208 | Ga0207681_100222082 | 103 |
| 182 | 3300025923 | Ga0207681_10069261 | Ga0207681_100692613 | 103 |
| 183 | 3300025923 | Ga0207681_10169484 | Ga0207681_101694842 | 103 |
| 184 | 3300025924 | Ga0207694_10049390 | Ga0207694_100493901 | 103 |
| 185 | 3300025924 | Ga0207694_10096109 | Ga0207694_100961092 | 103 |
| 186 | 3300025925 | Ga0207650_10678260 | Ga0207650_106782602 | 103 |
| 187 | 3300025926 | Ga0207659_10120353 | Ga0207659_101203531 | 103 |
| 188 | 3300025926 | Ga0207659_10626417 | Ga0207659_106264172 | 103 |
| 189 | 3300025926 | Ga0207659_11053770 | Ga0207659_110537701 | 103 |
| 190 | 3300025928 | Ga0207700_10059694 | Ga0207700_100596942 | 103 |
| 191 | 3300025928 | Ga0207700_10088265 | Ga0207700_100882651 | 103 |
| 192 | 3300025928 | Ga0207700_11255752 | Ga0207700_112557522 | 103 |
| 193 | 3300025929 | Ga0207664_11493590 | Ga0207664_114935901 | 103 |
| 194 | 3300025932 | Ga0207690_10145988 | Ga0207690_101459882 | 103 |
| 195 | 3300025933 | Ga0207706_10142698 | Ga0207706_101426982 | 103 |
| 196 | 3300025933 | Ga0207706_11373648 | Ga0207706_113736481 | 103 |
| 197 | 3300025935 | Ga0207709_10232061 | Ga0207709_102320612 | 103 |
| 198 | 3300025938 | Ga0207704_10034903 | Ga0207704_100349032 | 103 |
| 199 | 3300025938 | Ga0207704_10232287 | Ga0207704_102322871 | 103 |
| 200 | 3300025940 | Ga0207691_10256275 | Ga0207691_102562752 | 103 |
| 201 | 3300025942 | Ga0207689_11703778 | Ga0207689_117037781 | 103 |
| 202 | 3300025944 | Ga0207661_10128959 | Ga0207661_101289592 | 103 |
| 203 | 3300025945 | Ga0207679_10154510 | Ga0207679_101545102 | 103 |
| 204 | 3300025960 | Ga0207651_10015089 | Ga0207651_100150892 | 103 |
| 205 | 3300025961 | Ga0207712_10010343 | Ga0207712_100103434 | 103 |
| 206 | 3300025961 | Ga0207712_10014842 | Ga0207712_100148421 | 103 |
| 207 | 3300025972 | Ga0207668_10143982 | Ga0207668_101439822 | 103 |
| 208 | 3300025972 | Ga0207668_11546550 | Ga0207668_115465501 | 103 |
| 209 | 3300025986 | Ga0207658_11173688 | Ga0207658_111736881 | 103 |
| 210 | 3300026041 | Ga0207639_10517793 | Ga0207639_105177931 | 103 |
| 211 | 3300026041 | Ga0207639_11094827 | Ga0207639_110948272 | 103 |
| 212 | 3300026075 | Ga0207708_10061937 | Ga0207708_100619372 | 103 |
| 213 | 3300026075 | Ga0207708_10577460 | Ga0207708_105774601 | 103 |
| 214 | 3300026088 | Ga0207641_11653961 | Ga0207641_116539612 | 103 |
| 215 | 3300026089 | Ga0207648_10069251 | Ga0207648_100692512 | 103 |
| 216 | 3300026095 | Ga0207676_11460768 | Ga0207676_114607681 | 103 |
| 217 | 3300026116 | Ga0207674_10124874 | Ga0207674_101248742 | 103 |
| 218 | 3300026118 | Ga0207675_100078714 | Ga0207675_1000787142 | 103 |
| 219 | 3300026118 | Ga0207675_100439882 | Ga0207675_1004398822 | 103 |
| 220 | 3300026118 | Ga0207675_100460641 | Ga0207675_1004606412 | 103 |
| 221 | 3300026142 | Ga0207698_10059379 | Ga0207698_100593792 | 103 |
| 222 | 3300027552 | Ga0209982_1037195 | Ga0209982_10371952 | 103 |
| 223 | 3300027907 | Ga0207428_10014862 | Ga0207428_100148622 | 103 |
| 224 | 3300027907 | Ga0207428_10197706 | Ga0207428_101977062 | 103 |
| 225 | 3300028379 | Ga0268266_10615093 | Ga0268266_106150932 | 103 |
| 226 | 3300028380 | Ga0268265_10031042 | Ga0268265_100310422 | 103 |
| 227 | 3300028380 | Ga0268265_10122756 | Ga0268265_101227561 | 103 |
| 228 | 3300028380 | Ga0268265_11126912 | Ga0268265_111269122 | 103 |
| 229 | 3300028380 | Ga0268265_12022158 | Ga0268265_120221582 | 103 |
| 230 | 3300028381 | Ga0268264_12506090 | Ga0268264_125060902 | 103 |
