F459345

General Info

Members Datasets Scaffolds Average Seq Length
525 284 525 113

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_1075290|Ga0501083_1075290_11_400
Length 129
Sequence MYPAAAYTSTVDGSDMPRPPVDLLQGTLDLLVLKTLSWGPAHGYAIARWIEQLTGDVLQVGEGSLYPALHRLEARDWIESEWRLSEHNRRAKFYQLTGLGRRQLREETRSWGLLVEAVGKVLRTREQPT

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
139 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
151 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
152 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
161 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
162 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
163 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
177 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
180 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
181 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
182 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
183 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
184 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
185 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
186 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
187 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
209 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
214 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
215 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
222 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
223 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
227 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
228 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
229 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
233 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
234 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
235 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
236 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
237 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
249 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
250 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
251 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
252 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
253 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
254 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
255 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
256 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
257 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
258 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
259 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
260 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
261 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
267 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
268 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
273 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
274 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
275 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
280 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
284 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.33
Rhizosphere 97.9
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10215359 3300005290 Unclassified 1058
2 Ga0065715_10239422 3300005293 Bacteria 1204
3 Ga0070658_10079569 3300005327 Bacteria 2691
4 Ga0070658_10723431 3300005327 Unclassified 864
5 Ga0070676_10669729 3300005328 Unclassified 755
6 Ga0070670_100615237 3300005331 Bacteria 973
7 Ga0070677_10155604 3300005333 Bacteria 1068
8 Ga0068869_101319739 3300005334 Unclassified 637
9 Ga0068869_101336998 3300005334 Bacteria 633
10 Ga0070680_100050521 3300005336 Bacteria 3392
11 Ga0070680_101491244 3300005336 Bacteria 586
12 Ga0070689_100089760 3300005340 Bacteria 2421
13 Ga0070691_10011449 3300005341 Bacteria 4051
14 Ga0070687_100620795 3300005343 Bacteria 745
15 Ga0070687_100680508 3300005343 Bacteria 716
16 Ga0070668_100714195 3300005347 Bacteria 885
17 Ga0070668_101176908 3300005347 Bacteria 694
18 Ga0070669_100006088 3300005353 Bacteria 8704
19 Ga0070669_100048016 3300005353 Bacteria 3115
20 Ga0070669_100170913 3300005353 Bacteria 1694
21 Ga0070675_100345315 3300005354 Unclassified 1319
22 Ga0070675_100644481 3300005354 Bacteria 962
23 Ga0070675_100677754 3300005354 Bacteria 938
24 Ga0070674_100797691 3300005356 Bacteria 815
25 Ga0070673_100121798 3300005364 Bacteria 2177
26 Ga0070688_100146186 3300005365 Unclassified 1611
27 Ga0070688_100194217 3300005365 Unclassified 1416
28 Ga0070688_100652293 3300005365 Bacteria 811
29 Ga0070709_10038976 3300005434 Unclassified 2913
30 Ga0070709_10132087 3300005434 Bacteria 1706
31 Ga0070709_10242739 3300005434 Unclassified 1294
32 Ga0070709_10597096 3300005434 Bacteria 849
33 Ga0070714_100195359 3300005435 Unclassified 1848
34 Ga0070713_100048884 3300005436 Unclassified 3486
35 Ga0070713_100768194 3300005436 Unclassified 923
36 Ga0070710_10011232 3300005437 Bacteria 4421
37 Ga0070701_11238948 3300005438 Unclassified 531
38 Ga0070711_100043659 3300005439 Bacteria 3037
39 Ga0070711_100184597 3300005439 Bacteria 1598
40 Ga0070700_100308589 3300005441 Bacteria 1158
41 Ga0070694_100237143 3300005444 Unclassified 1374
42 Ga0070694_101206820 3300005444 Bacteria 634
43 Ga0070708_100552344 3300005445 Bacteria 1086
44 Ga0070708_101562941 3300005445 Unclassified 614
45 Ga0070662_100762742 3300005457 Bacteria 821
46 Ga0070681_10113327 3300005458 Bacteria 2651
47 Ga0070681_10155300 3300005458 Unclassified 2214
48 Ga0070681_10157874 3300005458 Bacteria 2192
49 Ga0070681_10316334 3300005458 Unclassified 1471
50 Ga0068867_100101346 3300005459 Bacteria 2200
51 Ga0070706_100452480 3300005467 Bacteria 1195
52 Ga0070707_101837658 3300005468 Bacteria 573
53 Ga0070707_102286392 3300005468 Bacteria 508
54 Ga0070698_100130073 3300005471 Bacteria 2473
55 Ga0070698_100341027 3300005471 Unclassified 1430
56 Ga0070699_100601749 3300005518 Unclassified 1002
57 Ga0070679_100039986 3300005530 Bacteria 4663
58 Ga0070679_100126247 3300005530 Bacteria 2541
59 Ga0070679_101357104 3300005530 Unclassified 657
60 Ga0070684_100025126 3300005535 Bacteria 5003
61 Ga0070684_100351305 3300005535 Bacteria 1356
62 Ga0070684_100351797 3300005535 Bacteria 1355
63 Ga0070697_100566293 3300005536 Bacteria 997
64 Ga0068853_100563314 3300005539 Bacteria 1080
65 Ga0070672_100019796 3300005543 Bacteria 4894
66 Ga0070665_100432484 3300005548 Unclassified 1325
67 Ga0070704_100070324 3300005549 Unclassified 2539
68 Ga0070704_101767485 3300005549 Bacteria 572
69 Ga0070664_100414574 3300005564 Bacteria 1233
70 Ga0068857_100199740 3300005577 Bacteria 1823
71 Ga0068852_100212429 3300005616 Bacteria 1836
72 Ga0068859_100158376 3300005617 Unclassified 2343
73 Ga0068859_100523459 3300005617 Bacteria 1281
74 Ga0068864_101792664 3300005618 Bacteria 619
75 Ga0068861_100051345 3300005719 Bacteria 3130
76 Ga0068861_101268819 3300005719 Bacteria 715
77 Ga0068861_101660738 3300005719 Bacteria 631
78 Ga0068870_10055211 3300005840 Bacteria 2116
79 Ga0068863_101874959 3300005841 Bacteria 609
80 Ga0068860_102173632 3300005843 Bacteria 576
81 Ga0068862_100018966 3300005844 Bacteria 5734
82 Ga0068862_100048668 3300005844 Bacteria 3619
83 Ga0068862_100762296 3300005844 Bacteria 942
84 Ga0068862_101014616 3300005844 Unclassified 821
85 Ga0068862_102205464 3300005844 Unclassified 562
86 Ga0070717_10061975 3300006028 Unclassified 3101
87 Ga0070717_10293449 3300006028 Unclassified 1444
88 Ga0075432_10491786 3300006058 Bacteria 545
89 Ga0070712_100148559 3300006175 Unclassified 1796
90 Ga0070712_100558606 3300006175 Unclassified 965
91 Ga0075428_100008863 3300006844 Bacteria 11158
92 Ga0075428_100068705 3300006844 Bacteria 3875
93 Ga0075428_100152759 3300006844 Bacteria 2508
94 Ga0075428_100910165 3300006844 Unclassified 933