| 231 | 3300031247 | Ga0265340_10263035 | Ga0265340_102630352 | 103 |
| 232 | 3300031548 | Ga0307408_100595784 | Ga0307408_1005957841 | 103 |
| 233 | 3300031548 | Ga0307408_100635733 | Ga0307408_1006357332 | 103 |
| 234 | 3300031548 | Ga0307408_102523782 | Ga0307408_1025237821 | 103 |
| 235 | 3300031727 | Ga0316576_10006305 | Ga0316576_100063055 | 103 |
| 236 | 3300031728 | Ga0316578_10185201 | Ga0316578_101852012 | 103 |
| 237 | 3300031731 | Ga0307405_10044191 | Ga0307405_100441912 | 103 |
| 238 | 3300031731 | Ga0307405_10150268 | Ga0307405_101502682 | 103 |
| 239 | 3300031731 | Ga0307405_12002520 | Ga0307405_120025201 | 103 |
| 240 | 3300031824 | Ga0307413_10013834 | Ga0307413_100138342 | 103 |
| 241 | 3300031824 | Ga0307413_10311791 | Ga0307413_103117912 | 103 |
| 242 | 3300031852 | Ga0307410_10020109 | Ga0307410_100201092 | 103 |
| 243 | 3300031852 | Ga0307410_10047437 | Ga0307410_100474372 | 103 |
| 244 | 3300031901 | Ga0307406_11305764 | Ga0307406_113057641 | 103 |
| 245 | 3300031903 | Ga0307407_10114010 | Ga0307407_101140102 | 103 |
| 246 | 3300031911 | Ga0307412_10018931 | Ga0307412_100189313 | 103 |
| 247 | 3300031911 | Ga0307412_10097900 | Ga0307412_100979002 | 103 |
| 248 | 3300031911 | Ga0307412_10249305 | Ga0307412_102493051 | 103 |
| 249 | 3300031911 | Ga0307412_10379663 | Ga0307412_103796632 | 103 |
| 250 | 3300031995 | Ga0307409_100125475 | Ga0307409_1001254752 | 103 |
| 251 | 3300032002 | Ga0307416_100027099 | Ga0307416_1000270991 | 103 |
| 252 | 3300032005 | Ga0307411_10059233 | Ga0307411_100592333 | 103 |
| 253 | 3300032005 | Ga0307411_10309116 | Ga0307411_103091161 | 103 |
| 254 | 3300032126 | Ga0307415_100007834 | Ga0307415_1000078346 | 103 |
| 255 | 3300032126 | Ga0307415_100085204 | Ga0307415_1000852043 | 103 |
| 256 | 3300032126 | Ga0307415_100094343 | Ga0307415_1000943432 | 103 |
| 257 | 3300032126 | Ga0307415_100483221 | Ga0307415_1004832211 | 103 |
| 258 | 3300032126 | Ga0307415_101101224 | Ga0307415_1011012242 | 103 |
| 259 | 3300035083 | Ga0373926_0060162 | Ga0373926_0060162_545_886 | 103 |
| 260 | 3300035083 | Ga0373926_0117866 | Ga0373926_0117866_457_804 | 103 |
| 261 | 3300035086 | Ga0373934_0028194 | Ga0373934_0028194_1590_1967 | 103 |
| 262 | 3300035091 | Ga0373951_0051492 | Ga0373951_0051492_336_668 | 103 |
| 263 | 3300035111 | Ga0373923_0162258 | Ga0373923_0162258_595_936 | 103 |
| 264 | 3300035112 | Ga0373932_0163031 | Ga0373932_0163031_93_425 | 103 |
| 265 | 3300035113 | Ga0373936_0205068 | Ga0373936_0205068_195_536 | 103 |
| 266 | 3300035117 | Ga0373953_0011146 | Ga0373953_0011146_727_1068 | 103 |
| 267 | 3300035118 | Ga0373954_0088481 | Ga0373954_0088481_687_1055 | 103 |
| 268 | 3300035118 | Ga0373954_0211444 | Ga0373954_0211444_501_842 | 103 |
| 269 | 3300035119 | Ga0373956_0081917 | Ga0373956_0081917_424_810 | 103 |
| 270 | 3300035119 | Ga0373956_0374700 | Ga0373956_0374700_91_459 | 103 |
| 271 | 3300035119 | Ga0373956_0387921 | Ga0373956_0387921_38_415 | 103 |
| 272 | 3300035120 | Ga0373957_0048067 | Ga0373957_0048067_499_840 | 103 |
| 273 | 3300035120 | Ga0373957_0086980 | Ga0373957_0086980_585_962 | 103 |
| 274 | 3300035170 | Ga0373943_0024273 | Ga0373943_0024273_314_661 | 103 |
| 275 | 3300035170 | Ga0373943_0131977 | Ga0373943_0131977_321_662 | 103 |
| 276 | 3300035171 | Ga0373946_0154460 | Ga0373946_0154460_261_608 | 103 |
| 277 | 3300035172 | Ga0373955_0016600 | Ga0373955_0016600_616_957 | 103 |
| 278 | 3300035172 | Ga0373955_0042663 | Ga0373955_0042663_1196_1573 | 103 |
| 279 | 3300035172 | Ga0373955_0505699 | Ga0373955_0505699_310_678 | 103 |
| 280 | 3300035172 | Ga0373955_0545325 | Ga0373955_0545325_286_633 | 103 |
| 281 | 3300035410 | Ga0373924_0071745 | Ga0373924_0071745_709_1095 | 103 |
| 282 | 3300035410 | Ga0373924_0202110 | Ga0373924_0202110_261_629 | 103 |
| 283 | 3300035410 | Ga0373924_0290559 | Ga0373924_0290559_268_645 | 103 |
| 284 | 3300035691 | Ga0373931_0574100 | Ga0373931_0574100_100_432 | 103 |
| 285 | 3300035691 | Ga0373931_1075809 | Ga0373931_1075809_85_414 | 103 |
| 286 | 3300035692 | Ga0373935_0019625 | Ga0373935_0019625_2866_3207 | 103 |
| 287 | 3300035692 | Ga0373935_0289916 | Ga0373935_0289916_501_848 | 103 |
| 288 | 3300035695 | Ga0373927_0027429 | Ga0373927_0027429_2788_3129 | 103 |
| 289 | 3300035695 | Ga0373927_0071281 | Ga0373927_0071281_344_691 | 103 |
| 290 | 3300035695 | Ga0373927_0202184 | Ga0373927_0202184_46_414 | 103 |
| 291 | 3300035724 | Ga0373933_0053620 | Ga0373933_0053620_232_618 | 103 |
| 292 | 3300035724 | Ga0373933_0153332 | Ga0373933_0153332_881_1249 | 103 |
| 293 | 3300035725 | Ga0373947_0073202 | Ga0373947_0073202_248_589 | 103 |
| 294 | 3300035725 | Ga0373947_0256740 | Ga0373947_0256740_50_418 | 103 |
| 295 | 3300036401 | Ga0373937_0003750 | Ga0373937_0003750_1495_1872 | 103 |
| 296 | 3300036401 | Ga0373937_0055140 | Ga0373937_0055140_1072_1458 | 103 |
| 297 | 3300036401 | Ga0373937_0154546 | Ga0373937_0154546_622_990 | 103 |
| 298 | 3300036401 | Ga0373937_1461325 | Ga0373937_1461325_148_495 | 103 |
| 299 | 3300036401 | Ga0373937_2079691 | Ga0373937_2079691_61_399 | 103 |
| 300 | 3300036712 | Ga0316584_0045002 | Ga0316584_0045002_1535_1876 | 103 |
| 301 | 3300037068 | Ga0373925_0004615 | Ga0373925_0004615_8161_8502 | 103 |
| 302 | 3300037068 | Ga0373925_0134977 | Ga0373925_0134977_456_803 | 103 |
| 303 | 3300037418 | Ga0395900_0039603 | Ga0395900_0039603_1968_2327 | 103 |
| 304 | 3300037471 | Ga0395905_0174044 | Ga0395905_0174044_72_416 | 103 |
| 305 | 3300037853 | Ga0436364_0380945 | Ga0436364_0380945_617_949 | 103 |
| 306 | 3300037853 | Ga0436364_0864787 | Ga0436364_0864787_5876_6205 | 103 |
| 307 | 3300039437 | Ga0436365_0389660 | Ga0436365_0389660_5655_5999 | 103 |
| 308 | 3300041408 | Ga0439453_0028445 | Ga0439453_0028445_690_1028 | 103 |
| 309 | 3300041408 | Ga0439453_0181606 | Ga0439453_0181606_124_453 | 103 |
| 310 | 3300041410 | Ga0439461_0198115 | Ga0439461_0198115_44_373 | 103 |
| 311 | 3300041486 | Ga0451807_0764093 | Ga0451807_0764093_140_475 | 103 |
| 312 | 3300041997 | Ga0439431_0165447 | Ga0439431_0165447_157_486 | 103 |
| 313 | 3300042003 | Ga0439443_033627 | Ga0439443_033627_174_503 | 103 |
| 314 | 3300042005 | Ga0439448_0138422 | Ga0439448_0138422_474_806 | 103 |
| 315 | 3300042013 | Ga0439456_079924 | Ga0439456_079924_54_392 | 103 |
| 316 | 3300042121 | Ga0450919_015336 | Ga0450919_015336_525_854 | 103 |
| 317 | 3300042134 | Ga0450898_012561 | Ga0450898_012561_959_1312 | 103 |
| 318 | 3300042436 | Ga0439435_0012197 | Ga0439435_0012197_839_1177 | 103 |
| 319 | 3300042436 | Ga0439435_0127013 | Ga0439435_0127013_134_463 | 103 |
| 320 | 3300042436 | Ga0439435_0311994 | Ga0439435_0311994_172_501 | 103 |
| 321 | 3300042532 | Ga0450893_0039032 | Ga0450893_0039032_492_821 | 103 |
| 322 | 3300044842 | Ga0466957_0845639 | Ga0466957_0845639_63_404 | 103 |
| 323 | 3300045051 | Ga0451576_0050509 | Ga0451576_0050509_3997_4326 | 103 |