95 Ga0075430_100205677 3300006846 Bacteria 1634
96 Ga0075431_100008852 3300006847 Bacteria 10085
97 Ga0075431_100167563 3300006847 Bacteria 2258
98 Ga0075431_100204858 3300006847 Unclassified 2017
99 Ga0075431_100363338 3300006847 Bacteria 1454
100 Ga0075433_10128812 3300006852 Unclassified 2248
101 Ga0075434_100018262 3300006871 Bacteria 6772
102 Ga0075434_100288152 3300006871 Bacteria 1662
103 Ga0075434_100453160 3300006871 Unclassified 1304
104 Ga0075434_101431880 3300006871 Bacteria 701
105 Ga0075434_101465174 3300006871 Bacteria 692
106 Ga0075429_100061451 3300006880 Bacteria 3273
107 Ga0075429_100082402 3300006880 Bacteria 2804
108 Ga0075429_100350905 3300006880 Unclassified 1292
109 Ga0075429_100617352 3300006880 Bacteria 950
110 Ga0068865_100077994 3300006881 Bacteria 2369
111 Ga0075436_100079393 3300006914 Bacteria 2273
112 Ga0097620_100158368 3300006931 Unclassified 2343
113 Ga0097620_100523440 3300006931 Bacteria 1281
114 Ga0075435_100029236 3300007076 Unclassified 4325
115 Ga0075435_100284441 3300007076 Unclassified 1412
116 Ga0111539_10005356 3300009094 Bacteria 16593
117 Ga0111539_10008461 3300009094 Bacteria 13084
118 Ga0111539_10048429 3300009094 Bacteria 5074
119 Ga0111539_10071240 3300009094 Bacteria 4102
120 Ga0111539_10201886 3300009094 Bacteria 2318
121 Ga0105245_10857998 3300009098 Unclassified 948
122 Ga0114129_10008837 3300009147 Bacteria 14375
123 Ga0114129_10024621 3300009147 Bacteria 8530
124 Ga0114129_10443507 3300009147 Bacteria 1704
125 Ga0114129_11073951 3300009147 Bacteria 1009
126 Ga0105243_10074625 3300009148 Bacteria 2751
127 Ga0105241_10581627 3300009174 Bacteria 1009
128 Ga0105241_11084309 3300009174 Bacteria 753
129 Ga0105248_10136698 3300009177 Bacteria 2765
130 Ga0105237_10457816 3300009545 Bacteria 1282
131 Ga0105238_10021908 3300009551 Bacteria 6510
132 Ga0105238_10087199 3300009551 Unclassified 3108
133 Ga0105249_10004049 3300009553 Bacteria 12641
134 Ga0105249_10011352 3300009553 Bacteria 7823
135 Ga0105249_10290252 3300009553 Unclassified 1637
136 Ga0105249_10305682 3300009553 Unclassified 1597
137 Ga0105249_11743076 3300009553 Bacteria 695
138 Ga0105239_10704586 3300010375 Bacteria 1154
139 Ga0105246_11138110 3300011119 Bacteria 715
140 Ga0157371_10136263 3300013102 Bacteria 1748
141 Ga0163162_11369630 3300013306 Bacteria 805
142 Ga0163162_12437799 3300013306 Bacteria 601
143 Ga0157372_10010954 3300013307 Bacteria 9650
144 Ga0157372_10019552 3300013307 Bacteria 7299
145 Ga0157372_10660699 3300013307 Unclassified 1217
146 Ga0157375_10857126 3300013308 Bacteria 1055
147 Ga0163163_10000030 3300014325 Bacteria 171203
148 Ga0157380_10078714 3300014326 Bacteria 2690
149 Ga0157380_10198793 3300014326 Bacteria 1777
150 Ga0157380_10769619 3300014326 Unclassified 976
151 Ga0157380_10907252 3300014326 Bacteria 908
152 Ga0157377_10114049 3300014745 Bacteria 1629
153 Ga0157377_10297540 3300014745 Bacteria 1064
154 Ga0157377_10912321 3300014745 Bacteria 658
155 Ga0157376_10185656 3300014969 Bacteria 1904
156 Ga0182007_10046524 3300015262 Unclassified 1437
157 Ga0163161_11555516 3300017792 Bacteria 582
158 Ga0213875_10003304 3300021388 Bacteria 9221
159 Ga0207697_10246358 3300025315 Bacteria 790
160 Ga0207682_10039988 3300025893 Bacteria 1909
161 Ga0207692_10009464 3300025898 Bacteria 4072
162 Ga0207688_10084929 3300025901 Bacteria 1813
163 Ga0207699_10157079 3300025906 Bacteria 1511
164 Ga0207699_10220540 3300025906 Unclassified 1294
165 Ga0207699_10313497 3300025906 Unclassified 1098
166 Ga0207645_10812404 3300025907 Unclassified 636
167 Ga0207643_10094344 3300025908 Bacteria 1748
168 Ga0207705_10159411 3300025909 Bacteria 1694
169 Ga0207684_10264439 3300025910 Bacteria 1484
170 Ga0207654_10359335 3300025911 Bacteria 1004
171 Ga0207707_10026191 3300025912 Bacteria 5098
172 Ga0207707_10153771 3300025912 Unclassified 2011
173 Ga0207671_10966235 3300025914 Bacteria 672
174 Ga0207693_10017898 3300025915 Bacteria 5649
175 Ga0207693_11352947 3300025915 Unclassified 531
176 Ga0207663_10761933 3300025916 Bacteria 769
177 Ga0207660_10064037 3300025917 Bacteria 2653
178 Ga0207660_11280192 3300025917 Bacteria 596
179 Ga0207660_11515515 3300025917 Bacteria 542
180 Ga0207662_10007501 3300025918 Bacteria 5939
181 Ga0207657_10033664 3300025919 Bacteria 4616
182 Ga0207649_10095539 3300025920 Bacteria 1956
183 Ga0207649_11095522 3300025920 Unclassified 628
184 Ga0207652_10055707 3300025921 Bacteria 3401
185 Ga0207652_10106508 3300025921 Bacteria 2482
186 Ga0207652_10128799 3300025921 Bacteria 2256
187 Ga0207652_10807689 3300025921 Bacteria 833
188 Ga0207681_10022208 3300025923 Bacteria 4044
189 Ga0207681_10069261 3300025923 Bacteria 2453
190 Ga0207681_10169484 3300025923 Bacteria 1654
191 Ga0207694_10049390 3300025924 Bacteria 3257
192 Ga0207694_10096109 3300025924 Unclassified 2343
193 Ga0207650_10678260 3300025925 Bacteria 870
194 Ga0207659_10120353 3300025926 Bacteria 2011
195 Ga0207659_10626417 3300025926 Bacteria 918
196 Ga0207659_11053770 3300025926 Bacteria 700
197 Ga0207700_10059694 3300025928 Unclassified 2885
198 Ga0207700_10088265 3300025928 Unclassified 2441
199 Ga0207700_11255752 3300025928 Bacteria 660
200 Ga0207664_11493590 3300025929 Bacteria 597
201 Ga0207690_10145988 3300025932 Bacteria 1749
202 Ga0207706_10142698 3300025933 Bacteria 2107
203 Ga0207706_11373648 3300025933 Bacteria 581
204 Ga0207709_10232061 3300025935 Bacteria 1337
205 Ga0207704_10034903 3300025938 Bacteria 2875
206 Ga0207704_10232287 3300025938 Bacteria 1372
207 Ga0207691_10256275 3300025940 Bacteria 1509
208 Ga0207689_11703778 3300025942 Bacteria 522
209 Ga0207661_10128959 3300025944 Bacteria 2163
210 Ga0207679_10154510 3300025945 Bacteria 1872
211 Ga0207651_10015089 3300025960 Bacteria 4480
212 Ga0207712_10010343 3300025961 Bacteria 5921
213 Ga0207712_10014842 3300025961 Bacteria 5015
214 Ga0207668_10143982 3300025972 Bacteria 1836
215 Ga0207668_11546550 3300025972 Bacteria 599
216 Ga0207658_11173688 3300025986 Bacteria 702
217 Ga0207639_10517793 3300026041 Bacteria 1092
218 Ga0207639_11094827 3300026041 Bacteria 747
219 Ga0207708_10061937 3300026075 Bacteria 2857
220 Ga0207708_10577460 3300026075 Bacteria 950
221 Ga0207641_11653961 3300026088 Bacteria 642
222 Ga0207648_10069251 3300026089 Bacteria 3074
223 Ga0207676_11460768 3300026095 Bacteria 680
224 Ga0207674_10124874 3300026116 Bacteria 2539
225 Ga0207675_100078714 3300026118 Bacteria 3089
226 Ga0207675_100439882 3300026118 Bacteria 1290
227 Ga0207675_100460641 3300026118 Bacteria 1261
228 Ga0207698_10059379 3300026142 Bacteria 2969
229 Ga0209982_1037195 3300027552 Unclassified 773
230 Ga0207428_10014862 3300027907 Bacteria 6743
231 Ga0207428_10197706 3300027907 Bacteria 1513
232 Ga0207428_10208793 3300027907 Bacteria 1468
233 Ga0268266_10615093 3300028379 Bacteria 1044
234 Ga0268265_10031042 3300028380 Bacteria 3855
235 Ga0268265_10122756 3300028380 Bacteria 2143
236 Ga0268265_11126912 3300028380 Bacteria 780
237 Ga0268265_12022158 3300028380 Unclassified 583
238 Ga0268264_12506090 3300028381 Bacteria 521
239 Ga0265340_10263035 3300031247 Bacteria 768
240 Ga0307408_100595784 3300031548 Bacteria 981
241 Ga0307408_100635733 3300031548 Bacteria 952
242 Ga0307408_102523782 3300031548 Bacteria 500
243 Ga0316576_10006305 3300031727 Bacteria 7370
244 Ga0316578_10185201 3300031728 Bacteria 1255
245 Ga0307405_10044191 3300031731 Bacteria 2723
246 Ga0307405_10150268 3300031731 Bacteria 1637
247 Ga0307405_12002520 3300031731 Unclassified 518
248 Ga0307413_10013834 3300031824 Bacteria 4075
249 Ga0307413_10311791 3300031824 Bacteria 1198
250 Ga0307410_10020109 3300031852 Bacteria 4077
251 Ga0307410_10047437 3300031852 Bacteria 2871
252 Ga0307406_11305764 3300031901 Bacteria 633
253 Ga0307407_10114010 3300031903 Bacteria 1702
254 Ga0307412_10018931 3300031911 Bacteria 4157
255 Ga0307412_10097900 3300031911 Bacteria 2068