| 324 | 3300045051 | Ga0451576_0755784 | Ga0451576_0755784_286_639 | 103 |
| 325 | 3300046454 | Ga0495592_0033456 | Ga0495592_0033456_2610_2951 | 103 |
| 326 | 3300046454 | Ga0495592_0346357 | Ga0495592_0346357_556_933 | 103 |
| 327 | 3300046454 | Ga0495592_0624555 | Ga0495592_0624555_179_514 | 103 |
| 328 | 3300046459 | Ga0495629_0010526 | Ga0495629_0010526_2186_2527 | 103 |
| 329 | 3300046459 | Ga0495629_0014541 | Ga0495629_0014541_5026_5373 | 103 |
| 330 | 3300046459 | Ga0495629_0183892 | Ga0495629_0183892_514_900 | 103 |
| 331 | 3300046462 | Ga0495651_0073785 | Ga0495651_0073785_1898_2239 | 103 |
| 332 | 3300046462 | Ga0495651_0097434 | Ga0495651_0097434_1003_1380 | 103 |
| 333 | 3300046462 | Ga0495651_0118725 | Ga0495651_0118725_156_524 | 103 |
| 334 | 3300046463 | Ga0495653_0175997 | Ga0495653_0175997_422_808 | 103 |
| 335 | 3300046472 | Ga0495580_0015956 | Ga0495580_0015956_3694_4035 | 103 |
| 336 | 3300046472 | Ga0495580_0067785 | Ga0495580_0067785_2014_2346 | 103 |
| 337 | 3300046472 | Ga0495580_0142069 | Ga0495580_0142069_28_375 | 103 |
| 338 | 3300046473 | Ga0495582_0006192 | Ga0495582_0006192_1372_1713 | 103 |
| 339 | 3300046473 | Ga0495582_0132629 | Ga0495582_0132629_999_1328 | 103 |
| 340 | 3300046475 | Ga0495639_0009872 | Ga0495639_0009872_293_640 | 103 |
| 341 | 3300046475 | Ga0495639_0325507 | Ga0495639_0325507_123_509 | 103 |
| 342 | 3300046477 | Ga0495664_0548819 | Ga0495664_0548819_41_370 | 103 |
| 343 | 3300046499 | Ga0495594_0084182 | Ga0495594_0084182_1096_1428 | 103 |
| 344 | 3300046511 | Ga0495608_0137543 | Ga0495608_0137543_646_987 | 103 |
| 345 | 3300046511 | Ga0495608_0388413 | Ga0495608_0388413_178_546 | 103 |
| 346 | 3300046514 | Ga0495618_0503076 | Ga0495618_0503076_165_506 | 103 |
| 347 | 3300046515 | Ga0495620_0354705 | Ga0495620_0354705_117_467 | 103 |
| 348 | 3300046516 | Ga0495628_0065300 | Ga0495628_0065300_461_847 | 103 |
| 349 | 3300046516 | Ga0495628_0259282 | Ga0495628_0259282_312_689 | 103 |
| 350 | 3300046517 | Ga0495630_0012952 | Ga0495630_0012952_5120_5461 | 103 |
| 351 | 3300046517 | Ga0495630_0247338 | Ga0495630_0247338_439_780 | 103 |
| 352 | 3300046517 | Ga0495630_0266931 | Ga0495630_0266931_549_896 | 103 |
| 353 | 3300046517 | Ga0495630_0686239 | Ga0495630_0686239_222_569 | 103 |
| 354 | 3300046523 | Ga0495644_0442140 | Ga0495644_0442140_105_455 | 103 |
| 355 | 3300046529 | Ga0495652_0054080 | Ga0495652_0054080_1737_2114 | 103 |
| 356 | 3300046529 | Ga0495652_0231509 | Ga0495652_0231509_67_453 | 103 |
| 357 | 3300046531 | Ga0495665_0054809 | Ga0495665_0054809_1254_1601 | 103 |
| 358 | 3300046531 | Ga0495665_0221230 | Ga0495665_0221230_391_759 | 103 |
| 359 | 3300046535 | Ga0495586_0202875 | Ga0495586_0202875_456_803 | 103 |
| 360 | 3300046535 | Ga0495586_0322415 | Ga0495586_0322415_150_491 | 103 |
| 361 | 3300046536 | Ga0495587_0023721 | Ga0495587_0023721_2998_3375 | 103 |
| 362 | 3300046536 | Ga0495587_0033301 | Ga0495587_0033301_553_939 | 103 |
| 363 | 3300046537 | Ga0495598_0111578 | Ga0495598_0111578_555_896 | 103 |
| 364 | 3300046539 | Ga0495621_0014471 | Ga0495621_0014471_368_718 | 103 |
| 365 | 3300046543 | Ga0495645_0041681 | Ga0495645_0041681_2060_2389 | 103 |
| 366 | 3300046557 | Ga0495622_0473737 | Ga0495622_0473737_135_476 | 103 |
| 367 | 3300046559 | Ga0495667_0043306 | Ga0495667_0043306_623_1009 | 103 |
| 368 | 3300046559 | Ga0495667_0082522 | Ga0495667_0082522_163_540 | 103 |
| 369 | 3300046559 | Ga0495667_0156825 | Ga0495667_0156825_210_557 | 103 |
| 370 | 3300046663 | Ga0495635_0007021 | Ga0495635_0007021_6929_7270 | 103 |
| 371 | 3300046663 | Ga0495635_0167840 | Ga0495635_0167840_47_388 | 103 |
| 372 | 3300046663 | Ga0495635_0358076 | Ga0495635_0358076_440_808 | 103 |
| 373 | 3300046663 | Ga0495635_0466969 | Ga0495635_0466969_235_582 | 103 |
| 374 | 3300046663 | Ga0495635_0675453 | Ga0495635_0675453_216_563 | 103 |
| 375 | 3300046663 | Ga0495635_1092610 | Ga0495635_1092610_31_360 | 103 |
| 376 | 3300046674 | Ga0495588_0002561 | Ga0495588_0002561_4797_5138 | 103 |
| 377 | 3300046674 | Ga0495588_0052421 | Ga0495588_0052421_885_1232 | 103 |
| 378 | 3300046675 | Ga0495657_0058919 | Ga0495657_0058919_637_978 | 103 |
| 379 | 3300046678 | Ga0495599_0034424 | Ga0495599_0034424_724_1110 | 103 |
| 380 | 3300046678 | Ga0495599_0054700 | Ga0495599_0054700_2129_2476 | 103 |
| 381 | 3300046679 | Ga0495623_0012316 | Ga0495623_0012316_1874_2260 | 103 |
| 382 | 3300046679 | Ga0495623_0258481 | Ga0495623_0258481_215_592 | 103 |
| 383 | 3300046679 | Ga0495623_0730858 | Ga0495623_0730858_119_466 | 103 |
| 384 | 3300046680 | Ga0495646_0075225 | Ga0495646_0075225_307_648 | 103 |
| 385 | 3300046683 | Ga0495658_0001372 | Ga0495658_0001372_5298_5639 | 103 |
| 386 | 3300046683 | Ga0495658_0009502 | Ga0495658_0009502_216_545 | 103 |
| 387 | 3300046689 | Ga0495613_0011253 | Ga0495613_0011253_325_666 | 103 |
| 388 | 3300046689 | Ga0495613_0281710 | Ga0495613_0281710_47_394 | 103 |
| 389 | 3300046689 | Ga0495613_0625876 | Ga0495613_0625876_322_651 | 103 |
| 390 | 3300046809 | Ga0495600_0022969 | Ga0495600_0022969_2355_2741 | 103 |
| 391 | 3300046809 | Ga0495600_0130752 | Ga0495600_0130752_1053_1400 | 103 |
| 392 | 3300046809 | Ga0495600_0513807 | Ga0495600_0513807_79_408 | 103 |
| 393 | 3300047315 | Ga0495581_0009525 | Ga0495581_0009525_248_589 | 103 |
| 394 | 3300047317 | Ga0495604_0008532 | Ga0495604_0008532_360_746 | 103 |
| 395 | 3300047319 | Ga0495674_0070612 | Ga0495674_0070612_460_846 | 103 |
| 396 | 3300047319 | Ga0495674_0207255 | Ga0495674_0207255_167_535 | 103 |
| 397 | 3300047444 | Ga0495675_0007268 | Ga0495675_0007268_748_1125 | 103 |
| 398 | 3300047444 | Ga0495675_0144996 | Ga0495675_0144996_652_981 | 103 |
| 399 | 3300047471 | Ga0495684_0009853 | Ga0495684_0009853_6048_6416 | 103 |
| 400 | 3300047471 | Ga0495684_0050200 | Ga0495684_0050200_1872_2258 | 103 |
| 401 | 3300047471 | Ga0495684_0297734 | Ga0495684_0297734_798_1145 | 103 |
| 402 | 3300047471 | Ga0495684_0381205 | Ga0495684_0381205_360_725 | 103 |
| 403 | 3300047471 | Ga0495684_0714001 | Ga0495684_0714001_85_432 | 103 |
| 404 | 3300047673 | Ga0495593_0000060 | Ga0495593_0000060_33573_33914 | 103 |
| 405 | 3300047673 | Ga0495593_0059614 | Ga0495593_0059614_285_632 | 103 |
| 406 | 3300048088 | Ga0495602_0711334 | Ga0495602_0711334_271_639 | 103 |
| 407 | 3300048089 | Ga0495614_0441410 | Ga0495614_0441410_244_591 | 103 |
| 408 | 3300048904 | Ga0496101_0100496 | Ga0496101_0100496_1471_1815 | 103 |
| 409 | 3300048907 | Ga0496104_0633502 | Ga0496104_0633502_285_629 | 103 |
| 410 | 3300048909 | Ga0496106_0388699 | Ga0496106_0388699_498_842 | 103 |
| 411 | 3300048910 | Ga0496107_0105777 | Ga0496107_0105777_548_892 | 103 |
| 412 | 3300048917 | Ga0496114_0109722 | Ga0496114_0109722_399_743 | 103 |
| 413 | 3300048918 | Ga0496115_0003763 | Ga0496115_0003763_2284_2628 | 103 |
| 414 | 3300049523 | Ga0501300_088233 | Ga0501300_088233_161_499 | 103 |