256 Ga0307412_10249305 3300031911 Unclassified 1378
257 Ga0307412_10379663 3300031911 Bacteria 1144
258 Ga0307409_100125475 3300031995 Bacteria 2182
259 Ga0307416_100027099 3300032002 Bacteria 4237
260 Ga0307411_10059233 3300032005 Bacteria 2538
261 Ga0307411_10309116 3300032005 Unclassified 1271
262 Ga0307415_100007834 3300032126 Bacteria 5872
263 Ga0307415_100085204 3300032126 Bacteria 2270
264 Ga0307415_100094343 3300032126 Unclassified 2175
265 Ga0307415_100483221 3300032126 Bacteria 1079
266 Ga0307415_101101224 3300032126 Bacteria 744
267 Ga0373926_0060162 3300035083 Unclassified 1383
268 Ga0373926_0117866 3300035083 Bacteria 1000
269 Ga0373934_0028194 3300035086 Unclassified 2186
270 Ga0373951_0051492 3300035091 Bacteria 1014
271 Ga0373923_0162258 3300035111 Unclassified 1020
272 Ga0373932_0163031 3300035112 Bacteria 772
273 Ga0373936_0205068 3300035113 Bacteria 871
274 Ga0373953_0011146 3300035117 Unclassified 3147
275 Ga0373954_0088481 3300035118 Bacteria 1485
276 Ga0373954_0211444 3300035118 Unclassified 953
277 Ga0373956_0081917 3300035119 Unclassified 1481
278 Ga0373956_0374700 3300035119 Unclassified 679
279 Ga0373956_0387921 3300035119 Unclassified 666
280 Ga0373957_0048067 3300035120 Unclassified 1625
281 Ga0373957_0086980 3300035120 Bacteria 1238
282 Ga0373943_0024273 3300035170 Bacteria 2826
283 Ga0373943_0131977 3300035170 Unclassified 1337
284 Ga0373946_0154460 3300035171 Unclassified 1073
285 Ga0373955_0016600 3300035172 Unclassified 3628
286 Ga0373955_0042663 3300035172 Bacteria 2437
287 Ga0373955_0505699 3300035172 Unclassified 738
288 Ga0373955_0545325 3300035172 Unclassified 709
289 Ga0373924_0071745 3300035410 Unclassified 1462
290 Ga0373924_0202110 3300035410 Bacteria 877
291 Ga0373924_0290559 3300035410 Unclassified 725
292 Ga0373931_0574100 3300035691 Bacteria 735
293 Ga0373931_1075809 3300035691 Bacteria 547
294 Ga0373935_0019625 3300035692 Unclassified 4122
295 Ga0373935_0289916 3300035692 Bacteria 1154
296 Ga0373927_0027429 3300035695 Unclassified 3718
297 Ga0373927_0071281 3300035695 Bacteria 2249
298 Ga0373927_0202184 3300035695 Unclassified 1304
299 Ga0373933_0053620 3300035724 Unclassified 2415
300 Ga0373933_0153332 3300035724 Bacteria 1460
301 Ga0373947_0073202 3300035725 Archaea 2105
302 Ga0373947_0256740 3300035725 Unclassified 1157
303 Ga0373937_0003750 3300036401 Bacteria 12844
304 Ga0373937_0055140 3300036401 Unclassified 3648
305 Ga0373937_0154546 3300036401 Bacteria 2150
306 Ga0373937_1461325 3300036401 Unclassified 631
307 Ga0373937_2079691 3300036401 Unclassified 514
308 Ga0316584_0045002 3300036712 Bacteria 3293
309 Ga0373925_0004615 3300037068 Bacteria 10399
310 Ga0373925_0134977 3300037068 Bacteria 1927
311 Ga0395900_0039603 3300037418 Bacteria 4856
312 Ga0395905_0174044 3300037471 Bacteria 2021
313 Ga0436364_0380945 3300037853 Bacteria 1687
314 Ga0436364_0864787 3300037853 Bacteria 12689
315 Ga0436365_0389660 3300039437 Bacteria 11420
316 Ga0439453_0028445 3300041408 Bacteria 1046
317 Ga0439453_0181606 3300041408 Bacteria 514
318 Ga0439461_0198115 3300041410 Unclassified 539
319 Ga0451807_0764093 3300041486 Unclassified 743
320 Ga0439431_0165447 3300041997 Unclassified 633
321 Ga0439443_033627 3300042003 Unclassified 854
322 Ga0439448_0138422 3300042005 Unclassified 842
323 Ga0439456_079924 3300042013 Unclassified 729
324 Ga0450919_015336 3300042121 Unclassified 865
325 Ga0450898_012561 3300042134 Unclassified 1401
326 Ga0439435_0012197 3300042436 Bacteria 2076
327 Ga0439435_0127013 3300042436 Unclassified 803
328 Ga0439435_0311994 3300042436 Bacteria 540
329 Ga0450893_0039032 3300042532 Unclassified 866
330 Ga0466957_0845639 3300044842 Bacteria 652
331 Ga0451576_0050509 3300045051 Bacteria 4361
332 Ga0451576_0755784 3300045051 Bacteria 1021
333 Ga0495592_0033456 3300046454 Unclassified 3877
334 Ga0495592_0346357 3300046454 Bacteria 954
335 Ga0495592_0624555 3300046454 Bacteria 655
336 Ga0495629_0010526 3300046459 Bacteria 6729
337 Ga0495629_0014541 3300046459 Bacteria 5664
338 Ga0495629_0183892 3300046459 Unclassified 1448
339 Ga0495651_0073785 3300046462 Unclassified 2589
340 Ga0495651_0097434 3300046462 Bacteria 2196
341 Ga0495651_0118725 3300046462 Bacteria 1946
342 Ga0495653_0175997 3300046463 Unclassified 1472
343 Ga0495580_0015956 3300046472 Bacteria 5652
344 Ga0495580_0067785 3300046472 Unclassified 2496
345 Ga0495580_0142069 3300046472 Unclassified 1664
346 Ga0495582_0006192 3300046473 Bacteria 6661
347 Ga0495582_0132629 3300046473 Bacteria 1408
348 Ga0495639_0009872 3300046475 Bacteria 4099
349 Ga0495639_0325507 3300046475 Unclassified 769
350 Ga0495664_0548819 3300046477 Unclassified 689
351 Ga0495594_0084182 3300046499 Bacteria 1778
352 Ga0495608_0137543 3300046511 Unclassified 1560
353 Ga0495608_0388413 3300046511 Bacteria 855
354 Ga0495618_0503076 3300046514 Unclassified 730
355 Ga0495620_0354705 3300046515 Unclassified 556
356 Ga0495628_0065300 3300046516 Unclassified 2847
357 Ga0495628_0259282 3300046516 Unclassified 1296
358 Ga0495630_0012952 3300046517 Bacteria 6058
359 Ga0495630_0247338 3300046517 Unclassified 1362
360 Ga0495630_0266931 3300046517 Bacteria 1307
361 Ga0495630_0686239 3300046517 Unclassified 784
362 Ga0495644_0442140 3300046523 Unclassified 517
363 Ga0495652_0054080 3300046529 Bacteria 3420
364 Ga0495652_0231509 3300046529 Bacteria 1381
365 Ga0495665_0054809 3300046531 Unclassified 2106
366 Ga0495665_0221230 3300046531 Bacteria 979
367 Ga0495586_0202875 3300046535 Unclassified 1124
368 Ga0495586_0322415 3300046535 Unclassified 886
369 Ga0495587_0023721 3300046536 Bacteria 3769
370 Ga0495587_0033301 3300046536 Unclassified 3111
371 Ga0495598_0111578 3300046537 Bacteria 917
372 Ga0495621_0014471 3300046539 Bacteria 2497
373 Ga0495645_0041681 3300046543 Unclassified 3348
374 Ga0495622_0473737 3300046557 Unclassified 536
375 Ga0495667_0043306 3300046559 Unclassified 2983
376 Ga0495667_0082522 3300046559 Bacteria 2088
377 Ga0495667_0156825 3300046559 Bacteria 1465
378 Ga0495635_0007021 3300046663 Bacteria 7868
379 Ga0495635_0167840 3300046663 Unclassified 1493
380 Ga0495635_0358076 3300046663 Unclassified 973
381 Ga0495635_0466969 3300046663 Unclassified 833
382 Ga0495635_0675453 3300046663 Unclassified 671
383 Ga0495635_1092610 3300046663 Bacteria 505
384 Ga0495588_0002561 3300046674 Bacteria 7771
385 Ga0495588_0052421 3300046674 Bacteria 2103
386 Ga0495657_0058919 3300046675 Bacteria 2548
387 Ga0495599_0034424 3300046678 Unclassified 3182
388 Ga0495599_0054700 3300046678 Bacteria 2500
389 Ga0495623_0012316 3300046679 Bacteria 5536
390 Ga0495623_0258481 3300046679 Unclassified 976
391 Ga0495623_0730858 3300046679 Bacteria 505
392 Ga0495646_0075225 3300046680 Bacteria 1980
393 Ga0495658_0001372 3300046683 Bacteria 12767
394 Ga0495658_0009502 3300046683 Bacteria 4850
395 Ga0495613_0011253 3300046689 Bacteria 6648
396 Ga0495613_0281710 3300046689 Bacteria 1154
397 Ga0495613_0625876 3300046689 Bacteria 714
398 Ga0495600_0022969 3300046809 Unclassified 4010
399 Ga0495600_0130752 3300046809 Bacteria 1632
400 Ga0495600_0513807 3300046809 Unclassified 735
401 Ga0495581_0009525 3300047315 Bacteria 5621
402 Ga0495604_0008532 3300047317 Bacteria 8091
403 Ga0495674_0070612 3300047319 Unclassified 3017
404 Ga0495674_0207255 3300047319 Bacteria 1625
405 Ga0495675_0007268 3300047444 Bacteria 6824
406 Ga0495675_0144996 3300047444 Bacteria 1470
407 Ga0495684_0009853 3300047471 Bacteria 7374
408 Ga0495684_0050200 3300047471 Unclassified 3186
409 Ga0495684_0297734 3300047471 Bacteria 1159
410 Ga0495684_0381205 3300047471 Bacteria 994
411 Ga0495684_0714001 3300047471 Unclassified 663
412 Ga0495593_0000060 3300047673 Bacteria 45391
413 Ga0495593_0059614 3300047673 Bacteria 2000
414 Ga0495602_0711334 3300048088 Unclassified 681
415 Ga0495614_0441410 3300048089 Unclassified 615
416 Ga0496101_0100496 3300048904 Bacteria 2164