| 415 | 3300049569 | Ga0501032_0014708 | Ga0501032_0014708_1198_1527 | 103 |
| 416 | 3300049569 | Ga0501032_0123567 | Ga0501032_0123567_1183_1512 | 103 |
| 417 | 3300049570 | Ga0501033_0225628 | Ga0501033_0225628_745_1074 | 103 |
| 418 | 3300049571 | Ga0501034_0018990 | Ga0501034_0018990_5150_5479 | 103 |
| 419 | 3300049571 | Ga0501034_0046437 | Ga0501034_0046437_3714_4043 | 103 |
| 420 | 3300049571 | Ga0501034_0442343 | Ga0501034_0442343_833_1162 | 103 |
| 421 | 3300049571 | Ga0501034_0657209 | Ga0501034_0657209_10_339 | 103 |
| 422 | 3300049571 | Ga0501034_1410936 | Ga0501034_1410936_200_529 | 103 |
| 423 | 3300049572 | Ga0501036_0026308 | Ga0501036_0026308_3984_4313 | 103 |
| 424 | 3300049572 | Ga0501036_0090790 | Ga0501036_0090790_585_914 | 103 |
| 425 | 3300049573 | Ga0501037_0018603 | Ga0501037_0018603_3605_3934 | 103 |
| 426 | 3300049573 | Ga0501037_0175610 | Ga0501037_0175610_769_1098 | 103 |
| 427 | 3300049573 | Ga0501037_0279573 | Ga0501037_0279573_613_942 | 103 |
| 428 | 3300049574 | Ga0501038_0068325 | Ga0501038_0068325_2624_2953 | 103 |
| 429 | 3300049574 | Ga0501038_0069369 | Ga0501038_0069369_192_521 | 103 |
| 430 | 3300049575 | Ga0501039_0015539 | Ga0501039_0015539_1338_1667 | 103 |
| 431 | 3300049579 | Ga0501043_0008735 | Ga0501043_0008735_7469_7798 | 103 |
| 432 | 3300049579 | Ga0501043_0032762 | Ga0501043_0032762_963_1292 | 103 |
| 433 | 3300049579 | Ga0501043_0073963 | Ga0501043_0073963_1446_1775 | 103 |
| 434 | 3300049580 | Ga0501046_0060607 | Ga0501046_0060607_1139_1468 | 103 |
| 435 | 3300049580 | Ga0501046_0080200 | Ga0501046_0080200_1998_2327 | 103 |
| 436 | 3300049580 | Ga0501046_0129772 | Ga0501046_0129772_1294_1623 | 103 |
| 437 | 3300049581 | Ga0501047_0000816 | Ga0501047_0000816_13982_14311 | 103 |
| 438 | 3300049581 | Ga0501047_0063049 | Ga0501047_0063049_598_927 | 103 |
| 439 | 3300049581 | Ga0501047_0084766 | Ga0501047_0084766_2677_3006 | 103 |
| 440 | 3300049581 | Ga0501047_0150617 | Ga0501047_0150617_1304_1633 | 103 |
| 441 | 3300049582 | Ga0501048_0578298 | Ga0501048_0578298_89_418 | 103 |
| 442 | 3300049583 | Ga0501067_0130560 | Ga0501067_0130560_766_1095 | 103 |
| 443 | 3300049584 | Ga0501068_0048079 | Ga0501068_0048079_1753_2082 | 103 |
| 444 | 3300049584 | Ga0501068_0067811 | Ga0501068_0067811_1594_1923 | 103 |
| 445 | 3300049585 | Ga0501069_0032378 | Ga0501069_0032378_2406_2735 | 103 |
| 446 | 3300049585 | Ga0501069_0179444 | Ga0501069_0179444_720_1052 | 103 |
| 447 | 3300049586 | Ga0501070_0362274 | Ga0501070_0362274_91_420 | 103 |
| 448 | 3300049586 | Ga0501070_0415941 | Ga0501070_0415941_501_830 | 103 |
| 449 | 3300049587 | Ga0501071_0870807 | Ga0501071_0870807_132_476 | 103 |
| 450 | 3300049588 | Ga0501072_0020667 | Ga0501072_0020667_1442_1771 | 103 |
| 451 | 3300049588 | Ga0501072_1065991 | Ga0501072_1065991_249_578 | 103 |
| 452 | 3300049588 | Ga0501072_1449725 | Ga0501072_1449725_60_389 | 103 |
| 453 | 3300049589 | Ga0501073_0012265 | Ga0501073_0012265_598_927 | 103 |
| 454 | 3300049589 | Ga0501073_0027190 | Ga0501073_0027190_3731_4060 | 103 |
| 455 | 3300049589 | Ga0501073_0349766 | Ga0501073_0349766_269_598 | 103 |
| 456 | 3300049589 | Ga0501073_0507441 | Ga0501073_0507441_120_464 | 103 |
| 457 | 3300049590 | Ga0501074_0521682 | Ga0501074_0521682_169_498 | 103 |
| 458 | 3300049590 | Ga0501074_0736735 | Ga0501074_0736735_235_564 | 103 |
| 459 | 3300049592 | Ga0501076_0730809 | Ga0501076_0730809_81_410 | 103 |
| 460 | 3300049593 | Ga0501077_0029288 | Ga0501077_0029288_2478_2822 | 103 |
| 461 | 3300049593 | Ga0501077_0445081 | Ga0501077_0445081_373_702 | 103 |
| 462 | 3300049593 | Ga0501077_0766394 | Ga0501077_0766394_185_514 | 103 |
| 463 | 3300049661 | Ga0501217_049395 | Ga0501217_049395_143_475 | 103 |
| 464 | 3300049668 | Ga0501233_107889 | Ga0501233_107889_251_595 | 103 |
| 465 | 3300049669 | Ga0501235_073251 | Ga0501235_073251_431_763 | 103 |
| 466 | 3300049675 | Ga0501243_147535 | Ga0501243_147535_109_450 | 103 |
| 467 | 3300049741 | Ga0501079_0041100 | Ga0501079_0041100_1804_2133 | 103 |
| 468 | 3300049741 | Ga0501079_0204315 | Ga0501079_0204315_1190_1519 | 103 |
| 469 | 3300049741 | Ga0501079_0957302 | Ga0501079_0957302_77_412 | 103 |
| 470 | 3300049742 | Ga0501080_0014268 | Ga0501080_0014268_1754_2083 | 103 |
| 471 | 3300049743 | Ga0501081_1546564 | Ga0501081_1546564_49_393 | 103 |
| 472 | 3300049744 | Ga0501083_0006188 | Ga0501083_0006188_5443_5772 | 103 |
| 473 | 3300049744 | Ga0501083_0447683 | Ga0501083_0447683_243_572 | 103 |
| 474 | 3300049744 | Ga0501083_1075290 | Ga0501083_1075290_11_400 | 103 |
| 475 | 3300049767 | Ga0501270_083742 | Ga0501270_083742_201_542 | 103 |
| 476 | 3300049769 | Ga0501272_073941 | Ga0501272_073941_107_439 | 103 |
| 477 | 3300049822 | Ga0501035_0050489 | Ga0501035_0050489_617_946 | 103 |
| 478 | 3300049822 | Ga0501035_0380168 | Ga0501035_0380168_175_504 | 103 |
| 479 | 3300049823 | Ga0501044_0080266 | Ga0501044_0080266_2227_2556 | 103 |
| 480 | 3300049823 | Ga0501044_0088415 | Ga0501044_0088415_1134_1463 | 103 |
| 481 | 3300050507 | nmdc:mga05p37_114056_c1 | nmdc:mga05p37_114056_c1_1557_1889 | 103 |
| 482 | 3300050507 | nmdc:mga05p37_203761_c1 | nmdc:mga05p37_203761_c1_1180_1509 | 103 |
| 483 | 3300050507 | nmdc:mga05p37_31256_c1 | nmdc:mga05p37_31256_c1_3267_3596 | 103 |
| 484 | 3300050508 | nmdc:mga09592_1067165_c1 | nmdc:mga09592_1067165_c1_179_511 | 103 |
| 485 | 3300050508 | nmdc:mga09592_257056_c1 | nmdc:mga09592_257056_c1_332_664 | 103 |
| 486 | 3300050508 | nmdc:mga09592_320546_c1 | nmdc:mga09592_320546_c1_243_572 | 103 |
| 487 | 3300050508 | nmdc:mga09592_592555_c1 | nmdc:mga09592_592555_c1_384_725 | 103 |
| 488 | 3300050508 | nmdc:mga09592_729355_c1 | nmdc:mga09592_729355_c1_390_719 | 103 |
| 489 | 3300050510 | nmdc:mga06r32_1963096_c1 | nmdc:mga06r32_1963096_c1_150_494 | 103 |
| 490 | 3300050510 | nmdc:mga06r32_220700_c1 | nmdc:mga06r32_220700_c1_958_1290 | 103 |
| 491 | 3300050510 | nmdc:mga06r32_229471_c1 | nmdc:mga06r32_229471_c1_624_953 | 103 |
| 492 | 3300050510 | nmdc:mga06r32_853520_c1 | nmdc:mga06r32_853520_c1_238_576 | 103 |
| 493 | 3300050510 | nmdc:mga06r32_930564_c1 | nmdc:mga06r32_930564_c1_419_751 | 103 |
| 494 | 3300050510 | nmdc:mga06r32_9351_c1 | nmdc:mga06r32_9351_c1_7776_8108 | 103 |
| 495 | 3300050511 | nmdc:mga08y16_278955_c1 | nmdc:mga08y16_278955_c1_776_1132 | 103 |
| 496 | 3300050511 | nmdc:mga08y16_28966_c1 | nmdc:mga08y16_28966_c1_1300_1644 | 103 |
| 497 | 3300050511 | nmdc:mga08y16_409051_c1 | nmdc:mga08y16_409051_c1_98_430 | 103 |
| 498 | 3300050511 | nmdc:mga08y16_6063_c1 | nmdc:mga08y16_6063_c1_4945_5274 | 103 |
| 499 | 3300050512 | nmdc:mga0n895_1148354_c1 | nmdc:mga0n895_1148354_c1_381_710 | 103 |
| 500 | 3300050512 | nmdc:mga0n895_1269426_c1 | nmdc:mga0n895_1269426_c1_117_449 | 103 |
| 501 | 3300050512 | nmdc:mga0n895_293895_c1 | nmdc:mga0n895_293895_c1_868_1200 | 103 |
| 502 | 3300050512 | nmdc:mga0n895_5211_c1 | nmdc:mga0n895_5211_c1_1530_1862 | 103 |