417 Ga0496104_0633502 3300048907 Bacteria 978
418 Ga0496106_0388699 3300048909 Bacteria 1121
419 Ga0496107_0105777 3300048910 Bacteria 2066
420 Ga0496114_0109722 3300048917 Bacteria 2363
421 Ga0496115_0003763 3300048918 Bacteria 10902
422 Ga0501300_088233 3300049523 Unclassified 517
423 Ga0501032_0014708 3300049569 Bacteria 5537
424 Ga0501032_0123567 3300049569 Unclassified 1710
425 Ga0501033_0225628 3300049570 Unclassified 1332
426 Ga0501034_0018990 3300049571 Bacteria 7041
427 Ga0501034_0046437 3300049571 Bacteria 4388
428 Ga0501034_0442343 3300049571 Unclassified 1219
429 Ga0501034_0657209 3300049571 Bacteria 949
430 Ga0501034_1410936 3300049571 Bacteria 571
431 Ga0501036_0026308 3300049572 Unclassified 4910
432 Ga0501036_0090790 3300049572 Unclassified 2580
433 Ga0501037_0018603 3300049573 Bacteria 5119
434 Ga0501037_0175610 3300049573 Bacteria 1521
435 Ga0501037_0279573 3300049573 Unclassified 1163
436 Ga0501038_0068325 3300049574 Bacteria 3020
437 Ga0501038_0069369 3300049574 Bacteria 2994
438 Ga0501039_0015539 3300049575 Bacteria 5826
439 Ga0501043_0008735 3300049579 Bacteria 7974
440 Ga0501043_0032762 3300049579 Bacteria 4086
441 Ga0501043_0073963 3300049579 Unclassified 2676
442 Ga0501046_0060607 3300049580 Unclassified 2960
443 Ga0501046_0080200 3300049580 Bacteria 2522
444 Ga0501046_0129772 3300049580 Bacteria 1912
445 Ga0501047_0000816 3300049581 Bacteria 32399
446 Ga0501047_0063049 3300049581 Unclassified 3575
447 Ga0501047_0084766 3300049581 Bacteria 3045
448 Ga0501047_0150617 3300049581 Unclassified 2202
449 Ga0501048_0578298 3300049582 Unclassified 806
450 Ga0501067_0130560 3300049583 Unclassified 1398
451 Ga0501068_0048079 3300049584 Bacteria 2575
452 Ga0501068_0067811 3300049584 Bacteria 2175
453 Ga0501069_0032378 3300049585 Unclassified 2877
454 Ga0501069_0179444 3300049585 Bacteria 1224
455 Ga0501070_0362274 3300049586 Unclassified 1176
456 Ga0501070_0415941 3300049586 Bacteria 1086
457 Ga0501071_0870807 3300049587 Bacteria 695
458 Ga0501072_0020667 3300049588 Bacteria 5101
459 Ga0501072_1065991 3300049588 Unclassified 629
460 Ga0501072_1449725 3300049588 Unclassified 530
461 Ga0501073_0012265 3300049589 Bacteria 6253
462 Ga0501073_0027190 3300049589 Bacteria 4094
463 Ga0501073_0349766 3300049589 Unclassified 1020
464 Ga0501073_0507441 3300049589 Bacteria 834
465 Ga0501074_0521682 3300049590 Bacteria 841
466 Ga0501074_0736735 3300049590 Bacteria 695
467 Ga0501076_0730809 3300049592 Bacteria 817
468 Ga0501077_0029288 3300049593 Bacteria 3501
469 Ga0501077_0445081 3300049593 Bacteria 829
470 Ga0501077_0766394 3300049593 Unclassified 620
471 Ga0501217_049395 3300049661 Unclassified 1095
472 Ga0501233_107889 3300049668 Unclassified 742
473 Ga0501235_073251 3300049669 Unclassified 812
474 Ga0501243_147535 3300049675 Unclassified 500
475 Ga0501079_0041100 3300049741 Bacteria 3569
476 Ga0501079_0204315 3300049741 Unclassified 1543
477 Ga0501079_0957302 3300049741 Bacteria 674
478 Ga0501080_0014268 3300049742 Bacteria 7317
479 Ga0501081_1546564 3300049743 Bacteria 504
480 Ga0501083_0006188 3300049744 Bacteria 8491
481 Ga0501083_0447683 3300049744 Bacteria 840
482 Ga0501083_1075290 3300049744 Unclassified 524
483 Ga0501270_083742 3300049767 Unclassified 639
484 Ga0501272_073941 3300049769 Bacteria 502
485 Ga0501035_0050489 3300049822 Bacteria 3727
486 Ga0501035_0380168 3300049822 Bacteria 1178
487 Ga0501044_0080266 3300049823 Bacteria 3304
488 Ga0501044_0088415 3300049823 Bacteria 3127
489 nmdc:mga05p37_114056_c1 3300050507 Bacteria 3322
490 nmdc:mga05p37_203761_c1 3300050507 Bacteria 2394
491 nmdc:mga05p37_31256_c1 3300050507 Bacteria 6504
492 nmdc:mga09592_1067165_c1 3300050508 Bacteria 673
493 nmdc:mga09592_257056_c1 3300050508 Unclassified 1514
494 nmdc:mga09592_320546_c1 3300050508 Unclassified 1343
495 nmdc:mga09592_592555_c1 3300050508 Bacteria 950
496 nmdc:mga09592_729355_c1 3300050508 Bacteria 842
497 nmdc:mga06r32_1963096_c1 3300050510 Unclassified 519
498 nmdc:mga06r32_220700_c1 3300050510 Unclassified 1884
499 nmdc:mga06r32_229471_c1 3300050510 Bacteria 1844
500 nmdc:mga06r32_853520_c1 3300050510 Bacteria 869
501 nmdc:mga06r32_930564_c1 3300050510 Unclassified 824
502 nmdc:mga06r32_9351_c1 3300050510 Bacteria 8836
503 nmdc:mga08y16_278955_c1 3300050511 Bacteria 1724
504 nmdc:mga08y16_28966_c1 3300050511 Bacteria 5837
505 nmdc:mga08y16_409051_c1 3300050511 Bacteria 1388
506 nmdc:mga08y16_6063_c1 3300050511 Bacteria 12673
507 nmdc:mga0n895_1148354_c1 3300050512 Unclassified 752
508 nmdc:mga0n895_1269426_c1 3300050512 Bacteria 708
509 nmdc:mga0n895_293895_c1 3300050512 Unclassified 1647
510 nmdc:mga0n895_5211_c1 3300050512 Bacteria 10824
511 nmdc:mga0rr50_1108083_c1 3300050513 Bacteria 673
512 nmdc:mga0rr50_409923_c1 3300050513 Unclassified 1146
513 nmdc:mga08x19_184093_c1 3300050514 Unclassified 1427
514 nmdc:mga0a205_49087_c1 3300050515 Bacteria 4073
515 nmdc:mga0a205_97737_c1 3300050515 Unclassified 2835
516 Ga0495601_0093087 3300053077 Bacteria 1941
517 Ga0495612_0012624 3300053078 Unclassified 3406
518 Ga0495595_0029730 3300053084 Unclassified 2447
519 Ga0501084_0001977 3300054114 Bacteria 16378
520 Ga0501084_0077611 3300054114 Bacteria 2784
521 Ga0501084_1045634 3300054114 Unclassified 686
522 Ga0501082_0024532 3300060353 Bacteria 5198
523 Ga0501082_0043249 3300060353 Bacteria 3884
524 Ga0466962_0647883 3300061719 Bacteria 540
525 Ga0530510_0565371 3300061734 Bacteria 864

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10239422 Ga0065715_102394221 103
2 3300005327 Ga0070658_10079569 Ga0070658_100795692 103
3 3300005327 Ga0070658_10723431 Ga0070658_107234312 103
4 3300005328 Ga0070676_10669729 Ga0070676_106697292 103
5 3300005331 Ga0070670_100615237 Ga0070670_1006152372 103
6 3300005333 Ga0070677_10155604 Ga0070677_101556042 103
7 3300005334 Ga0068869_101319739 Ga0068869_1013197391 103
8 3300005334 Ga0068869_101336998 Ga0068869_1013369981 103
9 3300005336 Ga0070680_100050521 Ga0070680_1000505212 103
10 3300005336 Ga0070680_101491244 Ga0070680_1014912441 103
11 3300005341 Ga0070691_10011449 Ga0070691_100114492 103
12 3300005343 Ga0070687_100620795 Ga0070687_1006207952 103
13 3300005343 Ga0070687_100680508 Ga0070687_1006805081 103
14 3300005347 Ga0070668_100714195 Ga0070668_1007141952 103
15 3300005347 Ga0070668_101176908 Ga0070668_1011769082 103
16 3300005353 Ga0070669_100006088 Ga0070669_1000060883 103
17 3300005353 Ga0070669_100048016 Ga0070669_1000480162 103
18 3300005353 Ga0070669_100170913 Ga0070669_1001709132 103
19 3300005354 Ga0070675_100644481 Ga0070675_1006444811 103
20 3300005354 Ga0070675_100677754 Ga0070675_1006777542 103
21 3300005356 Ga0070674_100797691 Ga0070674_1007976912 103
22 3300005364 Ga0070673_100121798 Ga0070673_1001217982 103
23 3300005365 Ga0070688_100146186 Ga0070688_1001461862 103
24 3300005434 Ga0070709_10038976 Ga0070709_100389763 103
25 3300005434 Ga0070709_10132087 Ga0070709_101320872 103
26 3300005434 Ga0070709_10242739 Ga0070709_102427392 103
27 3300005434 Ga0070709_10597096 Ga0070709_105970962 103
28 3300005435 Ga0070714_100195359 Ga0070714_1001953592 103
29 3300005436 Ga0070713_100048884 Ga0070713_1000488842 103
30 3300005436 Ga0070713_100768194 Ga0070713_1007681941 103
31 3300005437 Ga0070710_10011232 Ga0070710_100112321 103
32 3300005438 Ga0070701_11238948 Ga0070701_112389481 103
33 3300005439 Ga0070711_100043659 Ga0070711_1000436592 103
34 3300005439 Ga0070711_100184597 Ga0070711_1001845972 103
35 3300005441 Ga0070700_100308589 Ga0070700_1003085892 103
36 3300005444 Ga0070694_100237143 Ga0070694_1002371432 103
37 3300005444 Ga0070694_101206820 Ga0070694_1012068202 103
38 3300005445 Ga0070708_100552344 Ga0070708_1005523442 103
39 3300005445 Ga0070708_101562941 Ga0070708_1015629411 103
40 3300005457 Ga0070662_100762742 Ga0070662_1007627422 103
41 3300005458 Ga0070681_10113327 Ga0070681_101133272 103
42 3300005458 Ga0070681_10155300 Ga0070681_101553002 103
43 3300005458 Ga0070681_10157874 Ga0070681_101578742 103
44 3300005458 Ga0070681_10316334 Ga0070681_103163342 103
45 3300005459 Ga0068867_100101346 Ga0068867_1001013464 103
46 3300005467 Ga0070706_100452480 Ga0070706_1004524801 103
47 3300005468 Ga0070707_101837658 Ga0070707_1018376581 103
48 3300005468 Ga0070707_102286392 Ga0070707_1022863922 103
49 3300005471 Ga0070698_100130073 Ga0070698_1001300732 103
50 3300005471 Ga0070698_100341027 Ga0070698_1003410272 103
51 3300005518 Ga0070699_100601749 Ga0070699_1006017492 103
52 3300005530 Ga0070679_100039986 Ga0070679_1000399862 103
53 3300005530 Ga0070679_100126247 Ga0070679_1001262472 103
54 3300005530 Ga0070679_101357104 Ga0070679_1013571041 103
55 3300005535 Ga0070684_100025126 Ga0070684_1000251262 103
56 3300005535 Ga0070684_100351305 Ga0070684_1003513052 103
57 3300005535 Ga0070684_100351797 Ga0070684_1003517972 103
58 3300005536 Ga0070697_100566293 Ga0070697_1005662932 103
59 3300005539 Ga0068853_100563314 Ga0068853_1005633142 103
60 3300005543 Ga0070672_100019796 Ga0070672_1000197962 103
61 3300005548 Ga0070665_100432484 Ga0070665_1004324842 103
62 3300005549 Ga0070704_100070324 Ga0070704_1000703242 103
63 3300005549 Ga0070704_101767485 Ga0070704_1017674852 103
64 3300005564 Ga0070664_100414574 Ga0070664_1004145742 103
65 3300005577 Ga0068857_100199740 Ga0068857_1001997402 103
66 3300005616 Ga0068852_100212429 Ga0068852_1002124292 103
67 3300005617 Ga0068859_100158376 Ga0068859_1001583763 103
68 3300005617 Ga0068859_100523459 Ga0068859_1005234591 103
69 3300005618 Ga0068864_101792664 Ga0068864_1017926642 103
70 3300005719 Ga0068861_100051345 Ga0068861_1000513452 103
71 3300005719 Ga0068861_101268819 Ga0068861_1012688191 103
72 3300005719 Ga0068861_101660738 Ga0068861_1016607382 103
73 3300005840 Ga0068870_10055211 Ga0068870_100552112 103
74 3300005841 Ga0068863_101874959 Ga0068863_1018749591 103
75 3300005843 Ga0068860_102173632 Ga0068860_1021736322 103
76 3300005844 Ga0068862_100018966 Ga0068862_1000189661 103
77 3300005844 Ga0068862_100048668 Ga0068862_1000486682 103
78 3300005844 Ga0068862_100762296 Ga0068862_1007622961 103
79 3300005844 Ga0068862_101014616 Ga0068862_1010146162 103
80 3300005844 Ga0068862_102205464 Ga0068862_1022054641 103
81 3300006028 Ga0070717_10061975 Ga0070717_100619752 103
82 3300006028 Ga0070717_10293449 Ga0070717_102934492 103
83 3300006058 Ga0075432_10491786 Ga0075432_104917862 103
84 3300006175 Ga0070712_100148559 Ga0070712_1001485592 103
85 3300006175 Ga0070712_100558606 Ga0070712_1005586062 103
86 3300006844 Ga0075428_100008863 Ga0075428_1000088633 103
87 3300006844 Ga0075428_100068705 Ga0075428_1000687052 103
88 3300006844 Ga0075428_100152759 Ga0075428_1001527592 103
89 3300006844 Ga0075428_100910165 Ga0075428_1009101652 103
90 3300006846 Ga0075430_100205677 Ga0075430_1002056772 103
91 3300006847 Ga0075431_100008852 Ga0075431_1000088529 103
92 3300006847 Ga0075431_100167563 Ga0075431_1001675632 103
93 3300006847 Ga0075431_100204858 Ga0075431_1002048583 103
94 3300006847 Ga0075431_100363338 Ga0075431_1003633382 103
95 3300006852 Ga0075433_10128812 Ga0075433_101288121 103
96 3300006871 Ga0075434_100018262 Ga0075434_1000182624 103
97 3300006871 Ga0075434_100288152 Ga0075434_1002881522 103
98 3300006871 Ga0075434_100453160 Ga0075434_1004531602 103
99 3300006871 Ga0075434_101431880 Ga0075434_1014318802 103
100 3300006871 Ga0075434_101465174 Ga0075434_1014651742 103
101 3300006880 Ga0075429_100061451 Ga0075429_1000614512 103
102 3300006880 Ga0075429_100082402 Ga0075429_1000824022 103
103 3300006880 Ga0075429_100350905 Ga0075429_1003509052 103
104 3300006880 Ga0075429_100617352 Ga0075429_1006173522 103
105 3300006881 Ga0068865_100077994 Ga0068865_1000779942 103
106 3300006914 Ga0075436_100079393 Ga0075436_1000793932 103
107 3300006931 Ga0097620_100158368 Ga0097620_1001583683 103
108 3300006931 Ga0097620_100523440 Ga0097620_1005234401 103
109 3300007076 Ga0075435_100029236 Ga0075435_1000292362 103
110 3300007076 Ga0075435_100284441 Ga0075435_1002844411 103
111 3300009094 Ga0111539_10005356 Ga0111539_100053563 103
112 3300009094 Ga0111539_10008461 Ga0111539_100084619 103
113 3300009094 Ga0111539_10048429 Ga0111539_100484294 103
114 3300009094 Ga0111539_10071240 Ga0111539_100712402 103
115 3300009094 Ga0111539_10201886 Ga0111539_102018862 103
116 3300009098 Ga0105245_10857998 Ga0105245_108579982 103
117 3300009147 Ga0114129_10008837 Ga0114129_100088373 103
118 3300009147 Ga0114129_10024621 Ga0114129_100246218 103
119 3300009147 Ga0114129_10443507 Ga0114129_104435072 103
120 3300009147 Ga0114129_11073951 Ga0114129_110739512 103
121 3300009148 Ga0105243_10074625 Ga0105243_100746252 103
122 3300009174 Ga0105241_10581627 Ga0105241_105816271 103
123 3300009174 Ga0105241_11084309 Ga0105241_110843092 103
124 3300009177 Ga0105248_10136698 Ga0105248_101366981 103
125 3300009545 Ga0105237_10457816 Ga0105237_104578162 103
126 3300009551 Ga0105238_10021908 Ga0105238_100219084 103
127 3300009551 Ga0105238_10087199 Ga0105238_100871992 103
128 3300009553 Ga0105249_10004049 Ga0105249_100040495 103
129 3300009553 Ga0105249_10011352 Ga0105249_100113526 103
130 3300009553 Ga0105249_10290252 Ga0105249_102902522 103
131 3300009553 Ga0105249_11743076 Ga0105249_117430762 103
132 3300010375 Ga0105239_10704586 Ga0105239_107045862 103
133 3300011119 Ga0105246_11138110 Ga0105246_111381102 103
134 3300013102 Ga0157371_10136263 Ga0157371_101362632 103
135 3300013306 Ga0163162_11369630 Ga0163162_113696302 103
136 3300013306 Ga0163162_12437799 Ga0163162_124377992 103
137 3300013307 Ga0157372_10010954 Ga0157372_1001095413 103
138 3300013307 Ga0157372_10019552 Ga0157372_100195527 103
139 3300013307 Ga0157372_10660699 Ga0157372_106606991 103
140 3300013308 Ga0157375_10857126 Ga0157375_108571261 103
141 3300014325 Ga0163163_10000030 Ga0163163_1000003042 103
142 3300014326 Ga0157380_10078714 Ga0157380_100787143 103
143 3300014326 Ga0157380_10198793 Ga0157380_101987933 103
144 3300014326 Ga0157380_10769619 Ga0157380_107696191 103
145 3300014745 Ga0157377_10114049 Ga0157377_101140492 103
146 3300014745 Ga0157377_10297540 Ga0157377_102975402 103
147 3300014745 Ga0157377_10912321 Ga0157377_109123211 103
148 3300014969 Ga0157376_10185656 Ga0157376_101856562 103
149 3300015262 Ga0182007_10046524 Ga0182007_100465241 103
150 3300017792 Ga0163161_11555516 Ga0163161_115555162 103
151 3300021388 Ga0213875_10003304 Ga0213875_100033048 103
152 3300025315 Ga0207697_10246358 Ga0207697_102463582 103
153 3300025893 Ga0207682_10039988 Ga0207682_100399882 103
154 3300025898 Ga0207692_10009464 Ga0207692_100094641 103
155 3300025901 Ga0207688_10084929 Ga0207688_100849291 103
156 3300025906 Ga0207699_10157079 Ga0207699_101570792 103
157 3300025906 Ga0207699_10220540 Ga0207699_102205402 103
158 3300025906 Ga0207699_10313497 Ga0207699_103134972 103
159 3300025907 Ga0207645_10812404 Ga0207645_108124041 103
160 3300025908 Ga0207643_10094344 Ga0207643_100943441 103
161 3300025909 Ga0207705_10159411 Ga0207705_101594112 103
162 3300025910 Ga0207684_10264439 Ga0207684_102644392 103
163 3300025911 Ga0207654_10359335 Ga0207654_103593352 103
164 3300025912 Ga0207707_10026191 Ga0207707_100261912 103
165 3300025912 Ga0207707_10153771 Ga0207707_101537712 103
166 3300025914 Ga0207671_10966235 Ga0207671_109662352 103
167 3300025915 Ga0207693_10017898 Ga0207693_100178982 103
168 3300025915 Ga0207693_11352947 Ga0207693_113529471 103
169 3300025916 Ga0207663_10761933 Ga0207663_107619331 103
170 3300025917 Ga0207660_10064037 Ga0207660_100640372 103
171 3300025917 Ga0207660_11280192 Ga0207660_112801921 103
172 3300025917 Ga0207660_11515515 Ga0207660_115155151 103
173 3300025918 Ga0207662_10007501 Ga0207662_100075014 103
174 3300025919 Ga0207657_10033664 Ga0207657_100336642 103
175 3300025920 Ga0207649_10095539 Ga0207649_100955391 103
176 3300025920 Ga0207649_11095522 Ga0207649_110955222 103
177 3300025921 Ga0207652_10055707 Ga0207652_100557072 103
178 3300025921 Ga0207652_10106508 Ga0207652_101065082 103
179 3300025921 Ga0207652_10128799 Ga0207652_101287993 103
180 3300025921 Ga0207652_10807689 Ga0207652_108076891 103
181 3300025923 Ga0207681_10022208 Ga0207681_100222082 103
182 3300025923 Ga0207681_10069261 Ga0207681_100692613 103
183 3300025923 Ga0207681_10169484 Ga0207681_101694842 103
184 3300025924 Ga0207694_10049390 Ga0207694_100493901 103
185 3300025924 Ga0207694_10096109 Ga0207694_100961092 103
186 3300025925 Ga0207650_10678260 Ga0207650_106782602 103
187 3300025926 Ga0207659_10120353 Ga0207659_101203531 103
188 3300025926 Ga0207659_10626417 Ga0207659_106264172 103
189 3300025926 Ga0207659_11053770 Ga0207659_110537701 103
190 3300025928 Ga0207700_10059694 Ga0207700_100596942 103
191 3300025928 Ga0207700_10088265 Ga0207700_100882651 103
192 3300025928 Ga0207700_11255752 Ga0207700_112557522 103
193 3300025929 Ga0207664_11493590 Ga0207664_114935901 103
194 3300025932 Ga0207690_10145988 Ga0207690_101459882 103
195 3300025933 Ga0207706_10142698 Ga0207706_101426982 103
196 3300025933 Ga0207706_11373648 Ga0207706_113736481 103
197 3300025935 Ga0207709_10232061 Ga0207709_102320612 103
198 3300025938 Ga0207704_10034903 Ga0207704_100349032 103
199 3300025938 Ga0207704_10232287 Ga0207704_102322871 103
200 3300025940 Ga0207691_10256275 Ga0207691_102562752 103
201 3300025942 Ga0207689_11703778 Ga0207689_117037781 103
202 3300025944 Ga0207661_10128959 Ga0207661_101289592 103
203 3300025945 Ga0207679_10154510 Ga0207679_101545102 103
204 3300025960 Ga0207651_10015089 Ga0207651_100150892 103
205 3300025961 Ga0207712_10010343 Ga0207712_100103434 103
206 3300025961 Ga0207712_10014842 Ga0207712_100148421 103
207 3300025972 Ga0207668_10143982 Ga0207668_101439822 103
208 3300025972 Ga0207668_11546550 Ga0207668_115465501 103
209 3300025986 Ga0207658_11173688 Ga0207658_111736881 103
210 3300026041 Ga0207639_10517793 Ga0207639_105177931 103
211 3300026041 Ga0207639_11094827 Ga0207639_110948272 103
212 3300026075 Ga0207708_10061937 Ga0207708_100619372 103
213 3300026075 Ga0207708_10577460 Ga0207708_105774601 103
214 3300026088 Ga0207641_11653961 Ga0207641_116539612 103
215 3300026089 Ga0207648_10069251 Ga0207648_100692512 103
216 3300026095 Ga0207676_11460768 Ga0207676_114607681 103
217 3300026116 Ga0207674_10124874 Ga0207674_101248742 103
218 3300026118 Ga0207675_100078714 Ga0207675_1000787142 103
219 3300026118 Ga0207675_100439882 Ga0207675_1004398822 103
220 3300026118 Ga0207675_100460641 Ga0207675_1004606412 103
221 3300026142 Ga0207698_10059379 Ga0207698_100593792 103
222 3300027552 Ga0209982_1037195 Ga0209982_10371952 103
223 3300027907 Ga0207428_10014862 Ga0207428_100148622 103
224 3300027907 Ga0207428_10197706 Ga0207428_101977062 103
225 3300028379 Ga0268266_10615093 Ga0268266_106150932 103
226 3300028380 Ga0268265_10031042 Ga0268265_100310422 103
227 3300028380 Ga0268265_10122756 Ga0268265_101227561 103
228 3300028380 Ga0268265_11126912 Ga0268265_111269122 103
229 3300028380 Ga0268265_12022158 Ga0268265_120221582 103
230 3300028381 Ga0268264_12506090 Ga0268264_125060902 103
231 3300031247 Ga0265340_10263035 Ga0265340_102630352 103
232 3300031548 Ga0307408_100595784 Ga0307408_1005957841 103
233 3300031548 Ga0307408_100635733 Ga0307408_1006357332 103
234 3300031548 Ga0307408_102523782 Ga0307408_1025237821 103
235 3300031727 Ga0316576_10006305 Ga0316576_100063055 103
236 3300031728 Ga0316578_10185201 Ga0316578_101852012 103
237 3300031731 Ga0307405_10044191 Ga0307405_100441912 103
238 3300031731 Ga0307405_10150268 Ga0307405_101502682 103
239 3300031731 Ga0307405_12002520 Ga0307405_120025201 103
240 3300031824 Ga0307413_10013834 Ga0307413_100138342 103
241 3300031824 Ga0307413_10311791 Ga0307413_103117912 103
242 3300031852 Ga0307410_10020109 Ga0307410_100201092 103
243 3300031852 Ga0307410_10047437 Ga0307410_100474372 103
244 3300031901 Ga0307406_11305764 Ga0307406_113057641 103
245 3300031903 Ga0307407_10114010 Ga0307407_101140102 103
246 3300031911 Ga0307412_10018931 Ga0307412_100189313 103
247 3300031911 Ga0307412_10097900 Ga0307412_100979002 103
248 3300031911 Ga0307412_10249305 Ga0307412_102493051 103
249 3300031911 Ga0307412_10379663 Ga0307412_103796632 103
250 3300031995 Ga0307409_100125475 Ga0307409_1001254752 103
251 3300032002 Ga0307416_100027099 Ga0307416_1000270991 103
252 3300032005 Ga0307411_10059233 Ga0307411_100592333 103
253 3300032005 Ga0307411_10309116 Ga0307411_103091161 103
254 3300032126 Ga0307415_100007834 Ga0307415_1000078346 103
255 3300032126 Ga0307415_100085204 Ga0307415_1000852043 103
256 3300032126 Ga0307415_100094343 Ga0307415_1000943432 103
257 3300032126 Ga0307415_100483221 Ga0307415_1004832211 103
258 3300032126 Ga0307415_101101224 Ga0307415_1011012242 103
259 3300035083 Ga0373926_0060162 Ga0373926_0060162_545_886 103
260 3300035083 Ga0373926_0117866 Ga0373926_0117866_457_804 103
261 3300035086 Ga0373934_0028194 Ga0373934_0028194_1590_1967 103
262 3300035091 Ga0373951_0051492 Ga0373951_0051492_336_668 103
263 3300035111 Ga0373923_0162258 Ga0373923_0162258_595_936 103
264 3300035112 Ga0373932_0163031 Ga0373932_0163031_93_425 103
265 3300035113 Ga0373936_0205068 Ga0373936_0205068_195_536 103
266 3300035117 Ga0373953_0011146 Ga0373953_0011146_727_1068 103
267 3300035118 Ga0373954_0088481 Ga0373954_0088481_687_1055 103
268 3300035118 Ga0373954_0211444 Ga0373954_0211444_501_842 103
269 3300035119 Ga0373956_0081917 Ga0373956_0081917_424_810 103
270 3300035119 Ga0373956_0374700 Ga0373956_0374700_91_459 103
271 3300035119 Ga0373956_0387921 Ga0373956_0387921_38_415 103
272 3300035120 Ga0373957_0048067 Ga0373957_0048067_499_840 103
273 3300035120 Ga0373957_0086980 Ga0373957_0086980_585_962 103
274 3300035170 Ga0373943_0024273 Ga0373943_0024273_314_661 103
275 3300035170 Ga0373943_0131977 Ga0373943_0131977_321_662 103
276 3300035171 Ga0373946_0154460 Ga0373946_0154460_261_608 103
277 3300035172 Ga0373955_0016600 Ga0373955_0016600_616_957 103
278 3300035172 Ga0373955_0042663 Ga0373955_0042663_1196_1573 103
279 3300035172 Ga0373955_0505699 Ga0373955_0505699_310_678 103
280 3300035172 Ga0373955_0545325 Ga0373955_0545325_286_633 103
281 3300035410 Ga0373924_0071745 Ga0373924_0071745_709_1095 103
282 3300035410 Ga0373924_0202110 Ga0373924_0202110_261_629 103
283 3300035410 Ga0373924_0290559 Ga0373924_0290559_268_645 103
284 3300035691 Ga0373931_0574100 Ga0373931_0574100_100_432 103
285 3300035691 Ga0373931_1075809 Ga0373931_1075809_85_414 103
286 3300035692 Ga0373935_0019625 Ga0373935_0019625_2866_3207 103
287 3300035692 Ga0373935_0289916 Ga0373935_0289916_501_848 103
288 3300035695 Ga0373927_0027429 Ga0373927_0027429_2788_3129 103
289 3300035695 Ga0373927_0071281 Ga0373927_0071281_344_691 103
290 3300035695 Ga0373927_0202184 Ga0373927_0202184_46_414 103
291 3300035724 Ga0373933_0053620 Ga0373933_0053620_232_618 103
292 3300035724 Ga0373933_0153332 Ga0373933_0153332_881_1249 103
293 3300035725 Ga0373947_0073202 Ga0373947_0073202_248_589 103
294 3300035725 Ga0373947_0256740 Ga0373947_0256740_50_418 103
295 3300036401 Ga0373937_0003750 Ga0373937_0003750_1495_1872 103
296 3300036401 Ga0373937_0055140 Ga0373937_0055140_1072_1458 103
297 3300036401 Ga0373937_0154546 Ga0373937_0154546_622_990 103
298 3300036401 Ga0373937_1461325 Ga0373937_1461325_148_495 103
299 3300036401 Ga0373937_2079691 Ga0373937_2079691_61_399 103
300 3300036712 Ga0316584_0045002 Ga0316584_0045002_1535_1876 103
301 3300037068 Ga0373925_0004615 Ga0373925_0004615_8161_8502 103
302 3300037068 Ga0373925_0134977 Ga0373925_0134977_456_803 103
303 3300037418 Ga0395900_0039603 Ga0395900_0039603_1968_2327 103
304 3300037471 Ga0395905_0174044 Ga0395905_0174044_72_416 103
305 3300037853 Ga0436364_0380945 Ga0436364_0380945_617_949 103
306 3300037853 Ga0436364_0864787 Ga0436364_0864787_5876_6205 103
307 3300039437 Ga0436365_0389660 Ga0436365_0389660_5655_5999 103
308 3300041408 Ga0439453_0028445 Ga0439453_0028445_690_1028 103
309 3300041408 Ga0439453_0181606 Ga0439453_0181606_124_453 103
310 3300041410 Ga0439461_0198115 Ga0439461_0198115_44_373 103
311 3300041486 Ga0451807_0764093 Ga0451807_0764093_140_475 103
312 3300041997 Ga0439431_0165447 Ga0439431_0165447_157_486 103
313 3300042003 Ga0439443_033627 Ga0439443_033627_174_503 103
314 3300042005 Ga0439448_0138422 Ga0439448_0138422_474_806 103
315 3300042013 Ga0439456_079924 Ga0439456_079924_54_392 103
316 3300042121 Ga0450919_015336 Ga0450919_015336_525_854 103
317 3300042134 Ga0450898_012561 Ga0450898_012561_959_1312 103
318 3300042436 Ga0439435_0012197 Ga0439435_0012197_839_1177 103
319 3300042436 Ga0439435_0127013 Ga0439435_0127013_134_463 103
320 3300042436 Ga0439435_0311994 Ga0439435_0311994_172_501 103
321 3300042532 Ga0450893_0039032 Ga0450893_0039032_492_821 103
322 3300044842 Ga0466957_0845639 Ga0466957_0845639_63_404 103
323 3300045051 Ga0451576_0050509 Ga0451576_0050509_3997_4326 103
324 3300045051 Ga0451576_0755784 Ga0451576_0755784_286_639 103
325 3300046454 Ga0495592_0033456 Ga0495592_0033456_2610_2951 103
326 3300046454 Ga0495592_0346357 Ga0495592_0346357_556_933 103
327 3300046454 Ga0495592_0624555 Ga0495592_0624555_179_514 103
328 3300046459 Ga0495629_0010526 Ga0495629_0010526_2186_2527 103
329 3300046459 Ga0495629_0014541 Ga0495629_0014541_5026_5373 103
330 3300046459 Ga0495629_0183892 Ga0495629_0183892_514_900 103
331 3300046462 Ga0495651_0073785 Ga0495651_0073785_1898_2239 103
332 3300046462 Ga0495651_0097434 Ga0495651_0097434_1003_1380 103
333 3300046462 Ga0495651_0118725 Ga0495651_0118725_156_524 103
334 3300046463 Ga0495653_0175997 Ga0495653_0175997_422_808 103
335 3300046472 Ga0495580_0015956 Ga0495580_0015956_3694_4035 103
336 3300046472 Ga0495580_0067785 Ga0495580_0067785_2014_2346 103
337 3300046472 Ga0495580_0142069 Ga0495580_0142069_28_375 103
338 3300046473 Ga0495582_0006192 Ga0495582_0006192_1372_1713 103
339 3300046473 Ga0495582_0132629 Ga0495582_0132629_999_1328 103
340 3300046475 Ga0495639_0009872 Ga0495639_0009872_293_640 103
341 3300046475 Ga0495639_0325507 Ga0495639_0325507_123_509 103
342 3300046477 Ga0495664_0548819 Ga0495664_0548819_41_370 103
343 3300046499 Ga0495594_0084182 Ga0495594_0084182_1096_1428 103
344 3300046511 Ga0495608_0137543 Ga0495608_0137543_646_987 103
345 3300046511 Ga0495608_0388413 Ga0495608_0388413_178_546 103
346 3300046514 Ga0495618_0503076 Ga0495618_0503076_165_506 103
347 3300046515 Ga0495620_0354705 Ga0495620_0354705_117_467 103
348 3300046516 Ga0495628_0065300 Ga0495628_0065300_461_847 103
349 3300046516 Ga0495628_0259282 Ga0495628_0259282_312_689 103
350 3300046517 Ga0495630_0012952 Ga0495630_0012952_5120_5461 103
351 3300046517 Ga0495630_0247338 Ga0495630_0247338_439_780 103
352 3300046517 Ga0495630_0266931 Ga0495630_0266931_549_896 103
353 3300046517 Ga0495630_0686239 Ga0495630_0686239_222_569 103
354 3300046523 Ga0495644_0442140 Ga0495644_0442140_105_455 103
355 3300046529 Ga0495652_0054080 Ga0495652_0054080_1737_2114 103
356 3300046529 Ga0495652_0231509 Ga0495652_0231509_67_453 103
357 3300046531 Ga0495665_0054809 Ga0495665_0054809_1254_1601 103
358 3300046531 Ga0495665_0221230 Ga0495665_0221230_391_759 103
359 3300046535 Ga0495586_0202875 Ga0495586_0202875_456_803 103
360 3300046535 Ga0495586_0322415 Ga0495586_0322415_150_491 103
361 3300046536 Ga0495587_0023721 Ga0495587_0023721_2998_3375 103
362 3300046536 Ga0495587_0033301 Ga0495587_0033301_553_939 103
363 3300046537 Ga0495598_0111578 Ga0495598_0111578_555_896 103
364 3300046539 Ga0495621_0014471 Ga0495621_0014471_368_718 103
365 3300046543 Ga0495645_0041681 Ga0495645_0041681_2060_2389 103
366 3300046557 Ga0495622_0473737 Ga0495622_0473737_135_476 103
367 3300046559 Ga0495667_0043306 Ga0495667_0043306_623_1009 103
368 3300046559 Ga0495667_0082522 Ga0495667_0082522_163_540 103
369 3300046559 Ga0495667_0156825 Ga0495667_0156825_210_557 103
370 3300046663 Ga0495635_0007021 Ga0495635_0007021_6929_7270 103
371 3300046663 Ga0495635_0167840 Ga0495635_0167840_47_388 103
372 3300046663 Ga0495635_0358076 Ga0495635_0358076_440_808 103
373 3300046663 Ga0495635_0466969 Ga0495635_0466969_235_582 103
374 3300046663 Ga0495635_0675453 Ga0495635_0675453_216_563 103
375 3300046663 Ga0495635_1092610 Ga0495635_1092610_31_360 103
376 3300046674 Ga0495588_0002561 Ga0495588_0002561_4797_5138 103
377 3300046674 Ga0495588_0052421 Ga0495588_0052421_885_1232 103
378 3300046675 Ga0495657_0058919 Ga0495657_0058919_637_978 103
379 3300046678 Ga0495599_0034424 Ga0495599_0034424_724_1110 103
380 3300046678 Ga0495599_0054700 Ga0495599_0054700_2129_2476 103
381 3300046679 Ga0495623_0012316 Ga0495623_0012316_1874_2260 103
382 3300046679 Ga0495623_0258481 Ga0495623_0258481_215_592 103
383 3300046679 Ga0495623_0730858 Ga0495623_0730858_119_466 103
384 3300046680 Ga0495646_0075225 Ga0495646_0075225_307_648 103
385 3300046683 Ga0495658_0001372 Ga0495658_0001372_5298_5639 103
386 3300046683 Ga0495658_0009502 Ga0495658_0009502_216_545 103
387 3300046689 Ga0495613_0011253 Ga0495613_0011253_325_666 103
388 3300046689 Ga0495613_0281710 Ga0495613_0281710_47_394 103
389 3300046689 Ga0495613_0625876 Ga0495613_0625876_322_651 103
390 3300046809 Ga0495600_0022969 Ga0495600_0022969_2355_2741 103
391 3300046809 Ga0495600_0130752 Ga0495600_0130752_1053_1400 103
392 3300046809 Ga0495600_0513807 Ga0495600_0513807_79_408 103
393 3300047315 Ga0495581_0009525 Ga0495581_0009525_248_589 103
394 3300047317 Ga0495604_0008532 Ga0495604_0008532_360_746 103
395 3300047319 Ga0495674_0070612 Ga0495674_0070612_460_846 103
396 3300047319 Ga0495674_0207255 Ga0495674_0207255_167_535 103
397 3300047444 Ga0495675_0007268 Ga0495675_0007268_748_1125 103
398 3300047444 Ga0495675_0144996 Ga0495675_0144996_652_981 103
399 3300047471 Ga0495684_0009853 Ga0495684_0009853_6048_6416 103
400 3300047471 Ga0495684_0050200 Ga0495684_0050200_1872_2258 103
401 3300047471 Ga0495684_0297734 Ga0495684_0297734_798_1145 103
402 3300047471 Ga0495684_0381205 Ga0495684_0381205_360_725 103
403 3300047471 Ga0495684_0714001 Ga0495684_0714001_85_432 103
404 3300047673 Ga0495593_0000060 Ga0495593_0000060_33573_33914 103
405 3300047673 Ga0495593_0059614 Ga0495593_0059614_285_632 103
406 3300048088 Ga0495602_0711334 Ga0495602_0711334_271_639 103
407 3300048089 Ga0495614_0441410 Ga0495614_0441410_244_591 103
408 3300048904 Ga0496101_0100496 Ga0496101_0100496_1471_1815 103
409 3300048907 Ga0496104_0633502 Ga0496104_0633502_285_629 103
410 3300048909 Ga0496106_0388699 Ga0496106_0388699_498_842 103
411 3300048910 Ga0496107_0105777 Ga0496107_0105777_548_892 103
412 3300048917 Ga0496114_0109722 Ga0496114_0109722_399_743 103
413 3300048918 Ga0496115_0003763 Ga0496115_0003763_2284_2628 103
414 3300049523 Ga0501300_088233 Ga0501300_088233_161_499 103
415 3300049569 Ga0501032_0014708 Ga0501032_0014708_1198_1527 103
416 3300049569 Ga0501032_0123567 Ga0501032_0123567_1183_1512 103
417 3300049570 Ga0501033_0225628 Ga0501033_0225628_745_1074 103
418 3300049571 Ga0501034_0018990 Ga0501034_0018990_5150_5479 103
419 3300049571 Ga0501034_0046437 Ga0501034_0046437_3714_4043 103
420 3300049571 Ga0501034_0442343 Ga0501034_0442343_833_1162 103
421 3300049571 Ga0501034_0657209 Ga0501034_0657209_10_339 103
422 3300049571 Ga0501034_1410936 Ga0501034_1410936_200_529 103
423 3300049572 Ga0501036_0026308 Ga0501036_0026308_3984_4313 103
424 3300049572 Ga0501036_0090790 Ga0501036_0090790_585_914 103
425 3300049573 Ga0501037_0018603 Ga0501037_0018603_3605_3934 103
426 3300049573 Ga0501037_0175610 Ga0501037_0175610_769_1098 103
427 3300049573 Ga0501037_0279573 Ga0501037_0279573_613_942 103
428 3300049574 Ga0501038_0068325 Ga0501038_0068325_2624_2953 103
429 3300049574 Ga0501038_0069369 Ga0501038_0069369_192_521 103
430 3300049575 Ga0501039_0015539 Ga0501039_0015539_1338_1667 103
431 3300049579 Ga0501043_0008735 Ga0501043_0008735_7469_7798 103
432 3300049579 Ga0501043_0032762 Ga0501043_0032762_963_1292 103
433 3300049579 Ga0501043_0073963 Ga0501043_0073963_1446_1775 103
434 3300049580 Ga0501046_0060607 Ga0501046_0060607_1139_1468 103
435 3300049580 Ga0501046_0080200 Ga0501046_0080200_1998_2327 103
436 3300049580 Ga0501046_0129772 Ga0501046_0129772_1294_1623 103
437 3300049581 Ga0501047_0000816 Ga0501047_0000816_13982_14311 103
438 3300049581 Ga0501047_0063049 Ga0501047_0063049_598_927 103
439 3300049581 Ga0501047_0084766 Ga0501047_0084766_2677_3006 103
440 3300049581 Ga0501047_0150617 Ga0501047_0150617_1304_1633 103
441 3300049582 Ga0501048_0578298 Ga0501048_0578298_89_418 103
442 3300049583 Ga0501067_0130560 Ga0501067_0130560_766_1095 103
443 3300049584 Ga0501068_0048079 Ga0501068_0048079_1753_2082 103
444 3300049584 Ga0501068_0067811 Ga0501068_0067811_1594_1923 103
445 3300049585 Ga0501069_0032378 Ga0501069_0032378_2406_2735 103
446 3300049585 Ga0501069_0179444 Ga0501069_0179444_720_1052 103
447 3300049586 Ga0501070_0362274 Ga0501070_0362274_91_420 103
448 3300049586 Ga0501070_0415941 Ga0501070_0415941_501_830 103
449 3300049587 Ga0501071_0870807 Ga0501071_0870807_132_476 103
450 3300049588 Ga0501072_0020667 Ga0501072_0020667_1442_1771 103
451 3300049588 Ga0501072_1065991 Ga0501072_1065991_249_578 103
452 3300049588 Ga0501072_1449725 Ga0501072_1449725_60_389 103
453 3300049589 Ga0501073_0012265 Ga0501073_0012265_598_927 103
454 3300049589 Ga0501073_0027190 Ga0501073_0027190_3731_4060 103
455 3300049589 Ga0501073_0349766 Ga0501073_0349766_269_598 103
456 3300049589 Ga0501073_0507441 Ga0501073_0507441_120_464 103
457 3300049590 Ga0501074_0521682 Ga0501074_0521682_169_498 103
458 3300049590 Ga0501074_0736735 Ga0501074_0736735_235_564 103
459 3300049592 Ga0501076_0730809 Ga0501076_0730809_81_410 103
460 3300049593 Ga0501077_0029288 Ga0501077_0029288_2478_2822 103
461 3300049593 Ga0501077_0445081 Ga0501077_0445081_373_702 103
462 3300049593 Ga0501077_0766394 Ga0501077_0766394_185_514 103
463 3300049661 Ga0501217_049395 Ga0501217_049395_143_475 103
464 3300049668 Ga0501233_107889 Ga0501233_107889_251_595 103
465 3300049669 Ga0501235_073251 Ga0501235_073251_431_763 103
466 3300049675 Ga0501243_147535 Ga0501243_147535_109_450 103
467 3300049741 Ga0501079_0041100 Ga0501079_0041100_1804_2133 103
468 3300049741 Ga0501079_0204315 Ga0501079_0204315_1190_1519 103
469 3300049741 Ga0501079_0957302 Ga0501079_0957302_77_412 103
470 3300049742 Ga0501080_0014268 Ga0501080_0014268_1754_2083 103
471 3300049743 Ga0501081_1546564 Ga0501081_1546564_49_393 103
472 3300049744 Ga0501083_0006188 Ga0501083_0006188_5443_5772 103
473 3300049744 Ga0501083_0447683 Ga0501083_0447683_243_572 103
474 3300049744 Ga0501083_1075290 Ga0501083_1075290_11_400 103
475 3300049767 Ga0501270_083742 Ga0501270_083742_201_542 103
476 3300049769 Ga0501272_073941 Ga0501272_073941_107_439 103
477 3300049822 Ga0501035_0050489 Ga0501035_0050489_617_946 103
478 3300049822 Ga0501035_0380168 Ga0501035_0380168_175_504 103
479 3300049823 Ga0501044_0080266 Ga0501044_0080266_2227_2556 103
480 3300049823 Ga0501044_0088415 Ga0501044_0088415_1134_1463 103
481 3300050507 nmdc:mga05p37_114056_c1 nmdc:mga05p37_114056_c1_1557_1889 103
482 3300050507 nmdc:mga05p37_203761_c1 nmdc:mga05p37_203761_c1_1180_1509 103
483 3300050507 nmdc:mga05p37_31256_c1 nmdc:mga05p37_31256_c1_3267_3596 103
484 3300050508 nmdc:mga09592_1067165_c1 nmdc:mga09592_1067165_c1_179_511 103
485 3300050508 nmdc:mga09592_257056_c1 nmdc:mga09592_257056_c1_332_664 103
486 3300050508 nmdc:mga09592_320546_c1 nmdc:mga09592_320546_c1_243_572 103
487 3300050508 nmdc:mga09592_592555_c1 nmdc:mga09592_592555_c1_384_725 103
488 3300050508 nmdc:mga09592_729355_c1 nmdc:mga09592_729355_c1_390_719 103
489 3300050510 nmdc:mga06r32_1963096_c1 nmdc:mga06r32_1963096_c1_150_494 103
490 3300050510 nmdc:mga06r32_220700_c1 nmdc:mga06r32_220700_c1_958_1290 103
491 3300050510 nmdc:mga06r32_229471_c1 nmdc:mga06r32_229471_c1_624_953 103
492 3300050510 nmdc:mga06r32_853520_c1 nmdc:mga06r32_853520_c1_238_576 103
493 3300050510 nmdc:mga06r32_930564_c1 nmdc:mga06r32_930564_c1_419_751 103
494 3300050510 nmdc:mga06r32_9351_c1 nmdc:mga06r32_9351_c1_7776_8108 103
495 3300050511 nmdc:mga08y16_278955_c1 nmdc:mga08y16_278955_c1_776_1132 103
496 3300050511 nmdc:mga08y16_28966_c1 nmdc:mga08y16_28966_c1_1300_1644 103
497 3300050511 nmdc:mga08y16_409051_c1 nmdc:mga08y16_409051_c1_98_430 103
498 3300050511 nmdc:mga08y16_6063_c1 nmdc:mga08y16_6063_c1_4945_5274 103
499 3300050512 nmdc:mga0n895_1148354_c1 nmdc:mga0n895_1148354_c1_381_710 103
500 3300050512 nmdc:mga0n895_1269426_c1 nmdc:mga0n895_1269426_c1_117_449 103
501 3300050512 nmdc:mga0n895_293895_c1 nmdc:mga0n895_293895_c1_868_1200 103
502 3300050512 nmdc:mga0n895_5211_c1 nmdc:mga0n895_5211_c1_1530_1862 103
503 3300050513 nmdc:mga0rr50_1108083_c1 nmdc:mga0rr50_1108083_c1_91_435 103
504 3300050513 nmdc:mga0rr50_409923_c1 nmdc:mga0rr50_409923_c1_678_1010 103
505 3300050514 nmdc:mga08x19_184093_c1 nmdc:mga08x19_184093_c1_757_1107 103
506 3300050515 nmdc:mga0a205_49087_c1 nmdc:mga0a205_49087_c1_3683_4015 103
507 3300050515 nmdc:mga0a205_97737_c1 nmdc:mga0a205_97737_c1_47_379 103
508 3300053077 Ga0495601_0093087 Ga0495601_0093087_1082_1411 103
509 3300053078 Ga0495612_0012624 Ga0495612_0012624_2593_2934 103
510 3300053084 Ga0495595_0029730 Ga0495595_0029730_493_879 103
511 3300054114 Ga0501084_0001977 Ga0501084_0001977_10096_10425 103
512 3300054114 Ga0501084_0077611 Ga0501084_0077611_1174_1503 103
513 3300054114 Ga0501084_1045634 Ga0501084_1045634_196_525 103
514 3300060353 Ga0501082_0024532 Ga0501082_0024532_4370_4699 103
515 3300060353 Ga0501082_0043249 Ga0501082_0043249_12_341 103
516 3300061719 Ga0466962_0647883 Ga0466962_0647883_157_498 103
517 3300061734 Ga0530510_0565371 Ga0530510_0565371_198_527 103
518 3300005290 Ga0065712_10215359 Ga0065712_102153591 108
519 3300005340 Ga0070689_100089760 Ga0070689_1000897601 108
520 3300005354 Ga0070675_100345315 Ga0070675_1003453152 108
521 3300005365 Ga0070688_100194217 Ga0070688_1001942172 108
522 3300005365 Ga0070688_100652293 Ga0070688_1006522932 108
523 3300009553 Ga0105249_10305682 Ga0105249_103056822 108
524 3300014326 Ga0157380_10907252 Ga0157380_109072521 108
525 3300027907 Ga0207428_10208793 Ga0207428_102087932 108

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

32

106

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9473 9 106
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9372 8 103
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9312 8 104
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9284 8 103
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9189 4 107
ID Description Score Start End Superfamily
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9318 8 104 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9284 8 103 1.10.10.10
af_I6X7F9_1_101_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9174 8 106 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9 11 89 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8901 11 105 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2W4S967-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.9973 8 105
AF-A0A2E8E0J4-F1-model_v4 PadR family transcriptional regulator 0.9895 5 108
AF-C1F744-F1-model_v4 Transcriptional regulator, PadR family 0.9892 7 107
AF-W0RSI0-F1-model_v4 Transcriptional regulator, PadR-family 0.9875 8 107
AF-A0A2V7RSL4-F1-model_v4 PadR family transcriptional regulator 0.9868 5 108

Feature Viewer

pLDDT pTM Quality
87.24 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map