| 503 | 3300050513 | nmdc:mga0rr50_1108083_c1 | nmdc:mga0rr50_1108083_c1_91_435 | 103 |
| 504 | 3300050513 | nmdc:mga0rr50_409923_c1 | nmdc:mga0rr50_409923_c1_678_1010 | 103 |
| 505 | 3300050514 | nmdc:mga08x19_184093_c1 | nmdc:mga08x19_184093_c1_757_1107 | 103 |
| 506 | 3300050515 | nmdc:mga0a205_49087_c1 | nmdc:mga0a205_49087_c1_3683_4015 | 103 |
| 507 | 3300050515 | nmdc:mga0a205_97737_c1 | nmdc:mga0a205_97737_c1_47_379 | 103 |
| 508 | 3300053077 | Ga0495601_0093087 | Ga0495601_0093087_1082_1411 | 103 |
| 509 | 3300053078 | Ga0495612_0012624 | Ga0495612_0012624_2593_2934 | 103 |
| 510 | 3300053084 | Ga0495595_0029730 | Ga0495595_0029730_493_879 | 103 |
| 511 | 3300054114 | Ga0501084_0001977 | Ga0501084_0001977_10096_10425 | 103 |
| 512 | 3300054114 | Ga0501084_0077611 | Ga0501084_0077611_1174_1503 | 103 |
| 513 | 3300054114 | Ga0501084_1045634 | Ga0501084_1045634_196_525 | 103 |
| 514 | 3300060353 | Ga0501082_0024532 | Ga0501082_0024532_4370_4699 | 103 |
| 515 | 3300060353 | Ga0501082_0043249 | Ga0501082_0043249_12_341 | 103 |
| 516 | 3300061719 | Ga0466962_0647883 | Ga0466962_0647883_157_498 | 103 |
| 517 | 3300061734 | Ga0530510_0565371 | Ga0530510_0565371_198_527 | 103 |
| 518 | 3300005290 | Ga0065712_10215359 | Ga0065712_102153591 | 108 |
| 519 | 3300005340 | Ga0070689_100089760 | Ga0070689_1000897601 | 108 |
| 520 | 3300005354 | Ga0070675_100345315 | Ga0070675_1003453152 | 108 |
| 521 | 3300005365 | Ga0070688_100194217 | Ga0070688_1001942172 | 108 |
| 522 | 3300005365 | Ga0070688_100652293 | Ga0070688_1006522932 | 108 |
| 523 | 3300009553 | Ga0105249_10305682 | Ga0105249_103056822 | 108 |
| 524 | 3300014326 | Ga0157380_10907252 | Ga0157380_109072521 | 108 |
| 525 | 3300027907 | Ga0207428_10208793 | Ga0207428_102087932 | 108 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hhh-assembly1.cif.gz_B | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9473 | 9 | 106 |
| 1xma-assembly1.cif.gz_B-2 | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9372 | 8 | 103 |
| 3hhh-assembly1.cif.gz_A | crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 | 0.9312 | 8 | 104 |
| 1xma-assembly1.cif.gz_A | structure of a transcriptional regulator from clostridium thermocellum cth-833 | 0.9284 | 8 | 103 |
| 3l7w-assembly1.cif.gz_A-2 | the crystal structure of smu.1704 from streptococcus mutans ua159 | 0.9189 | 4 | 107 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUS4_1_110_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9318 | 8 | 104 | 1.10.10.10 |
| 1xmaA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9284 | 8 | 103 | 1.10.10.10 |
| af_I6X7F9_1_101_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9174 | 8 | 106 | 1.10.10.10 |
| af_P71704_1_89_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9 | 11 | 89 | 1.10.10.10 |
| 5dymA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8901 | 11 | 105 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W4S967-F1-model_v4 | Transcription regulator PadR N-terminal domain-containing protein | 0.9973 | 8 | 105 |
|
| AF-A0A2E8E0J4-F1-model_v4 | PadR family transcriptional regulator | 0.9895 | 5 | 108 |
|
| AF-C1F744-F1-model_v4 | Transcriptional regulator, PadR family | 0.9892 | 7 | 107 |
|
| AF-W0RSI0-F1-model_v4 | Transcriptional regulator, PadR-family | 0.9875 | 8 | 107 |
|
| AF-A0A2V7RSL4-F1-model_v4 | PadR family transcriptional regulator | 0.9868 | 5 | 108 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar