F459263
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 525 | 354 | 467 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300009545|Ga0105237_10007199|Ga0105237_100071992 |
| Length | 171 |
| Sequence | LYFLILIHFSGLALSATLGITKNIKKMKARILIKKADPEAYKALGVLSNYIANSSLSKTHQELIKIRASQINGCAYCIDMHTKDARKAGETEQRIYALNAWRETPFFTEEERAILALTEEVTLIQNHVSDKTYEEAERILGEKYLAQVIMAIINISAWNRIGIATGMQPGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513020052 | Flavobacterium sp. CF136 | Isolate | Rhizosphere |
| 3 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 4 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 5 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 6 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 7 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 8 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 9 | 2643221600 | Flavobacterium sp. Root186 | Isolate | Unclassified |
| 10 | 2643221667 | Flavobacterium sp. Root420 | Isolate | Unclassified |
| 11 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 12 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 13 | 2738541279 | Flavobacterium sp. GV069 | Isolate | Unclassified |
| 14 | 2738541285 | Flavobacterium sp. GV030 | Isolate | Unclassified |
| 15 | 2738543007 | Flavobacterium sp. GV063 | Isolate | Unclassified |
| 16 | 2739367857 | Flavobacterium sp. GV029 | Isolate | Unclassified |
| 17 | 2739367858 | Flavobacterium sp. GV028 | Isolate | Unclassified |
| 18 | 2739367874 | Chryseobacterium sp. T16E-39 | Isolate | Unclassified |
| 19 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 20 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 21 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 22 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 23 | 2802428842 | Flavobacterium sp. S87F.05.LMB.W.Kidney.N | Isolate | Unclassified |
| 24 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 25 | 2816332295 | Bacillus paralicheniformis MDJK30 | Isolate | Rhizosphere |
| 26 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 27 | 2840677318 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 28 | 2857618242 | Flavobacterium sp. R-74482 | Isolate | Unclassified |
| 29 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 30 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 31 | 2896085136 | Chitinophaga alhagiae T22 | Isolate | Unclassified |
| 32 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 33 | 2919191525 | Flavobacterium sp. 2755 | Isolate | Rhizosphere |
| 34 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 35 | 2919683626 | Flavobacterium piscis 4129 | Isolate | Unclassified |
| 36 | 2929150217 | Flavobacterium sp. R-74510 Hybrid assembly | Isolate | Unclassified |
| 37 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 38 | 2929921140 | Chitinophaga sp. R-72609 Hybrid assembly | Isolate | Unclassified |
| 39 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 40 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 41 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 42 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 43 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 44 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 45 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 46 | 2977268062 | Flavobacterium sp. SORGH_AS 622 | Isolate | Unclassified |
| 47 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 48 | 3006858327 | Bacillus paralicheniformis SUBG0010 | Isolate | Unclassified |
| 49 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 50 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 51 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 52 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 53 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 54 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 55 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 56 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 57 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 58 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 59 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 60 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 61 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 62 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 64 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 65 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 66 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 67 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 68 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 70 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 71 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 77 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 78 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 79 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 81 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 87 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 88 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 89 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 90 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 97 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 163 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 164 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 166 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 167 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 168 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 169 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 173 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 174 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 175 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 176 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 177 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 178 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 179 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 180 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 181 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 182 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 183 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 184 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 185 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 186 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 193 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 194 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 195 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 196 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 197 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 198 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 199 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 200 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 201 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 202 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 203 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 204 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 205 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 206 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 207 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 208 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 209 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 210 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 211 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 212 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 213 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 214 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 215 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 291 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 292 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 293 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 294 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 295 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 296 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 299 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 300 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 307 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 308 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 309 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 310 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 311 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 312 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 313 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 314 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 315 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 316 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 317 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 319 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 320 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 321 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 322 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 323 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 324 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 325 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 326 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 327 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 328 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 329 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 330 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 332 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 334 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 335 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 337 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 338 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 339 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 340 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 341 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 342 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 343 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 344 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 345 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 346 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 347 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 348 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 349 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 350 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 351 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 352 | 8054307821 | Flavobacterium soyae SCIV07 | Isolate | Rhizosphere |
| 353 | 8055419101 | Flavobacterium tyrosinilyticum KCTC 42726 | Isolate | Rhizosphere |
| 354 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.76 |
| Metatranscriptomes | 0.38 |
| Isolates | 10.86 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.86 |
| Nodule | 0.57 |
| Rhizoplane | 1.71 |
| Rhizosphere | 66.48 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3915940 | 2162886007 | Bacteria | 993 |
| 2 | JGI24740J21852_10002037 | 3300001979 | Bacteria | 9242 |
| 3 | JGI25162J39368_1000011 | 3300002737 | Bacteria | 379156 |
| 4 | JGI25154J39366_1000041 | 3300002738 | Bacteria | 144221 |
| 5 | JGI25157J39369_1003559 | 3300002741 | Bacteria | 3130 |
| 6 | JGI25159J45721_1014250 | 3300002987 | Bacteria | 1801 |
| 7 | JGI25151J46595_10006327 | 3300003187 | Bacteria | 5968 |
| 8 | JGI25151J46595_10008495 | 3300003187 | Bacteria | 4934 |
| 9 | JGI25153J46596_10003472 | 3300003215 | Bacteria | 8825 |
| 10 | JGI25153J46596_10038521 | 3300003215 | Unclassified | 1506 |
| 11 | rootH2_10005684 | 3300003320 | Bacteria | 48336 |
| 12 | rootH2_10063502 | 3300003320 | Bacteria | 13069 |
| 13 | rootH2_10212327 | 3300003320 | Unclassified | 1346 |
| 14 | rootH2_10283979 | 3300003320 | Bacteria | 1082 |
| 15 | rootL2_10071856 | 3300003322 | Bacteria | 3682 |
| 16 | rootL2_10213467 | 3300003322 | Bacteria | 1207 |
| 17 | rootH1_10037955 | 3300003323 | Bacteria | 16172 |
| 18 | rootH1_10080260 | 3300003323 | Bacteria | 4994 |
| 19 | rootH1_10103407 | 3300003323 | Bacteria | 4190 |
| 20 | rootH1_10268703 | 3300003323 | Bacteria | 1666 |
| 21 | JGI25160J50197_1032290 | 3300003354 | Bacteria | 1333 |
| 22 | Ga0006562J51391_1057395 | 3300003578 | Bacteria | 609 |
| 23 | Ga0055526_1076962 | 3300003771 | Bacteria | 660 |
| 24 | Ga0055531_10000104 | 3300003794 | Bacteria | 92278 |
| 25 | Ga0058860_12076626 | 3300004801 | Bacteria | 756 |
| 26 | Ga0065165_1057060 | 3300005262 | Bacteria | 1083 |
| 27 | Ga0065714_10071155 | 3300005288 | Bacteria | 3652 |
| 28 | Ga0065714_10076072 | 3300005288 | Bacteria | 2832 |
| 29 | Ga0065714_10244477 | 3300005288 | Bacteria | 768 |
| 30 | Ga0065714_10248088 | 3300005288 | Bacteria | 781 |
| 31 | Ga0065704_10072920 | 3300005289 | Bacteria | 7814 |
| 32 | Ga0065704_10366593 | 3300005289 | Bacteria | 790 |
| 33 | Ga0065715_10200358 | 3300005293 | Bacteria | 1365 |
| 34 | Ga0065715_10536852 | 3300005293 | Bacteria | 751 |
| 35 | Ga0070658_10330702 | 3300005327 | Bacteria | 1302 |
| 36 | Ga0070680_100015323 | 3300005336 | Bacteria | 6007 |
| 37 | Ga0070682_100000583 | 3300005337 | Bacteria | 22371 |
| 38 | Ga0070660_100052884 | 3300005339 | Bacteria | 3132 |
| 39 | Ga0070691_10001351 | 3300005341 | Bacteria | 10464 |
| 40 | Ga0070669_100297274 | 3300005353 | Bacteria | 1298 |
| 41 | Ga0070663_101499412 | 3300005455 | Bacteria | 599 |
| 42 | Ga0070678_100189657 | 3300005456 | Bacteria | 1689 |
| 43 | Ga0070681_10001864 | 3300005458 | Bacteria | 19041 |
| 44 | Ga0070679_100000415 | 3300005530 | Bacteria | 36278 |
| 45 | Ga0070679_101617181 | 3300005530 | Bacteria | 595 |
| 46 | Ga0068853_100028605 | 3300005539 | Bacteria | 4689 |
| 47 | Ga0068853_100141613 | 3300005539 | Bacteria | 2159 |
| 48 | Ga0070672_100332812 | 3300005543 | Bacteria | 1292 |
| 49 | Ga0070672_101441076 | 3300005543 | Bacteria | 616 |
| 50 | Ga0070686_100000007 | 3300005544 | Bacteria | 242709 |
| 51 | Ga0070693_100007791 | 3300005547 | Bacteria | 5252 |
| 52 | Ga0070693_100007797 | 3300005547 | Bacteria | 5251 |
| 53 | Ga0068855_100049427 | 3300005563 | Bacteria | 4960 |
| 54 | Ga0068855_100060518 | 3300005563 | Bacteria | 4428 |
| 55 | Ga0068857_102279237 | 3300005577 | Bacteria | 532 |
| 56 | Ga0068854_100368588 | 3300005578 | Bacteria | 1180 |
| 57 | Ga0068856_100016947 | 3300005614 | Bacteria | 7061 |
| 58 | Ga0068870_10164973 | 3300005840 | Bacteria | 1317 |
| 59 | Ga0068863_100013234 | 3300005841 | Bacteria | 7958 |
| 60 | Ga0068860_100046394 | 3300005843 | Bacteria | 4143 |
| 61 | Ga0075365_10041421 | 3300006038 | Bacteria | 3008 |
| 62 | Ga0075368_10024780 | 3300006042 | Bacteria | 2299 |
| 63 | Ga0070712_100012667 | 3300006175 | Bacteria | 5368 |
| 64 | Ga0075367_10008634 | 3300006178 | Bacteria | 5286 |
| 65 | Ga0075370_10124220 | 3300006353 | Bacteria | 1504 |
| 66 | Ga0075370_10672915 | 3300006353 | Bacteria | 629 |
| 67 | Ga0075428_102038951 | 3300006844 | Bacteria | 594 |
| 68 | Ga0075429_100243476 | 3300006880 | Bacteria | 1575 |
| 69 | Ga0099826_10436516 | 3300006948 | Bacteria | 627 |
| 70 | Ga0105251_10030030 | 3300009011 | Bacteria | 2733 |
| 71 | Ga0105244_10000201 | 3300009036 | Bacteria | 60835 |
| 72 | Ga0105244_10187245 | 3300009036 | Bacteria | 980 |
| 73 | Ga0105250_10010368 | 3300009092 | Bacteria | 3884 |
| 74 | Ga0105250_10263920 | 3300009092 | Bacteria | 738 |
| 75 | Ga0105240_10001681 | 3300009093 | Bacteria | 37540 |
| 76 | Ga0105240_10003959 | 3300009093 | Bacteria | 22879 |
| 77 | Ga0105240_10412696 | 3300009093 | Bacteria | 1518 |
| 78 | Ga0105240_10509014 | 3300009093 | Bacteria | 1338 |
| 79 | Ga0105240_10721060 | 3300009093 | Bacteria | 1087 |
| 80 | Ga0105245_10463336 | 3300009098 | Bacteria | 1278 |
| 81 | Ga0105247_10899222 | 3300009101 | Bacteria | 684 |
| 82 | Ga0105243_10364562 | 3300009148 | Bacteria | 1331 |
| 83 | Ga0105243_10992211 | 3300009148 | Bacteria | 842 |
| 84 | Ga0105241_10000404 | 3300009174 | Bacteria | 32610 |
| 85 | Ga0105241_10087105 | 3300009174 | Bacteria | 2457 |
| 86 | Ga0105241_10181221 | 3300009174 | Bacteria | 1748 |
| 87 | Ga0105248_11032500 | 3300009177 | Bacteria | 929 |
| 88 | Ga0105237_10007199 | 3300009545 | Bacteria | 12215 |
| 89 | Ga0105237_10010066 | 3300009545 | Bacteria | 10087 |
| 90 | Ga0105237_10128103 | 3300009545 | Bacteria | 2532 |
| 91 | Ga0105237_10918378 | 3300009545 | Bacteria | 882 |
| 92 | Ga0105238_10137072 | 3300009551 | Bacteria | 2425 |
| 93 | Ga0105238_10406951 | 3300009551 | Bacteria | 1354 |
| 94 | Ga0105249_10108628 | 3300009553 | Bacteria | 2619 |
| 95 | Ga0105249_12171746 | 3300009553 | Bacteria | 628 |
| 96 | Ga0105239_10000008 | 3300010375 | Bacteria | 376925 |
| 97 | Ga0105239_10000256 | 3300010375 | Bacteria | 79404 |
| 98 | Ga0105239_10015160 | 3300010375 | Bacteria | 8541 |
| 99 | Ga0105239_10119416 | 3300010375 | Bacteria | 2926 |
| 100 | Ga0105239_10972266 | 3300010375 | Bacteria | 976 |
| 101 | Ga0105246_10047265 | 3300011119 | Bacteria | 2938 |
| 102 | Ga0157373_10002593 | 3300013100 | Bacteria | 13729 |
| 103 | Ga0157373_10116952 | 3300013100 | Bacteria | 1874 |
| 104 | Ga0157371_10003257 | 3300013102 | Bacteria | 14885 |
| 105 | Ga0157371_10030689 | 3300013102 | Bacteria | 3876 |
| 106 | Ga0157371_10600262 | 3300013102 | Unclassified | 819 |
| 107 | Ga0157370_10000134 | 3300013104 | Bacteria | 89337 |
| 108 | Ga0157370_10009827 | 3300013104 | Bacteria | 10142 |
| 109 | Ga0157370_10203460 | 3300013104 | Bacteria | 1836 |
| 110 | Ga0157370_11336599 | 3300013104 | Bacteria | 645 |
| 111 | Ga0157369_10001052 | 3300013105 | Bacteria | 34841 |
| 112 | Ga0163162_10440737 | 3300013306 | Bacteria | 1435 |
| 113 | Ga0157372_10064294 | 3300013307 | Bacteria | 4117 |
| 114 | Ga0157372_10094520 | 3300013307 | Bacteria | 3404 |
| 115 | Ga0157375_10066839 | 3300013308 | Bacteria | 3590 |
| 116 | Ga0163163_10599502 | 3300014325 | Bacteria | 1165 |
| 117 | Ga0182008_10000034 | 3300014497 | Bacteria | 138235 |
| 118 | Ga0157376_10855245 | 3300014969 | Bacteria | 925 |
| 119 | Ga0157376_11077031 | 3300014969 | Bacteria | 829 |
| 120 | Ga0157376_11699673 | 3300014969 | Bacteria | 666 |
| 121 | Ga0182006_1002474 | 3300015261 | Bacteria | 10076 |
| 122 | Ga0182006_1008371 | 3300015261 | Bacteria | 4686 |
| 123 | Ga0182006_1017652 | 3300015261 | Bacteria | 3028 |
| 124 | Ga0163161_10000922 | 3300017792 | Bacteria | 22691 |
| 125 | Ga0163161_10196783 | 3300017792 | Bacteria | 1552 |
| 126 | Ga0209147_106110 | 3300025229 | Bacteria | 1706 |
| 127 | Ga0209437_100017 | 3300025233 | Bacteria | 694471 |
| 128 | Ga0209646_1000122 | 3300025246 | Bacteria | 144486 |
| 129 | Ga0209026_1000329 | 3300025250 | Bacteria | 47539 |
| 130 | Ga0209673_1009305 | 3300025273 | Bacteria | 4276 |
| 131 | Ga0209130_1039520 | 3300025284 | Bacteria | 918 |
| 132 | Ga0209025_1001072 | 3300025294 | Bacteria | 39679 |
| 133 | Ga0209025_1001789 | 3300025294 | Bacteria | 25516 |
| 134 | Ga0209564_1008257 | 3300025295 | Bacteria | 5179 |
| 135 | Ga0209758_1005260 | 3300025297 | Bacteria | 10124 |
| 136 | Ga0207426_1001512 | 3300025302 | Bacteria | 18977 |
| 137 | Ga0207426_1009457 | 3300025302 | Bacteria | 3855 |
| 138 | Ga0209257_1000013 | 3300025304 | Bacteria | 1047305 |
| 139 | Ga0207696_1112235 | 3300025711 | Bacteria | 738 |
| 140 | Ga0207655_1000381 | 3300025728 | Bacteria | 61849 |
| 141 | Ga0207655_1188995 | 3300025728 | Bacteria | 623 |
| 142 | Ga0207713_1027134 | 3300025735 | Bacteria | 2607 |
| 143 | Ga0207688_10296604 | 3300025901 | Bacteria | 988 |
| 144 | Ga0207643_10110301 | 3300025908 | Bacteria | 1621 |
| 145 | Ga0207705_11211901 | 3300025909 | Bacteria | 579 |
| 146 | Ga0207654_10068651 | 3300025911 | Bacteria | 2098 |
| 147 | Ga0207707_10002482 | 3300025912 | Bacteria | 16598 |
| 148 | Ga0207695_10006276 | 3300025913 | Bacteria | 15475 |
| 149 | Ga0207695_10007718 | 3300025913 | Bacteria | 13624 |
| 150 | Ga0207695_10101866 | 3300025913 | Unclassified | 2865 |
| 151 | Ga0207671_10005635 | 3300025914 | Bacteria | 11477 |
| 152 | Ga0207671_10014905 | 3300025914 | Bacteria | 6114 |
| 153 | Ga0207660_10005556 | 3300025917 | Bacteria | 8189 |
| 154 | Ga0207657_10109514 | 3300025919 | Bacteria | 2282 |
| 155 | Ga0207652_10000016 | 3300025921 | Bacteria | 188815 |
| 156 | Ga0207652_10002176 | 3300025921 | Bacteria | 16750 |
| 157 | Ga0207681_10651385 | 3300025923 | Bacteria | 873 |
| 158 | Ga0207694_10267428 | 3300025924 | Bacteria | 1402 |
| 159 | Ga0207650_11441008 | 3300025925 | Bacteria | 586 |
| 160 | Ga0207709_10217813 | 3300025935 | Bacteria | 1375 |
| 161 | Ga0207667_10069624 | 3300025949 | Bacteria | 3662 |
| 162 | Ga0207667_10086441 | 3300025949 | Bacteria | 3245 |
| 163 | Ga0207667_10141618 | 3300025949 | Bacteria | 2476 |
| 164 | Ga0207640_10015839 | 3300025981 | Bacteria | 4374 |
| 165 | Ga0207703_10807215 | 3300026035 | Bacteria | 896 |
| 166 | Ga0207639_10107989 | 3300026041 | Bacteria | 2262 |
| 167 | Ga0207639_12063627 | 3300026041 | Bacteria | 531 |
| 168 | Ga0207641_10090940 | 3300026088 | Bacteria | 2670 |
| 169 | Ga0207674_11144190 | 3300026116 | Bacteria | 748 |
| 170 | Ga0207683_10233712 | 3300026121 | Bacteria | 1677 |
| 171 | Ga0209813_10009922 | 3300027866 | Bacteria | 2450 |
| 172 | Ga0265334_10254033 | 3300028573 | Bacteria | 605 |
| 173 | Ga0307517_10016527 | 3300028786 | Bacteria | 9693 |
| 174 | Ga0307515_10000353 | 3300028794 | Bacteria | 112876 |
| 175 | Ga0307515_10005513 | 3300028794 | Bacteria | 25617 |
| 176 | Ga0307515_10033940 | 3300028794 | Bacteria | 8378 |
| 177 | Ga0307515_10132920 | 3300028794 | Bacteria | 2726 |
| 178 | Ga0307515_10290675 | 3300028794 | Bacteria | 1330 |
| 179 | Ga0307512_10050498 | 3300030522 | Bacteria | 3339 |
| 180 | Ga0307512_10285186 | 3300030522 | Bacteria | 785 |
| 181 | Ga0316177_1128036 | 3300030731 | Bacteria | 2413 |
| 182 | Ga0265327_10000006 | 3300031251 | Bacteria | 693716 |
| 183 | Ga0265327_10025157 | 3300031251 | Bacteria | 3478 |
| 184 | Ga0265327_10075306 | 3300031251 | Bacteria | 1679 |
| 185 | Ga0307513_10009379 | 3300031456 | Bacteria | 12382 |
| 186 | Ga0307513_10047943 | 3300031456 | Unclassified | 4642 |
| 187 | Ga0307513_10080791 | 3300031456 | Bacteria | 3352 |
| 188 | Ga0307513_10576802 | 3300031456 | Bacteria | 835 |
| 189 | Ga0307509_10748062 | 3300031507 | Bacteria | 643 |
| 190 | Ga0307408_100042156 | 3300031548 | Unclassified | 3240 |
| 191 | Ga0307508_10047628 | 3300031616 | Bacteria | 3821 |
| 192 | Ga0307514_10197725 | 3300031649 | Bacteria | 1269 |
| 193 | Ga0307514_10357840 | 3300031649 | Bacteria | 773 |
| 194 | Ga0307405_10022711 | 3300031731 | Unclassified | 3552 |
| 195 | Ga0307410_10851273 | 3300031852 | Unclassified | 778 |
| 196 | Ga0307407_10069916 | 3300031903 | Unclassified | 2085 |
| 197 | Ga0307412_10000049 | 3300031911 | Bacteria | 151588 |
| 198 | Ga0307412_10765046 | 3300031911 | Bacteria | 835 |
| 199 | Ga0307416_100022952 | 3300032002 | Bacteria | 4517 |
| 200 | Ga0307416_100027471 | 3300032002 | Unclassified | 4215 |
| 201 | Ga0307414_10005831 | 3300032004 | Bacteria | 6811 |
| 202 | Ga0307414_10025379 | 3300032004 | Bacteria | 3796 |
| 203 | Ga0307414_10049838 | 3300032004 | Bacteria | 2897 |
| 204 | Ga0307414_10111620 | 3300032004 | Bacteria | 2082 |
| 205 | Ga0307414_10167054 | 3300032004 | Bacteria | 1755 |
| 206 | Ga0307414_11753461 | 3300032004 | Bacteria | 579 |
| 207 | Ga0307411_10000004 | 3300032005 | Bacteria | 460327 |
| 208 | Ga0307411_11099625 | 3300032005 | Bacteria | 716 |
| 209 | Ga0307415_100019356 | 3300032126 | Bacteria | 4132 |
| 210 | Ga0307507_10000362 | 3300033179 | Bacteria | 93053 |
| 211 | Ga0307507_10311738 | 3300033179 | Bacteria | 955 |
| 212 | Ga0307510_10068758 | 3300033180 | Bacteria | 3551 |
| 213 | Ga0307510_10085718 | 3300033180 | Bacteria | 3025 |
| 214 | Ga0395900_0619352 | 3300037418 | Bacteria | 1021 |
| 215 | Ga0395900_0820778 | 3300037418 | Bacteria | 857 |
| 216 | Ga0436363_1578705 | 3300039450 | Unclassified | 1152 |
| 217 | Ga0436362_0649927 | 3300039453 | Bacteria | 683 |
| 218 | Ga0436362_1225224 | 3300039453 | Bacteria | 1449 |
| 219 | Ga0439436_0021983 | 3300041404 | Bacteria | 1891 |
| 220 | Ga0439439_0106950 | 3300041406 | Bacteria | 773 |
| 221 | Ga0439447_004295 | 3300041407 | Bacteria | 4941 |
| 222 | Ga0451787_094168 | 3300041441 | Bacteria | 608 |
| 223 | Ga0451793_0428212 | 3300041452 | Unclassified | 744 |
| 224 | Ga0451793_1195031 | 3300041452 | Unclassified | 1345 |
| 225 | Ga0451797_1207730 | 3300041453 | Bacteria | 952 |
| 226 | Ga0451795_0246016 | 3300041456 | Bacteria | 553 |
| 227 | Ga0451795_1578515 | 3300041456 | Bacteria | 1448 |
| 228 | Ga0451802_0384759 | 3300041460 | Bacteria | 1135 |
| 229 | Ga0451807_0222980 | 3300041486 | Bacteria | 911 |
| 230 | Ga0451839_1165440 | 3300041496 | Bacteria | 592 |
| 231 | Ga0451847_0955537 | 3300041503 | Bacteria | 530 |
| 232 | Ga0451853_0842481 | 3300041512 | Bacteria | 2029 |
| 233 | Ga0451853_0878125 | 3300041512 | Bacteria | 6787 |
| 234 | Ga0451853_1390141 | 3300041512 | Bacteria | 6633 |
| 235 | Ga0451853_1429198 | 3300041512 | Bacteria | 655 |
| 236 | Ga0451853_2021448 | 3300041512 | Bacteria | 2569 |
| 237 | Ga0451853_2072721 | 3300041512 | Bacteria | 1604 |
| 238 | Ga0439442_027232 | 3300042002 | Bacteria | 1191 |
| 239 | Ga0439448_0014792 | 3300042005 | Bacteria | 2357 |
| 240 | Ga0439449_0010774 | 3300042007 | Bacteria | 3450 |
| 241 | Ga0439449_0021745 | 3300042007 | Bacteria | 2401 |
| 242 | Ga0439449_0160192 | 3300042007 | Bacteria | 840 |
| 243 | Ga0439449_0317165 | 3300042007 | Bacteria | 589 |
| 244 | Ga0439455_0003760 | 3300042012 | Bacteria | 2935 |
| 245 | Ga0439457_019007 | 3300042014 | Bacteria | 1526 |
| 246 | Ga0439462_0075525 | 3300042015 | Bacteria | 917 |
| 247 | Ga0450894_000150 | 3300042131 | Bacteria | 12331 |
| 248 | Ga0450896_026848 | 3300042133 | Bacteria | 860 |
| 249 | Ga0450898_050851 | 3300042134 | Bacteria | 800 |
| 250 | Ga0450899_001245 | 3300042135 | Bacteria | 2885 |
| 251 | Ga0450903_008829 | 3300042138 | Bacteria | 1646 |
| 252 | Ga0450906_005737 | 3300042145 | Bacteria | 2533 |
| 253 | Ga0439458_0002003 | 3300042157 | Bacteria | 5059 |
| 254 | Ga0466969_0000451 | 3300044656 | Bacteria | 22561 |
| 255 | Ga0466972_0011561 | 3300044658 | Bacteria | 4432 |
| 256 | Ga0466965_0001081 | 3300044683 | Bacteria | 10598 |
| 257 | Ga0466966_0001814 | 3300044684 | Bacteria | 13849 |
| 258 | Ga0466966_0003200 | 3300044684 | Bacteria | 10784 |
| 259 | Ga0466961_0001727 | 3300044693 | Bacteria | 13590 |
| 260 | Ga0466961_0002469 | 3300044693 | Bacteria | 11471 |
| 261 | Ga0466963_0051646 | 3300044694 | Bacteria | 2725 |
| 262 | Ga0466964_0299359 | 3300044706 | Bacteria | 810 |
| 263 | Ga0466971_0001603 | 3300044719 | Bacteria | 9539 |
| 264 | Ga0466970_0000971 | 3300044765 | Bacteria | 13790 |
| 265 | Ga0466970_0012511 | 3300044765 | Bacteria | 4341 |
| 266 | Ga0466970_0135403 | 3300044765 | Bacteria | 1355 |
| 267 | Ga0466957_0002710 | 3300044842 | Bacteria | 9576 |
| 268 | Ga0466957_0003736 | 3300044842 | Bacteria | 8414 |
| 269 | Ga0466959_0000182 | 3300045049 | Bacteria | 41499 |
| 270 | Ga0466959_0002105 | 3300045049 | Bacteria | 12594 |
| 271 | Ga0466958_0000961 | 3300045836 | Bacteria | 13041 |
| 272 | Ga0466967_0000560 | 3300045976 | Bacteria | 18187 |
| 273 | Ga0495603_0033465 | 3300046455 | Bacteria | 3092 |
| 274 | Ga0495590_0031788 | 3300046457 | Bacteria | 1847 |
| 275 | Ga0495629_0018902 | 3300046459 | Bacteria | 4926 |
| 276 | Ga0495638_0424890 | 3300046460 | Bacteria | 684 |
| 277 | Ga0495650_0134882 | 3300046471 | Bacteria | 897 |
| 278 | Ga0495650_0299202 | 3300046471 | Bacteria | 539 |
| 279 | Ga0495605_0032866 | 3300046474 | Bacteria | 2638 |
| 280 | Ga0495662_0192847 | 3300046476 | Bacteria | 1004 |
| 281 | Ga0495585_0000388 | 3300046492 | Bacteria | 42445 |
| 282 | Ga0495585_0107778 | 3300046492 | Bacteria | 1484 |
| 283 | Ga0495585_0360579 | 3300046492 | Unclassified | 705 |
| 284 | Ga0495585_0568018 | 3300046492 | Bacteria | 535 |
| 285 | Ga0495594_0184624 | 3300046499 | Bacteria | 1187 |
| 286 | Ga0495594_0429043 | 3300046499 | Bacteria | 752 |
| 287 | Ga0495583_0143583 | 3300046506 | Bacteria | 992 |
| 288 | Ga0495583_0317752 | 3300046506 | Bacteria | 617 |
| 289 | Ga0495606_0000074 | 3300046507 | Bacteria | 170848 |
| 290 | Ga0495606_0004380 | 3300046507 | Bacteria | 14156 |
| 291 | Ga0495606_0006049 | 3300046507 | Bacteria | 11319 |
| 292 | Ga0495606_0017582 | 3300046507 | Bacteria | 5398 |
| 293 | Ga0495606_0028451 | 3300046507 | Bacteria | 3942 |
| 294 | Ga0495606_0085940 | 3300046507 | Bacteria | 1945 |
| 295 | Ga0495608_0073014 | 3300046511 | Bacteria | 2238 |
| 296 | Ga0495610_0029208 | 3300046512 | Bacteria | 2907 |
| 297 | Ga0495610_0057176 | 3300046512 | Bacteria | 1872 |
| 298 | Ga0495616_0006996 | 3300046513 | Bacteria | 6791 |
| 299 | Ga0495616_0008620 | 3300046513 | Bacteria | 6021 |
| 300 | Ga0495616_0293361 | 3300046513 | Bacteria | 688 |
| 301 | Ga0495618_0224704 | 3300046514 | Bacteria | 1183 |
| 302 | Ga0495620_0004387 | 3300046515 | Bacteria | 7961 |
| 303 | Ga0495620_0034178 | 3300046515 | Bacteria | 2300 |
| 304 | Ga0495628_0067106 | 3300046516 | Bacteria | 2802 |
| 305 | Ga0495630_0135145 | 3300046517 | Bacteria | 1874 |
| 306 | Ga0495631_0011003 | 3300046518 | Bacteria | 4466 |
| 307 | Ga0495637_0019315 | 3300046520 | Bacteria | 3153 |
| 308 | Ga0495643_0006478 | 3300046522 | Bacteria | 7704 |
| 309 | Ga0495643_0034893 | 3300046522 | Bacteria | 2772 |
| 310 | Ga0495644_0163266 | 3300046523 | Bacteria | 854 |
| 311 | Ga0495648_0008222 | 3300046524 | Bacteria | 8227 |
| 312 | Ga0495648_0213277 | 3300046524 | Bacteria | 957 |
| 313 | Ga0495663_0047279 | 3300046525 | Bacteria | 1324 |
| 314 | Ga0495666_0025458 | 3300046526 | Bacteria | 2921 |
| 315 | Ga0495642_0211994 | 3300046528 | Bacteria | 845 |
| 316 | Ga0495652_0135326 | 3300046529 | Bacteria | 1945 |
| 317 | Ga0495654_0261234 | 3300046530 | Bacteria | 718 |
| 318 | Ga0495640_0103707 | 3300046533 | Bacteria | 1864 |
| 319 | Ga0495609_0034029 | 3300046538 | Bacteria | 2311 |
| 320 | Ga0495597_0085113 | 3300046542 | Bacteria | 1347 |
| 321 | Ga0495622_0010743 | 3300046557 | Bacteria | 4224 |
| 322 | Ga0495622_0055525 | 3300046557 | Bacteria | 1837 |
| 323 | Ga0495622_0335435 | 3300046557 | Bacteria | 655 |
| 324 | Ga0495633_0000027 | 3300046558 | Bacteria | 204613 |
| 325 | Ga0495633_0004447 | 3300046558 | Bacteria | 8916 |
| 326 | Ga0495633_0124349 | 3300046558 | Bacteria | 1194 |
| 327 | Ga0495667_0672677 | 3300046559 | Bacteria | 642 |
| 328 | Ga0495667_0821509 | 3300046559 | Bacteria | 572 |
| 329 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 330 | Ga0495668_0007298 | 3300046616 | Bacteria | 7087 |
| 331 | Ga0495634_0381750 | 3300046642 | Bacteria | 839 |
| 332 | Ga0495611_0000010 | 3300046648 | Bacteria | 156661 |
| 333 | Ga0495611_0069259 | 3300046648 | Bacteria | 1611 |
| 334 | Ga0495625_0022865 | 3300046660 | Bacteria | 4783 |
| 335 | Ga0495625_0025338 | 3300046660 | Bacteria | 4499 |
| 336 | Ga0495625_0043358 | 3300046660 | Bacteria | 3263 |
| 337 | Ga0495625_0184263 | 3300046660 | Bacteria | 1386 |
| 338 | Ga0495625_0401828 | 3300046660 | Bacteria | 856 |
| 339 | Ga0495661_0040743 | 3300046665 | Bacteria | 2878 |
| 340 | Ga0495657_0030837 | 3300046675 | Bacteria | 3751 |
| 341 | Ga0495599_0404411 | 3300046678 | Bacteria | 813 |
| 342 | Ga0495623_0038597 | 3300046679 | Bacteria | 3054 |
| 343 | Ga0495646_0313190 | 3300046680 | Bacteria | 828 |
| 344 | Ga0495658_0094445 | 3300046683 | Bacteria | 1776 |
| 345 | Ga0495669_0466631 | 3300046684 | Bacteria | 613 |
| 346 | Ga0495613_0787035 | 3300046689 | Bacteria | 621 |
| 347 | Ga0495613_0791070 | 3300046689 | Bacteria | 619 |
| 348 | Ga0495624_0032786 | 3300046690 | Bacteria | 3366 |
| 349 | Ga0495624_0140191 | 3300046690 | Bacteria | 1481 |
| 350 | Ga0495670_0152220 | 3300046691 | Bacteria | 1213 |
| 351 | Ga0495671_0218809 | 3300046692 | Bacteria | 922 |
| 352 | Ga0495649_0038296 | 3300046694 | Bacteria | 2631 |
| 353 | Ga0495600_0851540 | 3300046809 | Bacteria | 540 |
| 354 | Ga0495660_0078996 | 3300046810 | Bacteria | 1728 |
| 355 | Ga0495660_0216802 | 3300046810 | Bacteria | 904 |
| 356 | Ga0495660_0378822 | 3300046810 | Bacteria | 624 |
| 357 | Ga0495581_0130138 | 3300047315 | Bacteria | 1466 |
| 358 | Ga0495604_0045469 | 3300047317 | Bacteria | 3426 |
| 359 | Ga0495636_0050896 | 3300047318 | Bacteria | 1735 |
| 360 | Ga0495674_1399868 | 3300047319 | Bacteria | 521 |
| 361 | Ga0495672_0081353 | 3300047320 | Bacteria | 1804 |
| 362 | Ga0495676_0012453 | 3300047321 | Bacteria | 7661 |
| 363 | Ga0495676_0068551 | 3300047321 | Bacteria | 2740 |
| 364 | Ga0495680_0016059 | 3300047322 | Bacteria | 6437 |
| 365 | Ga0495680_0018359 | 3300047322 | Bacteria | 5940 |
| 366 | Ga0495683_0030126 | 3300047323 | Bacteria | 2770 |
| 367 | Ga0495683_0044007 | 3300047323 | Bacteria | 2245 |
| 368 | Ga0495687_011324 | 3300047443 | Bacteria | 4807 |
| 369 | Ga0495687_049857 | 3300047443 | Bacteria | 1787 |
| 370 | Ga0495687_157291 | 3300047443 | Bacteria | 769 |
| 371 | Ga0495677_0163530 | 3300047445 | Bacteria | 860 |
| 372 | Ga0495685_114709 | 3300047447 | Bacteria | 885 |
| 373 | Ga0495681_0027610 | 3300047470 | Bacteria | 2933 |
| 374 | Ga0495684_0865832 | 3300047471 | Bacteria | 585 |
| 375 | Ga0495686_0000249 | 3300047472 | Bacteria | 96604 |
| 376 | Ga0495686_0000386 | 3300047472 | Bacteria | 70225 |
| 377 | Ga0495686_0000582 | 3300047472 | Bacteria | 51799 |
| 378 | Ga0495686_0000587 | 3300047472 | Bacteria | 51313 |
| 379 | Ga0495686_0001554 | 3300047472 | Bacteria | 24493 |
| 380 | Ga0495686_0066967 | 3300047472 | Bacteria | 2218 |
| 381 | Ga0495593_0008174 | 3300047673 | Bacteria | 6086 |
| 382 | Ga0495593_0072907 | 3300047673 | Bacteria | 1782 |
| 383 | Ga0495593_0313917 | 3300047673 | Bacteria | 784 |
| 384 | Ga0495614_0013162 | 3300048089 | Bacteria | 3629 |
| 385 | Ga0495614_0029728 | 3300048089 | Bacteria | 2351 |
| 386 | Ga0495614_0070246 | 3300048089 | Bacteria | 1508 |
| 387 | Ga0495626_0019938 | 3300048091 | Bacteria | 3345 |
| 388 | Ga0496101_0281832 | 3300048904 | Bacteria | 1299 |
| 389 | Ga0496116_0000024 | 3300048919 | Bacteria | 471420 |
| 390 | Ga0496117_0218606 | 3300048920 | Bacteria | 1062 |
| 391 | Ga0496118_0080707 | 3300048921 | Bacteria | 2288 |
| 392 | Ga0496121_0019380 | 3300048924 | Bacteria | 6804 |
| 393 | Ga0496121_0163799 | 3300048924 | Bacteria | 1623 |
| 394 | Ga0496122_0000066 | 3300048925 | Bacteria | 231473 |
| 395 | Ga0496123_0096876 | 3300048926 | Bacteria | 1730 |
| 396 | Ga0496124_0017724 | 3300048927 | Bacteria | 6700 |
| 397 | Ga0496124_0177392 | 3300048927 | Bacteria | 1643 |
| 398 | Ga0496125_0000018 | 3300048928 | Bacteria | 482390 |
| 399 | Ga0496126_0014506 | 3300048929 | Bacteria | 7963 |
| 400 | Ga0496126_0018225 | 3300048929 | Bacteria | 6967 |
| 401 | Ga0495678_056852 | 3300049459 | Bacteria | 1485 |
| 402 | Ga0495682_0113112 | 3300049460 | Bacteria | 973 |
| 403 | Ga0501032_0466896 | 3300049569 | Bacteria | 808 |
| 404 | Ga0501033_0397782 | 3300049570 | Unclassified | 961 |
| 405 | Ga0501034_0924455 | 3300049571 | Bacteria | 759 |
| 406 | Ga0501070_0785365 | 3300049586 | Bacteria | 749 |
| 407 | Ga0501198_090711 | 3300049649 | Unclassified | 606 |
| 408 | Ga0501238_002146 | 3300049671 | Bacteria | 2330 |
| 409 | Ga0501241_004732 | 3300049758 | Bacteria | 2540 |
| 410 | Ga0501266_000002 | 3300049763 | Bacteria | 459947 |
| 411 | Ga0501269_001832 | 3300049766 | Bacteria | 2697 |
| 412 | Ga0501280_002242 | 3300049776 | Unclassified | 3282 |
| 413 | Ga0501035_0436176 | 3300049822 | Unclassified | 1086 |
| 414 | nmdc:mga03n38_716763_c1 | 3300050490 | Bacteria | 577 |
| 415 | nmdc:mga0yw44_123704_c1 | 3300050492 | Bacteria | 1668 |
| 416 | nmdc:mga06z11_5136_c1 | 3300050494 | Bacteria | 5219 |
| 417 | nmdc:mga04h51_13231_c1 | 3300050495 | Bacteria | 2332 |
| 418 | nmdc:mga0rr50_440802_c1 | 3300050513 | Bacteria | 1103 |
| 419 | Ga0500635_0000558 | 3300053080 | Bacteria | 9937 |
| 420 | Ga0500635_0021064 | 3300053080 | Bacteria | 2004 |
| 421 | Ga0500644_0002380 | 3300053088 | Bacteria | 4720 |
| 422 | Ga0500644_0012972 | 3300053088 | Bacteria | 2317 |
| 423 | Ga0500644_0049063 | 3300053088 | Bacteria | 1439 |
| 424 | Ga0500646_0011416 | 3300053090 | Bacteria | 2286 |
| 425 | Ga0500646_0057660 | 3300053090 | Bacteria | 1135 |
| 426 | Ga0500646_0167667 | 3300053090 | Bacteria | 737 |
| 427 | Ga0500651_0000756 | 3300053093 | Bacteria | 15793 |
| 428 | Ga0500651_0015489 | 3300053093 | Unclassified | 4680 |
| 429 | Ga0500651_0037850 | 3300053093 | Unclassified | 3039 |
| 430 | Ga0500651_0079716 | 3300053093 | Bacteria | 2029 |
| 431 | Ga0500641_0000143 | 3300053096 | Bacteria | 26192 |
| 432 | Ga0500641_0003775 | 3300053096 | Bacteria | 5353 |
| 433 | Ga0500555_082418 | 3300053103 | Bacteria | 835 |
| 434 | Ga0500560_058057 | 3300053107 | Bacteria | 1256 |
| 435 | Ga0500562_000111 | 3300053108 | Bacteria | 28772 |
| 436 | Ga0500569_000338 | 3300053109 | Bacteria | 7520 |
| 437 | Ga0500594_0047530 | 3300053118 | Bacteria | 1197 |
| 438 | Ga0500608_018193 | 3300053122 | Bacteria | 3203 |
| 439 | Ga0500614_286395 | 3300053123 | Bacteria | 517 |
| 440 | Ga0500618_000013 | 3300053125 | Bacteria | 183026 |
| 441 | Ga0500642_0079083 | 3300053130 | Bacteria | 1507 |
| 442 | Ga0500658_0000002 | 3300053134 | Bacteria | 548440 |
| 443 | Ga0500658_0201695 | 3300053134 | Bacteria | 909 |
| 444 | Ga0500561_0035330 | 3300053137 | Bacteria | 1289 |
| 445 | Ga0500564_095564 | 3300053138 | Bacteria | 1319 |
| 446 | Ga0500568_0062607 | 3300053139 | Bacteria | 1437 |
| 447 | Ga0500573_0029975 | 3300053140 | Bacteria | 3137 |
| 448 | Ga0500577_0000386 | 3300053142 | Bacteria | 11294 |
| 449 | Ga0500589_144834 | 3300053147 | Bacteria | 974 |
| 450 | Ga0500600_0322464 | 3300053149 | Bacteria | 650 |
| 451 | Ga0500616_0007615 | 3300053153 | Bacteria | 6846 |
| 452 | Ga0500616_0368440 | 3300053153 | Bacteria | 580 |
| 453 | Ga0500616_0397564 | 3300053153 | Bacteria | 551 |
| 454 | Ga0500622_0000042 | 3300053156 | Bacteria | 161253 |
| 455 | Ga0500622_0000086 | 3300053156 | Bacteria | 99366 |
| 456 | Ga0500622_0000354 | 3300053156 | Bacteria | 44739 |
| 457 | Ga0500622_0001279 | 3300053156 | Bacteria | 20471 |
| 458 | Ga0500624_000158 | 3300053157 | Bacteria | 27895 |
| 459 | Ga0500627_0151586 | 3300053158 | Bacteria | 1047 |
| 460 | Ga0500627_0237856 | 3300053158 | Bacteria | 809 |
| 461 | Ga0500633_0000863 | 3300053160 | Bacteria | 5258 |
| 462 | Ga0500636_0005090 | 3300053177 | Bacteria | 7463 |
| 463 | Ga0500584_025201 | 3300053726 | Bacteria | 2765 |
| 464 | Ga0500645_003030 | 3300053730 | Bacteria | 7083 |
| 465 | Ga0500661_008673 | 3300055283 | Bacteria | 1869 |
| 466 | Ga0466962_0002543 | 3300061719 | Bacteria | 8654 |
| 467 | Ga0466962_0057525 | 3300061719 | Bacteria | 1856 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047443 | Ga0495687_011324 | Ga0495687_011324_2943_3461 | 123 |
| 2 | 3300041503 | Ga0451847_0955537 | Ga0451847_0955537_71_496 | 127 |
| 3 | 3300041512 | Ga0451853_0878125 | Ga0451853_0878125_5858_6277 | 127 |
| 4 | 3300042134 | Ga0450898_050851 | Ga0450898_050851_10_429 | 127 |
| 5 | 3300042135 | Ga0450899_001245 | Ga0450899_001245_2004_2423 | 127 |
| 6 | 3300042145 | Ga0450906_005737 | Ga0450906_005737_29_448 | 127 |
| 7 | 3300046471 | Ga0495650_0299202 | Ga0495650_0299202_32_457 | 127 |
| 8 | 3300046474 | Ga0495605_0032866 | Ga0495605_0032866_678_1103 | 127 |
| 9 | 3300046492 | Ga0495585_0568018 | Ga0495585_0568018_131_517 | 127 |
| 10 | 3300046506 | Ga0495583_0143583 | Ga0495583_0143583_450_875 | 127 |
| 11 | 3300046506 | Ga0495583_0317752 | Ga0495583_0317752_33_458 | 127 |
| 12 | 3300046515 | Ga0495620_0004387 | Ga0495620_0004387_5635_6060 | 127 |
| 13 | 3300046542 | Ga0495597_0085113 | Ga0495597_0085113_874_1299 | 127 |
| 14 | 3300046616 | Ga0495668_0007298 | Ga0495668_0007298_1216_1641 | 127 |
| 15 | 3300046660 | Ga0495625_0022865 | Ga0495625_0022865_3681_4106 | 127 |
| 16 | 3300046660 | Ga0495625_0043358 | Ga0495625_0043358_1355_1780 | 127 |
| 17 | 3300046678 | Ga0495599_0404411 | Ga0495599_0404411_346_771 | 127 |
| 18 | 3300046684 | Ga0495669_0466631 | Ga0495669_0466631_201_590 | 127 |
| 19 | 3300047319 | Ga0495674_1399868 | Ga0495674_1399868_13_438 | 127 |
| 20 | 3300047323 | Ga0495683_0044007 | Ga0495683_0044007_684_1109 | 127 |
| 21 | 3300047443 | Ga0495687_157291 | Ga0495687_157291_12_437 | 127 |
| 22 | 3300053149 | Ga0500600_0322464 | Ga0500600_0322464_49_474 | 127 |
| 23 | 3300041456 | Ga0451795_1578515 | Ga0451795_1578515_101_592 | 134 |
| 24 | 3300041496 | Ga0451839_1165440 | Ga0451839_1165440_43_534 | 134 |
| 25 | 3300041460 | Ga0451802_0384759 | Ga0451802_0384759_435_926 | 136 |
| 26 | 3300053156 | Ga0500622_0000042 | Ga0500622_0000042_155961_156380 | 138 |
| 27 | iso_pu_bacteria | 2643221600 | 2644011252 | 139 |
| 28 | iso_pu_bacteria | 2919191525 | 2919193786 | 139 |
| 29 | 3300009545 | Ga0105237_10918378 | Ga0105237_109183782 | 140 |
| 30 | 3300042014 | Ga0439457_019007 | Ga0439457_019007_439_897 | 140 |
| 31 | 3300042131 | Ga0450894_000150 | Ga0450894_000150_10180_10638 | 140 |
| 32 | 3300042133 | Ga0450896_026848 | Ga0450896_026848_358_816 | 140 |
| 33 | 3300046530 | Ga0495654_0261234 | Ga0495654_0261234_21_485 | 140 |
| 34 | 3300046648 | Ga0495611_0000010 | Ga0495611_0000010_99389_99853 | 140 |
| 35 | 3300046810 | Ga0495660_0078996 | Ga0495660_0078996_391_855 | 140 |
| 36 | 3300048925 | Ga0496122_0000066 | Ga0496122_0000066_477_914 | 140 |
| 37 | 3300048926 | Ga0496123_0096876 | Ga0496123_0096876_474_911 | 140 |
| 38 | 3300049586 | Ga0501070_0785365 | Ga0501070_0785365_232_690 | 140 |
| 39 | 3300053090 | Ga0500646_0057660 | Ga0500646_0057660_84_512 | 140 |
| 40 | 3300053093 | Ga0500651_0079716 | Ga0500651_0079716_1377_1805 | 140 |
| 41 | 3300053109 | Ga0500569_000338 | Ga0500569_000338_1137_1565 | 140 |
| 42 | 3300053134 | Ga0500658_0201695 | Ga0500658_0201695_420_848 | 140 |
| 43 | 3300053142 | Ga0500577_0000386 | Ga0500577_0000386_9779_10207 | 140 |
| 44 | 3300053153 | Ga0500616_0007615 | Ga0500616_0007615_60_488 | 140 |
| 45 | iso_pu_bacteria | 2513020052 | 2513235886 | 140 |
| 46 | iso_pu_bacteria | 2585428060 | 2587749435 | 140 |
| 47 | iso_pu_bacteria | 2588253712 | 2588446598 | 140 |
| 48 | iso_pu_bacteria | 2588254257 | 2590612089 | 140 |
| 49 | iso_pu_bacteria | 2643221600 | 2644008424 | 140 |
| 50 | iso_pu_bacteria | 2643221600 | 2644009616 | 140 |
| 51 | iso_pu_bacteria | 2643221667 | 2644372142 | 140 |
| 52 | iso_pu_bacteria | 2738541279 | 2738732697 | 140 |
| 53 | iso_pu_bacteria | 2738541285 | 2738765235 | 140 |
| 54 | iso_pu_bacteria | 2738543007 | 2739214278 | 140 |
| 55 | iso_pu_bacteria | 2739367857 | 2740003191 | 140 |
| 56 | iso_pu_bacteria | 2739367858 | 2740008008 | 140 |
| 57 | iso_pu_bacteria | 2739367874 | 2740057842 | 140 |
| 58 | iso_pu_bacteria | 2802428842 | 2802654901 | 140 |
| 59 | iso_pu_bacteria | 2816332295 | 2817482419 | 140 |
| 60 | iso_pu_bacteria | 2840677318 | 2840678189 | 140 |
| 61 | iso_pu_bacteria | 2857618242 | 2857618309 | 140 |
| 62 | iso_pu_bacteria | 2857618242 | 2857620083 | 140 |
| 63 | iso_pu_bacteria | 2896085136 | 2896086007 | 140 |
| 64 | iso_pu_bacteria | 2896109856 | 2896115212 | 140 |
| 65 | iso_pu_bacteria | 2919191525 | 2919195515 | 140 |
| 66 | iso_pu_bacteria | 2919191525 | 2919196503 | 140 |
| 67 | iso_pu_bacteria | 2919437846 | 2919440801 | 140 |
| 68 | iso_pu_bacteria | 2919683626 | 2919688360 | 140 |
| 69 | iso_pu_bacteria | 2929150217 | 2929150250 | 140 |
| 70 | iso_pu_bacteria | 2929239360 | 2929241154 | 140 |
| 71 | iso_pu_bacteria | 2929921140 | 2929925275 | 140 |
| 72 | iso_pu_bacteria | 2971410472 | 2971412278 | 140 |
| 73 | iso_pu_bacteria | 2977268062 | 2977271719 | 140 |
| 74 | iso_pu_bacteria | 3006858327 | 3006858347 | 140 |
| 75 | iso_pu_bacteria | 8022792930 | 8022794021 | 140 |
| 76 | iso_pu_bacteria | 8054307821 | 8054309860 | 140 |
| 77 | iso_pu_bacteria | 8055419101 | 8055423220 | 140 |
| 78 | iso_pu_bacteria | 8057582654 | 8057587295 | 140 |
| 79 | 3300026035 | Ga0207703_10807215 | Ga0207703_108072152 | 141 |
| 80 | 3300028786 | Ga0307517_10016527 | Ga0307517_100165277 | 141 |
| 81 | 3300046518 | Ga0495631_0011003 | Ga0495631_0011003_1262_1690 | 141 |
| 82 | 3300046660 | Ga0495625_0401828 | Ga0495625_0401828_83_514 | 141 |
| 83 | 3300047323 | Ga0495683_0030126 | Ga0495683_0030126_158_589 | 141 |
| 84 | 3300053122 | Ga0500608_018193 | Ga0500608_018193_177_605 | 141 |
| 85 | 3300053130 | Ga0500642_0079083 | Ga0500642_0079083_359_787 | 141 |
| 86 | 3300004801 | Ga0058860_12076626 | Ga0058860_120766261 | 142 |
| 87 | 3300005327 | Ga0070658_10330702 | Ga0070658_103307021 | 142 |
| 88 | 3300005336 | Ga0070680_100015323 | Ga0070680_1000153235 | 142 |
| 89 | 3300005337 | Ga0070682_100000583 | Ga0070682_10000058322 | 142 |
| 90 | 3300005339 | Ga0070660_100052884 | Ga0070660_1000528844 | 142 |
| 91 | 3300005341 | Ga0070691_10001351 | Ga0070691_100013518 | 142 |
| 92 | 3300005456 | Ga0070678_100189657 | Ga0070678_1001896573 | 142 |
| 93 | 3300005458 | Ga0070681_10001864 | Ga0070681_100018643 | 142 |
| 94 | 3300005530 | Ga0070679_101617181 | Ga0070679_1016171811 | 142 |
| 95 | 3300005539 | Ga0068853_100028605 | Ga0068853_1000286053 | 142 |
| 96 | 3300005547 | Ga0070693_100007797 | Ga0070693_1000077973 | 142 |
| 97 | 3300005563 | Ga0068855_100060518 | Ga0068855_1000605184 | 142 |
| 98 | 3300009093 | Ga0105240_10001681 | Ga0105240_100016813 | 142 |
| 99 | 3300009174 | Ga0105241_10000404 | Ga0105241_1000040431 | 142 |
| 100 | 3300009545 | Ga0105237_10128103 | Ga0105237_101281031 | 142 |
| 101 | 3300009551 | Ga0105238_10406951 | Ga0105238_104069512 | 142 |
| 102 | 3300013104 | Ga0157370_10203460 | Ga0157370_102034602 | 142 |
| 103 | 3300014969 | Ga0157376_10855245 | Ga0157376_108552451 | 142 |
| 104 | 3300025909 | Ga0207705_11211901 | Ga0207705_112119011 | 142 |
| 105 | 3300025911 | Ga0207654_10068651 | Ga0207654_100686512 | 142 |
| 106 | 3300025912 | Ga0207707_10002482 | Ga0207707_100024823 | 142 |
| 107 | 3300025913 | Ga0207695_10006276 | Ga0207695_1000627617 | 142 |
| 108 | 3300025917 | Ga0207660_10005556 | Ga0207660_100055564 | 142 |
| 109 | 3300025919 | Ga0207657_10109514 | Ga0207657_101095143 | 142 |
| 110 | 3300025921 | Ga0207652_10002176 | Ga0207652_1000217617 | 142 |
| 111 | 3300025924 | Ga0207694_10267428 | Ga0207694_102674283 | 142 |
| 112 | 3300025949 | Ga0207667_10141618 | Ga0207667_101416184 | 142 |
| 113 | 3300026041 | Ga0207639_10107989 | Ga0207639_101079893 | 142 |
| 114 | 3300026121 | Ga0207683_10233712 | Ga0207683_102337123 | 142 |
| 115 | 3300031507 | Ga0307509_10748062 | Ga0307509_107480622 | 142 |
| 116 | iso_pu_bacteria | 2675903060 | 2676487618 | 142 |
| 117 | iso_pu_bacteria | 2818991472 | 2819739549 | 142 |
| 118 | 3300005841 | Ga0068863_100013234 | Ga0068863_1000132346 | 143 |
| 119 | 3300005843 | Ga0068860_100046394 | Ga0068860_1000463943 | 143 |
| 120 | 3300006175 | Ga0070712_100012667 | Ga0070712_1000126672 | 143 |
| 121 | 3300006844 | Ga0075428_102038951 | Ga0075428_1020389511 | 143 |
| 122 | 3300006880 | Ga0075429_100243476 | Ga0075429_1002434762 | 143 |
| 123 | 3300009177 | Ga0105248_11032500 | Ga0105248_110325002 | 143 |
| 124 | 3300010375 | Ga0105239_10119416 | Ga0105239_101194162 | 143 |
| 125 | 3300025728 | Ga0207655_1188995 | Ga0207655_11889951 | 143 |
| 126 | 3300026088 | Ga0207641_10090940 | Ga0207641_100909401 | 143 |
| 127 | 3300028573 | Ga0265334_10254033 | Ga0265334_102540332 | 143 |
| 128 | 3300031456 | Ga0307513_10080791 | Ga0307513_100807912 | 143 |
| 129 | 3300039453 | Ga0436362_0649927 | Ga0436362_0649927_64_621 | 143 |
| 130 | 3300041453 | Ga0451797_1207730 | Ga0451797_1207730_169_603 | 143 |
| 131 | 3300041512 | Ga0451853_1429198 | Ga0451853_1429198_42_506 | 143 |
| 132 | 3300047673 | Ga0495593_0313917 | Ga0495593_0313917_123_554 | 143 |
| 133 | 3300050513 | nmdc:mga0rr50_440802_c1 | nmdc:mga0rr50_440802_c1_122_589 | 143 |
| 134 | 3300053103 | Ga0500555_082418 | Ga0500555_082418_230_709 | 143 |
| 135 | 3300053158 | Ga0500627_0151586 | Ga0500627_0151586_47_481 | 143 |
| 136 | 2162886007 | SwRhRL2b_contig_3915940 | SwRhRL2b_0547.00005540 | 144 |
| 137 | 3300001979 | JGI24740J21852_10002037 | JGI24740J21852_100020376 | 144 |
| 138 | 3300002737 | JGI25162J39368_1000011 | JGI25162J39368_1000011109 | 144 |
| 139 | 3300002738 | JGI25154J39366_1000041 | JGI25154J39366_100004159 | 144 |
| 140 | 3300002741 | JGI25157J39369_1003559 | JGI25157J39369_10035594 | 144 |
| 141 | 3300002987 | JGI25159J45721_1014250 | JGI25159J45721_10142501 | 144 |
| 142 | 3300003187 | JGI25151J46595_10006327 | JGI25151J46595_100063273 | 144 |
| 143 | 3300003187 | JGI25151J46595_10008495 | JGI25151J46595_100084954 | 144 |
| 144 | 3300003215 | JGI25153J46596_10003472 | JGI25153J46596_100034726 | 144 |
| 145 | 3300003215 | JGI25153J46596_10038521 | JGI25153J46596_100385212 | 144 |
| 146 | 3300003320 | rootH2_10005684 | rootH2_1000568421 | 144 |
| 147 | 3300003320 | rootH2_10063502 | rootH2_100635027 | 144 |
| 148 | 3300003320 | rootH2_10212327 | rootH2_102123272 | 144 |
| 149 | 3300003320 | rootH2_10283979 | rootH2_102839792 | 144 |
| 150 | 3300003322 | rootL2_10071856 | rootL2_100718563 | 144 |
| 151 | 3300003322 | rootL2_10213467 | rootL2_102134672 | 144 |
| 152 | 3300003323 | rootH1_10037955 | rootH1_1003795510 | 144 |
| 153 | 3300003323 | rootH1_10080260 | rootH1_100802602 | 144 |
| 154 | 3300003323 | rootH1_10103407 | rootH1_101034071 | 144 |
| 155 | 3300003323 | rootH1_10268703 | rootH1_102687032 | 144 |
| 156 | 3300003354 | JGI25160J50197_1032290 | JGI25160J50197_10322902 | 144 |
| 157 | 3300003578 | Ga0006562J51391_1057395 | Ga0006562J51391_10573951 | 144 |
| 158 | 3300003771 | Ga0055526_1076962 | Ga0055526_10769621 | 144 |
| 159 | 3300003794 | Ga0055531_10000104 | Ga0055531_100001049 | 144 |
| 160 | 3300005262 | Ga0065165_1057060 | Ga0065165_10570601 | 144 |
| 161 | 3300005288 | Ga0065714_10071155 | Ga0065714_100711554 | 144 |
| 162 | 3300005288 | Ga0065714_10076072 | Ga0065714_100760721 | 144 |
| 163 | 3300005288 | Ga0065714_10244477 | Ga0065714_102444771 | 144 |
| 164 | 3300005288 | Ga0065714_10248088 | Ga0065714_102480882 | 144 |
| 165 | 3300005289 | Ga0065704_10072920 | Ga0065704_100729205 | 144 |
| 166 | 3300005289 | Ga0065704_10366593 | Ga0065704_103665932 | 144 |
| 167 | 3300005293 | Ga0065715_10200358 | Ga0065715_102003582 | 144 |
| 168 | 3300005293 | Ga0065715_10536852 | Ga0065715_105368522 | 144 |
| 169 | 3300005353 | Ga0070669_100297274 | Ga0070669_1002972741 | 144 |
| 170 | 3300005455 | Ga0070663_101499412 | Ga0070663_1014994121 | 144 |
| 171 | 3300005530 | Ga0070679_100000415 | Ga0070679_1000004159 | 144 |
| 172 | 3300005539 | Ga0068853_100141613 | Ga0068853_1001416132 | 144 |
| 173 | 3300005543 | Ga0070672_100332812 | Ga0070672_1003328122 | 144 |
| 174 | 3300005543 | Ga0070672_101441076 | Ga0070672_1014410761 | 144 |
| 175 | 3300005544 | Ga0070686_100000007 | Ga0070686_100000007185 | 144 |
| 176 | 3300005547 | Ga0070693_100007791 | Ga0070693_1000077913 | 144 |
| 177 | 3300005563 | Ga0068855_100049427 | Ga0068855_1000494272 | 144 |
| 178 | 3300005577 | Ga0068857_102279237 | Ga0068857_1022792371 | 144 |
| 179 | 3300005578 | Ga0068854_100368588 | Ga0068854_1003685881 | 144 |
| 180 | 3300005614 | Ga0068856_100016947 | Ga0068856_1000169473 | 144 |
| 181 | 3300005840 | Ga0068870_10164973 | Ga0068870_101649732 | 144 |
| 182 | 3300006038 | Ga0075365_10041421 | Ga0075365_100414213 | 144 |
| 183 | 3300006042 | Ga0075368_10024780 | Ga0075368_100247802 | 144 |
| 184 | 3300006178 | Ga0075367_10008634 | Ga0075367_100086344 | 144 |
| 185 | 3300006353 | Ga0075370_10124220 | Ga0075370_101242202 | 144 |
| 186 | 3300006353 | Ga0075370_10672915 | Ga0075370_106729151 | 144 |
| 187 | 3300006948 | Ga0099826_10436516 | Ga0099826_104365161 | 144 |
| 188 | 3300009011 | Ga0105251_10030030 | Ga0105251_100300304 | 144 |
| 189 | 3300009036 | Ga0105244_10000201 | Ga0105244_1000020117 | 144 |
| 190 | 3300009036 | Ga0105244_10187245 | Ga0105244_101872451 | 144 |
| 191 | 3300009092 | Ga0105250_10010368 | Ga0105250_100103682 | 144 |
| 192 | 3300009092 | Ga0105250_10263920 | Ga0105250_102639201 | 144 |
| 193 | 3300009093 | Ga0105240_10003959 | Ga0105240_1000395910 | 144 |
| 194 | 3300009093 | Ga0105240_10412696 | Ga0105240_104126962 | 144 |
| 195 | 3300009093 | Ga0105240_10509014 | Ga0105240_105090141 | 144 |
| 196 | 3300009093 | Ga0105240_10721060 | Ga0105240_107210602 | 144 |
| 197 | 3300009098 | Ga0105245_10463336 | Ga0105245_104633362 | 144 |
| 198 | 3300009101 | Ga0105247_10899222 | Ga0105247_108992221 | 144 |
| 199 | 3300009148 | Ga0105243_10364562 | Ga0105243_103645622 | 144 |
| 200 | 3300009148 | Ga0105243_10992211 | Ga0105243_109922111 | 144 |
| 201 | 3300009174 | Ga0105241_10087105 | Ga0105241_100871052 | 144 |
| 202 | 3300009174 | Ga0105241_10181221 | Ga0105241_101812212 | 144 |
| 203 | 3300009545 | Ga0105237_10007199 | Ga0105237_100071992 | 144 |
| 204 | 3300009545 | Ga0105237_10010066 | Ga0105237_100100663 | 144 |
| 205 | 3300009551 | Ga0105238_10137072 | Ga0105238_101370724 | 144 |
| 206 | 3300009553 | Ga0105249_10108628 | Ga0105249_101086282 | 144 |
| 207 | 3300009553 | Ga0105249_12171746 | Ga0105249_121717461 | 144 |
| 208 | 3300010375 | Ga0105239_10000008 | Ga0105239_10000008110 | 144 |
| 209 | 3300010375 | Ga0105239_10000256 | Ga0105239_1000025648 | 144 |
| 210 | 3300010375 | Ga0105239_10015160 | Ga0105239_100151602 | 144 |
| 211 | 3300010375 | Ga0105239_10972266 | Ga0105239_109722662 | 144 |
| 212 | 3300011119 | Ga0105246_10047265 | Ga0105246_100472651 | 144 |
| 213 | 3300013100 | Ga0157373_10002593 | Ga0157373_100025932 | 144 |
| 214 | 3300013100 | Ga0157373_10116952 | Ga0157373_101169522 | 144 |
| 215 | 3300013102 | Ga0157371_10003257 | Ga0157371_100032578 | 144 |
| 216 | 3300013102 | Ga0157371_10030689 | Ga0157371_100306896 | 144 |
| 217 | 3300013102 | Ga0157371_10600262 | Ga0157371_106002621 | 144 |
| 218 | 3300013104 | Ga0157370_10000134 | Ga0157370_1000013496 | 144 |
| 219 | 3300013104 | Ga0157370_10009827 | Ga0157370_100098278 | 144 |
| 220 | 3300013104 | Ga0157370_11336599 | Ga0157370_113365992 | 144 |
| 221 | 3300013105 | Ga0157369_10001052 | Ga0157369_100010526 | 144 |
| 222 | 3300013306 | Ga0163162_10440737 | Ga0163162_104407372 | 144 |
| 223 | 3300013307 | Ga0157372_10064294 | Ga0157372_100642945 | 144 |
| 224 | 3300013307 | Ga0157372_10094520 | Ga0157372_100945204 | 144 |
| 225 | 3300013308 | Ga0157375_10066839 | Ga0157375_100668395 | 144 |
| 226 | 3300014325 | Ga0163163_10599502 | Ga0163163_105995022 | 144 |
| 227 | 3300014497 | Ga0182008_10000034 | Ga0182008_1000003459 | 144 |
| 228 | 3300014969 | Ga0157376_11077031 | Ga0157376_110770311 | 144 |
| 229 | 3300014969 | Ga0157376_11699673 | Ga0157376_116996732 | 144 |
| 230 | 3300015261 | Ga0182006_1002474 | Ga0182006_10024743 | 144 |
| 231 | 3300015261 | Ga0182006_1008371 | Ga0182006_10083714 | 144 |
| 232 | 3300015261 | Ga0182006_1017652 | Ga0182006_10176523 | 144 |
| 233 | 3300017792 | Ga0163161_10000922 | Ga0163161_1000092215 | 144 |
| 234 | 3300017792 | Ga0163161_10196783 | Ga0163161_101967832 | 144 |
| 235 | 3300025229 | Ga0209147_106110 | Ga0209147_1061102 | 144 |
| 236 | 3300025233 | Ga0209437_100017 | Ga0209437_100017272 | 144 |
| 237 | 3300025246 | Ga0209646_1000122 | Ga0209646_100012260 | 144 |
| 238 | 3300025250 | Ga0209026_1000329 | Ga0209026_100032921 | 144 |
| 239 | 3300025273 | Ga0209673_1009305 | Ga0209673_10093052 | 144 |
| 240 | 3300025284 | Ga0209130_1039520 | Ga0209130_10395201 | 144 |
| 241 | 3300025294 | Ga0209025_1001072 | Ga0209025_100107222 | 144 |
| 242 | 3300025294 | Ga0209025_1001789 | Ga0209025_100178920 | 144 |
| 243 | 3300025295 | Ga0209564_1008257 | Ga0209564_10082572 | 144 |
| 244 | 3300025297 | Ga0209758_1005260 | Ga0209758_10052609 | 144 |
| 245 | 3300025302 | Ga0207426_1001512 | Ga0207426_10015126 | 144 |
| 246 | 3300025302 | Ga0207426_1009457 | Ga0207426_10094575 | 144 |
| 247 | 3300025304 | Ga0209257_1000013 | Ga0209257_1000013244 | 144 |
| 248 | 3300025711 | Ga0207696_1112235 | Ga0207696_11122351 | 144 |
| 249 | 3300025728 | Ga0207655_1000381 | Ga0207655_100038117 | 144 |
| 250 | 3300025735 | Ga0207713_1027134 | Ga0207713_10271341 | 144 |
| 251 | 3300025901 | Ga0207688_10296604 | Ga0207688_102966042 | 144 |
| 252 | 3300025908 | Ga0207643_10110301 | Ga0207643_101103012 | 144 |
| 253 | 3300025913 | Ga0207695_10007718 | Ga0207695_100077185 | 144 |
| 254 | 3300025913 | Ga0207695_10101866 | Ga0207695_101018665 | 144 |
| 255 | 3300025914 | Ga0207671_10005635 | Ga0207671_100056353 | 144 |
| 256 | 3300025914 | Ga0207671_10014905 | Ga0207671_100149054 | 144 |
| 257 | 3300025921 | Ga0207652_10000016 | Ga0207652_1000001617 | 144 |
| 258 | 3300025923 | Ga0207681_10651385 | Ga0207681_106513851 | 144 |
| 259 | 3300025925 | Ga0207650_11441008 | Ga0207650_114410081 | 144 |
| 260 | 3300025935 | Ga0207709_10217813 | Ga0207709_102178132 | 144 |
| 261 | 3300025949 | Ga0207667_10069624 | Ga0207667_100696245 | 144 |
| 262 | 3300025949 | Ga0207667_10086441 | Ga0207667_100864413 | 144 |
| 263 | 3300025981 | Ga0207640_10015839 | Ga0207640_100158396 | 144 |
| 264 | 3300026041 | Ga0207639_12063627 | Ga0207639_120636271 | 144 |
| 265 | 3300026116 | Ga0207674_11144190 | Ga0207674_111441901 | 144 |
| 266 | 3300027866 | Ga0209813_10009922 | Ga0209813_100099222 | 144 |
| 267 | 3300028794 | Ga0307515_10000353 | Ga0307515_1000035373 | 144 |
| 268 | 3300028794 | Ga0307515_10005513 | Ga0307515_1000551330 | 144 |
| 269 | 3300028794 | Ga0307515_10033940 | Ga0307515_100339403 | 144 |
| 270 | 3300028794 | Ga0307515_10132920 | Ga0307515_101329203 | 144 |
| 271 | 3300028794 | Ga0307515_10290675 | Ga0307515_102906751 | 144 |
| 272 | 3300030522 | Ga0307512_10050498 | Ga0307512_100504983 | 144 |
| 273 | 3300030522 | Ga0307512_10285186 | Ga0307512_102851861 | 144 |
| 274 | 3300030731 | Ga0316177_1128036 | Ga0316177_11280362 | 144 |
| 275 | 3300031251 | Ga0265327_10000006 | Ga0265327_10000006230 | 144 |
| 276 | 3300031251 | Ga0265327_10025157 | Ga0265327_100251574 | 144 |
| 277 | 3300031251 | Ga0265327_10075306 | Ga0265327_100753063 | 144 |
| 278 | 3300031456 | Ga0307513_10009379 | Ga0307513_100093793 | 144 |
| 279 | 3300031456 | Ga0307513_10047943 | Ga0307513_100479431 | 144 |
| 280 | 3300031456 | Ga0307513_10576802 | Ga0307513_105768021 | 144 |
| 281 | 3300031548 | Ga0307408_100042156 | Ga0307408_1000421562 | 144 |
| 282 | 3300031616 | Ga0307508_10047628 | Ga0307508_100476284 | 144 |
| 283 | 3300031649 | Ga0307514_10197725 | Ga0307514_101977252 | 144 |
| 284 | 3300031649 | Ga0307514_10357840 | Ga0307514_103578401 | 144 |
| 285 | 3300031731 | Ga0307405_10022711 | Ga0307405_100227114 | 144 |
| 286 | 3300031852 | Ga0307410_10851273 | Ga0307410_108512732 | 144 |
| 287 | 3300031903 | Ga0307407_10069916 | Ga0307407_100699161 | 144 |
| 288 | 3300031911 | Ga0307412_10000049 | Ga0307412_1000004937 | 144 |
| 289 | 3300031911 | Ga0307412_10765046 | Ga0307412_107650461 | 144 |
| 290 | 3300032002 | Ga0307416_100022952 | Ga0307416_1000229524 | 144 |
| 291 | 3300032002 | Ga0307416_100027471 | Ga0307416_1000274712 | 144 |
| 292 | 3300032004 | Ga0307414_10005831 | Ga0307414_100058316 | 144 |
| 293 | 3300032004 | Ga0307414_10025379 | Ga0307414_100253793 | 144 |
| 294 | 3300032004 | Ga0307414_10049838 | Ga0307414_100498384 | 144 |
| 295 | 3300032004 | Ga0307414_10111620 | Ga0307414_101116202 | 144 |
| 296 | 3300032004 | Ga0307414_10167054 | Ga0307414_101670542 | 144 |
| 297 | 3300032004 | Ga0307414_11753461 | Ga0307414_117534611 | 144 |
| 298 | 3300032005 | Ga0307411_10000004 | Ga0307411_10000004443 | 144 |
| 299 | 3300032005 | Ga0307411_11099625 | Ga0307411_110996251 | 144 |
| 300 | 3300032126 | Ga0307415_100019356 | Ga0307415_1000193564 | 144 |
| 301 | 3300033179 | Ga0307507_10000362 | Ga0307507_1000036211 | 144 |
| 302 | 3300033179 | Ga0307507_10311738 | Ga0307507_103117381 | 144 |
| 303 | 3300033180 | Ga0307510_10068758 | Ga0307510_100687582 | 144 |
| 304 | 3300033180 | Ga0307510_10085718 | Ga0307510_100857181 | 144 |
| 305 | 3300037418 | Ga0395900_0619352 | Ga0395900_0619352_173_658 | 144 |
| 306 | 3300037418 | Ga0395900_0820778 | Ga0395900_0820778_13_483 | 144 |
| 307 | 3300039450 | Ga0436363_1578705 | Ga0436363_1578705_353_823 | 144 |
| 308 | 3300039453 | Ga0436362_1225224 | Ga0436362_1225224_589_1032 | 144 |
| 309 | 3300041404 | Ga0439436_0021983 | Ga0439436_0021983_271_738 | 144 |
| 310 | 3300041406 | Ga0439439_0106950 | Ga0439439_0106950_21_461 | 144 |
| 311 | 3300041407 | Ga0439447_004295 | Ga0439447_004295_189_623 | 144 |
| 312 | 3300041441 | Ga0451787_094168 | Ga0451787_094168_93_581 | 144 |
| 313 | 3300041452 | Ga0451793_0428212 | Ga0451793_0428212_12_479 | 144 |
| 314 | 3300041452 | Ga0451793_1195031 | Ga0451793_1195031_427_864 | 144 |
| 315 | 3300041456 | Ga0451795_0246016 | Ga0451795_0246016_48_497 | 144 |
| 316 | 3300041486 | Ga0451807_0222980 | Ga0451807_0222980_237_728 | 144 |
| 317 | 3300041512 | Ga0451853_0842481 | Ga0451853_0842481_1211_1702 | 144 |
| 318 | 3300041512 | Ga0451853_1390141 | Ga0451853_1390141_5571_6056 | 144 |
| 319 | 3300041512 | Ga0451853_2021448 | Ga0451853_2021448_1589_2074 | 144 |
| 320 | 3300041512 | Ga0451853_2072721 | Ga0451853_2072721_566_1051 | 144 |
| 321 | 3300042002 | Ga0439442_027232 | Ga0439442_027232_517_984 | 144 |
| 322 | 3300042005 | Ga0439448_0014792 | Ga0439448_0014792_1617_2105 | 144 |
| 323 | 3300042007 | Ga0439449_0010774 | Ga0439449_0010774_883_1323 | 144 |
| 324 | 3300042007 | Ga0439449_0021745 | Ga0439449_0021745_1658_2125 | 144 |
| 325 | 3300042007 | Ga0439449_0160192 | Ga0439449_0160192_156_647 | 144 |
| 326 | 3300042007 | Ga0439449_0317165 | Ga0439449_0317165_20_493 | 144 |
| 327 | 3300042012 | Ga0439455_0003760 | Ga0439455_0003760_1811_2299 | 144 |
| 328 | 3300042015 | Ga0439462_0075525 | Ga0439462_0075525_37_504 | 144 |
| 329 | 3300042138 | Ga0450903_008829 | Ga0450903_008829_432_920 | 144 |
| 330 | 3300042157 | Ga0439458_0002003 | Ga0439458_0002003_453_941 | 144 |
| 331 | 3300044656 | Ga0466969_0000451 | Ga0466969_0000451_18528_18968 | 144 |
| 332 | 3300044658 | Ga0466972_0011561 | Ga0466972_0011561_1643_2128 | 144 |
| 333 | 3300044683 | Ga0466965_0001081 | Ga0466965_0001081_248_733 | 144 |
| 334 | 3300044684 | Ga0466966_0001814 | Ga0466966_0001814_11386_11871 | 144 |
| 335 | 3300044684 | Ga0466966_0003200 | Ga0466966_0003200_1254_1694 | 144 |
| 336 | 3300044693 | Ga0466961_0001727 | Ga0466961_0001727_8179_8619 | 144 |
| 337 | 3300044693 | Ga0466961_0002469 | Ga0466961_0002469_1785_2270 | 144 |
| 338 | 3300044694 | Ga0466963_0051646 | Ga0466963_0051646_262_747 | 144 |
| 339 | 3300044706 | Ga0466964_0299359 | Ga0466964_0299359_150_635 | 144 |
| 340 | 3300044719 | Ga0466971_0001603 | Ga0466971_0001603_8822_9307 | 144 |
| 341 | 3300044765 | Ga0466970_0000971 | Ga0466970_0000971_6334_6819 | 144 |
| 342 | 3300044765 | Ga0466970_0012511 | Ga0466970_0012511_1472_1912 | 144 |
| 343 | 3300044765 | Ga0466970_0135403 | Ga0466970_0135403_654_1187 | 144 |
| 344 | 3300044842 | Ga0466957_0002710 | Ga0466957_0002710_8821_9306 | 144 |
| 345 | 3300044842 | Ga0466957_0003736 | Ga0466957_0003736_6003_6440 | 144 |
| 346 | 3300045049 | Ga0466959_0000182 | Ga0466959_0000182_35706_36146 | 144 |
| 347 | 3300045049 | Ga0466959_0002105 | Ga0466959_0002105_9953_10438 | 144 |
| 348 | 3300045836 | Ga0466958_0000961 | Ga0466958_0000961_11387_11872 | 144 |
| 349 | 3300045976 | Ga0466967_0000560 | Ga0466967_0000560_10765_11250 | 144 |
| 350 | 3300046455 | Ga0495603_0033465 | Ga0495603_0033465_1094_1585 | 144 |
| 351 | 3300046457 | Ga0495590_0031788 | Ga0495590_0031788_382_873 | 144 |
| 352 | 3300046459 | Ga0495629_0018902 | Ga0495629_0018902_1911_2402 | 144 |
| 353 | 3300046460 | Ga0495638_0424890 | Ga0495638_0424890_183_617 | 144 |
| 354 | 3300046471 | Ga0495650_0134882 | Ga0495650_0134882_410_844 | 144 |
| 355 | 3300046476 | Ga0495662_0192847 | Ga0495662_0192847_198_689 | 144 |
| 356 | 3300046492 | Ga0495585_0000388 | Ga0495585_0000388_25848_26288 | 144 |
| 357 | 3300046492 | Ga0495585_0107778 | Ga0495585_0107778_450_941 | 144 |
| 358 | 3300046492 | Ga0495585_0360579 | Ga0495585_0360579_258_695 | 144 |
| 359 | 3300046499 | Ga0495594_0184624 | Ga0495594_0184624_247_738 | 144 |
| 360 | 3300046499 | Ga0495594_0429043 | Ga0495594_0429043_247_738 | 144 |
| 361 | 3300046507 | Ga0495606_0000074 | Ga0495606_0000074_69499_69933 | 144 |
| 362 | 3300046507 | Ga0495606_0004380 | Ga0495606_0004380_9999_10490 | 144 |
| 363 | 3300046507 | Ga0495606_0006049 | Ga0495606_0006049_3677_4111 | 144 |
| 364 | 3300046507 | Ga0495606_0017582 | Ga0495606_0017582_2456_2920 | 144 |
| 365 | 3300046507 | Ga0495606_0028451 | Ga0495606_0028451_362_811 | 144 |
| 366 | 3300046507 | Ga0495606_0085940 | Ga0495606_0085940_1059_1496 | 144 |
| 367 | 3300046511 | Ga0495608_0073014 | Ga0495608_0073014_950_1441 | 144 |
| 368 | 3300046512 | Ga0495610_0029208 | Ga0495610_0029208_969_1460 | 144 |
| 369 | 3300046512 | Ga0495610_0057176 | Ga0495610_0057176_291_725 | 144 |
| 370 | 3300046513 | Ga0495616_0006996 | Ga0495616_0006996_3656_4093 | 144 |
| 371 | 3300046513 | Ga0495616_0008620 | Ga0495616_0008620_3008_3499 | 144 |
| 372 | 3300046513 | Ga0495616_0293361 | Ga0495616_0293361_224_664 | 144 |
| 373 | 3300046514 | Ga0495618_0224704 | Ga0495618_0224704_602_1093 | 144 |
| 374 | 3300046515 | Ga0495620_0034178 | Ga0495620_0034178_445_936 | 144 |
| 375 | 3300046516 | Ga0495628_0067106 | Ga0495628_0067106_1044_1535 | 144 |
| 376 | 3300046517 | Ga0495630_0135145 | Ga0495630_0135145_140_631 | 144 |
| 377 | 3300046520 | Ga0495637_0019315 | Ga0495637_0019315_751_1242 | 144 |
| 378 | 3300046522 | Ga0495643_0006478 | Ga0495643_0006478_1653_2144 | 144 |
| 379 | 3300046522 | Ga0495643_0034893 | Ga0495643_0034893_1903_2346 | 144 |
| 380 | 3300046523 | Ga0495644_0163266 | Ga0495644_0163266_125_559 | 144 |
| 381 | 3300046524 | Ga0495648_0008222 | Ga0495648_0008222_454_894 | 144 |
| 382 | 3300046524 | Ga0495648_0213277 | Ga0495648_0213277_58_498 | 144 |
| 383 | 3300046525 | Ga0495663_0047279 | Ga0495663_0047279_50_484 | 144 |
| 384 | 3300046526 | Ga0495666_0025458 | Ga0495666_0025458_2380_2871 | 144 |
| 385 | 3300046528 | Ga0495642_0211994 | Ga0495642_0211994_370_807 | 144 |
| 386 | 3300046529 | Ga0495652_0135326 | Ga0495652_0135326_1432_1923 | 144 |
| 387 | 3300046533 | Ga0495640_0103707 | Ga0495640_0103707_1311_1802 | 144 |
| 388 | 3300046538 | Ga0495609_0034029 | Ga0495609_0034029_333_767 | 144 |
| 389 | 3300046557 | Ga0495622_0010743 | Ga0495622_0010743_2637_3128 | 144 |
| 390 | 3300046557 | Ga0495622_0055525 | Ga0495622_0055525_1361_1801 | 144 |
| 391 | 3300046557 | Ga0495622_0335435 | Ga0495622_0335435_40_531 | 144 |
| 392 | 3300046558 | Ga0495633_0000027 | Ga0495633_0000027_151792_152232 | 144 |
| 393 | 3300046558 | Ga0495633_0004447 | Ga0495633_0004447_3577_4014 | 144 |
| 394 | 3300046558 | Ga0495633_0124349 | Ga0495633_0124349_56_490 | 144 |
| 395 | 3300046559 | Ga0495667_0672677 | Ga0495667_0672677_12_503 | 144 |
| 396 | 3300046559 | Ga0495667_0821509 | Ga0495667_0821509_62_553 | 144 |
| 397 | 3300046616 | Ga0495668_0000010 | Ga0495668_0000010_38600_39040 | 144 |
| 398 | 3300046642 | Ga0495634_0381750 | Ga0495634_0381750_192_683 | 144 |
| 399 | 3300046648 | Ga0495611_0069259 | Ga0495611_0069259_247_738 | 144 |
| 400 | 3300046660 | Ga0495625_0025338 | Ga0495625_0025338_3551_3988 | 144 |
| 401 | 3300046660 | Ga0495625_0184263 | Ga0495625_0184263_748_1182 | 144 |
| 402 | 3300046665 | Ga0495661_0040743 | Ga0495661_0040743_1219_1710 | 144 |
| 403 | 3300046675 | Ga0495657_0030837 | Ga0495657_0030837_2173_2664 | 144 |
| 404 | 3300046679 | Ga0495623_0038597 | Ga0495623_0038597_524_1015 | 144 |
| 405 | 3300046680 | Ga0495646_0313190 | Ga0495646_0313190_44_535 | 144 |
| 406 | 3300046683 | Ga0495658_0094445 | Ga0495658_0094445_244_684 | 144 |
| 407 | 3300046689 | Ga0495613_0787035 | Ga0495613_0787035_117_608 | 144 |
| 408 | 3300046689 | Ga0495613_0791070 | Ga0495613_0791070_107_598 | 144 |
| 409 | 3300046690 | Ga0495624_0032786 | Ga0495624_0032786_2509_3000 | 144 |
| 410 | 3300046690 | Ga0495624_0140191 | Ga0495624_0140191_252_743 | 144 |
| 411 | 3300046691 | Ga0495670_0152220 | Ga0495670_0152220_249_683 | 144 |
| 412 | 3300046692 | Ga0495671_0218809 | Ga0495671_0218809_29_463 | 144 |
| 413 | 3300046694 | Ga0495649_0038296 | Ga0495649_0038296_1533_2024 | 144 |
| 414 | 3300046809 | Ga0495600_0851540 | Ga0495600_0851540_21_512 | 144 |
| 415 | 3300046810 | Ga0495660_0216802 | Ga0495660_0216802_364_855 | 144 |
| 416 | 3300046810 | Ga0495660_0378822 | Ga0495660_0378822_41_535 | 144 |
| 417 | 3300047315 | Ga0495581_0130138 | Ga0495581_0130138_772_1263 | 144 |
| 418 | 3300047317 | Ga0495604_0045469 | Ga0495604_0045469_2545_3036 | 144 |
| 419 | 3300047318 | Ga0495636_0050896 | Ga0495636_0050896_1223_1714 | 144 |
| 420 | 3300047320 | Ga0495672_0081353 | Ga0495672_0081353_16_507 | 144 |
| 421 | 3300047321 | Ga0495676_0012453 | Ga0495676_0012453_3195_3686 | 144 |
| 422 | 3300047321 | Ga0495676_0068551 | Ga0495676_0068551_883_1374 | 144 |
| 423 | 3300047322 | Ga0495680_0016059 | Ga0495680_0016059_293_784 | 144 |
| 424 | 3300047322 | Ga0495680_0018359 | Ga0495680_0018359_5409_5900 | 144 |
| 425 | 3300047443 | Ga0495687_011324 | Ga0495687_011324_922_1413 | 144 |
| 426 | 3300047443 | Ga0495687_049857 | Ga0495687_049857_612_1103 | 144 |
| 427 | 3300047445 | Ga0495677_0163530 | Ga0495677_0163530_345_836 | 144 |
| 428 | 3300047447 | Ga0495685_114709 | Ga0495685_114709_342_833 | 144 |
| 429 | 3300047470 | Ga0495681_0027610 | Ga0495681_0027610_25_516 | 144 |
| 430 | 3300047471 | Ga0495684_0865832 | Ga0495684_0865832_33_524 | 144 |
| 431 | 3300047472 | Ga0495686_0000249 | Ga0495686_0000249_27507_27941 | 144 |
| 432 | 3300047472 | Ga0495686_0000386 | Ga0495686_0000386_8186_8629 | 144 |
| 433 | 3300047472 | Ga0495686_0000582 | Ga0495686_0000582_10678_11115 | 144 |
| 434 | 3300047472 | Ga0495686_0000587 | Ga0495686_0000587_35750_36190 | 144 |
| 435 | 3300047472 | Ga0495686_0001554 | Ga0495686_0001554_17491_17925 | 144 |
| 436 | 3300047472 | Ga0495686_0066967 | Ga0495686_0066967_1742_2176 | 144 |
| 437 | 3300047673 | Ga0495593_0008174 | Ga0495593_0008174_2044_2535 | 144 |
| 438 | 3300047673 | Ga0495593_0072907 | Ga0495593_0072907_25_516 | 144 |
| 439 | 3300048089 | Ga0495614_0013162 | Ga0495614_0013162_2357_2797 | 144 |
| 440 | 3300048089 | Ga0495614_0029728 | Ga0495614_0029728_1795_2286 | 144 |
| 441 | 3300048089 | Ga0495614_0070246 | Ga0495614_0070246_46_537 | 144 |
| 442 | 3300048091 | Ga0495626_0019938 | Ga0495626_0019938_2839_3330 | 144 |
| 443 | 3300048904 | Ga0496101_0281832 | Ga0496101_0281832_707_1147 | 144 |
| 444 | 3300048919 | Ga0496116_0000024 | Ga0496116_0000024_465914_466399 | 144 |
| 445 | 3300048920 | Ga0496117_0218606 | Ga0496117_0218606_301_786 | 144 |
| 446 | 3300048921 | Ga0496118_0080707 | Ga0496118_0080707_452_937 | 144 |
| 447 | 3300048924 | Ga0496121_0019380 | Ga0496121_0019380_2225_2659 | 144 |
| 448 | 3300048924 | Ga0496121_0163799 | Ga0496121_0163799_838_1323 | 144 |
| 449 | 3300048927 | Ga0496124_0017724 | Ga0496124_0017724_3611_4096 | 144 |
| 450 | 3300048927 | Ga0496124_0177392 | Ga0496124_0177392_889_1323 | 144 |
| 451 | 3300048928 | Ga0496125_0000018 | Ga0496125_0000018_5167_5652 | 144 |
| 452 | 3300048929 | Ga0496126_0014506 | Ga0496126_0014506_3149_3634 | 144 |
| 453 | 3300048929 | Ga0496126_0018225 | Ga0496126_0018225_6443_6883 | 144 |
| 454 | 3300049459 | Ga0495678_056852 | Ga0495678_056852_236_727 | 144 |
| 455 | 3300049460 | Ga0495682_0113112 | Ga0495682_0113112_48_539 | 144 |
| 456 | 3300049569 | Ga0501032_0466896 | Ga0501032_0466896_333_767 | 144 |
| 457 | 3300049570 | Ga0501033_0397782 | Ga0501033_0397782_136_570 | 144 |
| 458 | 3300049571 | Ga0501034_0924455 | Ga0501034_0924455_225_659 | 144 |
| 459 | 3300049649 | Ga0501198_090711 | Ga0501198_090711_64_543 | 144 |
| 460 | 3300049671 | Ga0501238_002146 | Ga0501238_002146_514_948 | 144 |
| 461 | 3300049758 | Ga0501241_004732 | Ga0501241_004732_718_1152 | 144 |
| 462 | 3300049763 | Ga0501266_000002 | Ga0501266_000002_4415_4849 | 144 |
| 463 | 3300049766 | Ga0501269_001832 | Ga0501269_001832_1705_2139 | 144 |
| 464 | 3300049776 | Ga0501280_002242 | Ga0501280_002242_2705_3148 | 144 |
| 465 | 3300049822 | Ga0501035_0436176 | Ga0501035_0436176_112_546 | 144 |
| 466 | 3300050490 | nmdc:mga03n38_716763_c1 | nmdc:mga03n38_716763_c1_43_534 | 144 |
| 467 | 3300050492 | nmdc:mga0yw44_123704_c1 | nmdc:mga0yw44_123704_c1_410_904 | 144 |
| 468 | 3300050494 | nmdc:mga06z11_5136_c1 | nmdc:mga06z11_5136_c1_3617_4096 | 144 |
| 469 | 3300050495 | nmdc:mga04h51_13231_c1 | nmdc:mga04h51_13231_c1_725_1204 | 144 |
| 470 | 3300053080 | Ga0500635_0000558 | Ga0500635_0000558_1612_2058 | 144 |
| 471 | 3300053080 | Ga0500635_0021064 | Ga0500635_0021064_161_595 | 144 |
| 472 | 3300053088 | Ga0500644_0002380 | Ga0500644_0002380_1338_1832 | 144 |
| 473 | 3300053088 | Ga0500644_0012972 | Ga0500644_0012972_85_519 | 144 |
| 474 | 3300053088 | Ga0500644_0049063 | Ga0500644_0049063_66_500 | 144 |
| 475 | 3300053090 | Ga0500646_0011416 | Ga0500646_0011416_1383_1817 | 144 |
| 476 | 3300053090 | Ga0500646_0167667 | Ga0500646_0167667_256_690 | 144 |
| 477 | 3300053093 | Ga0500651_0000756 | Ga0500651_0000756_2314_2772 | 144 |
| 478 | 3300053093 | Ga0500651_0015489 | Ga0500651_0015489_2275_2712 | 144 |
| 479 | 3300053093 | Ga0500651_0037850 | Ga0500651_0037850_1252_1686 | 144 |
| 480 | 3300053096 | Ga0500641_0000143 | Ga0500641_0000143_4041_4475 | 144 |
| 481 | 3300053096 | Ga0500641_0003775 | Ga0500641_0003775_3723_4157 | 144 |
| 482 | 3300053107 | Ga0500560_058057 | Ga0500560_058057_705_1193 | 144 |
| 483 | 3300053108 | Ga0500562_000111 | Ga0500562_000111_4402_4836 | 144 |
| 484 | 3300053118 | Ga0500594_0047530 | Ga0500594_0047530_100_534 | 144 |
| 485 | 3300053123 | Ga0500614_286395 | Ga0500614_286395_46_486 | 144 |
| 486 | 3300053125 | Ga0500618_000013 | Ga0500618_000013_128462_128896 | 144 |
| 487 | 3300053134 | Ga0500658_0000002 | Ga0500658_0000002_543636_544070 | 144 |
| 488 | 3300053137 | Ga0500561_0035330 | Ga0500561_0035330_172_666 | 144 |
| 489 | 3300053138 | Ga0500564_095564 | Ga0500564_095564_751_1188 | 144 |
| 490 | 3300053139 | Ga0500568_0062607 | Ga0500568_0062607_463_897 | 144 |
| 491 | 3300053140 | Ga0500573_0029975 | Ga0500573_0029975_79_567 | 144 |
| 492 | 3300053147 | Ga0500589_144834 | Ga0500589_144834_310_804 | 144 |
| 493 | 3300053153 | Ga0500616_0368440 | Ga0500616_0368440_49_486 | 144 |
| 494 | 3300053153 | Ga0500616_0397564 | Ga0500616_0397564_57_500 | 144 |
| 495 | 3300053156 | Ga0500622_0000086 | Ga0500622_0000086_29037_29471 | 144 |
| 496 | 3300053156 | Ga0500622_0000354 | Ga0500622_0000354_20451_20888 | 144 |
| 497 | 3300053156 | Ga0500622_0001279 | Ga0500622_0001279_8035_8469 | 144 |
| 498 | 3300053157 | Ga0500624_000158 | Ga0500624_000158_4797_5234 | 144 |
| 499 | 3300053158 | Ga0500627_0237856 | Ga0500627_0237856_106_543 | 144 |
| 500 | 3300053160 | Ga0500633_0000863 | Ga0500633_0000863_2904_3398 | 144 |
| 501 | 3300053177 | Ga0500636_0005090 | Ga0500636_0005090_4615_5109 | 144 |
| 502 | 3300053726 | Ga0500584_025201 | Ga0500584_025201_1560_1994 | 144 |
| 503 | 3300053730 | Ga0500645_003030 | Ga0500645_003030_4910_5344 | 144 |
| 504 | 3300055283 | Ga0500661_008673 | Ga0500661_008673_1405_1839 | 144 |
| 505 | 3300061719 | Ga0466962_0002543 | Ga0466962_0002543_8134_8619 | 144 |
| 506 | 3300061719 | Ga0466962_0057525 | Ga0466962_0057525_217_657 | 144 |
| 507 | iso_pu_bacteria | 2582581313 | 2585306219 | 144 |
| 508 | iso_pu_bacteria | 2582581314 | 2585313782 | 144 |
| 509 | iso_pu_bacteria | 2616644814 | 2616696632 | 144 |
| 510 | iso_pu_bacteria | 2643221714 | 2644633144 | 144 |
| 511 | iso_pu_bacteria | 2751185782 | 2753266273 | 144 |
| 512 | iso_pu_bacteria | 2784746763 | 2785339210 | 144 |
| 513 | iso_pu_bacteria | 2784746768 | 2785370929 | 144 |
| 514 | iso_pu_bacteria | 2786546132 | 2786672105 | 144 |
| 515 | iso_pu_bacteria | 2808606359 | 2808843486 | 144 |
| 516 | iso_pu_bacteria | 2862382967 | 2862382990 | 144 |
| 517 | iso_pu_bacteria | 2863404153 | 2863410727 | 144 |
| 518 | iso_pu_bacteria | 2946072368 | 2946077254 | 144 |
| 519 | iso_pu_bacteria | 2954002825 | 2954004889 | 144 |
| 520 | iso_pu_bacteria | 2954673503 | 2954678378 | 144 |
| 521 | iso_pu_bacteria | 2954682443 | 2954685777 | 144 |
| 522 | iso_pu_bacteria | 2954691527 | 2954695414 | 144 |
| 523 | iso_pu_bacteria | 2954701450 | 2954710607 | 144 |
| 524 | iso_pu_bacteria | 2990059506 | 2990066828 | 144 |
| 525 | iso_pu_bacteria | 8008558824 | 8008564770 | 144 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.9815 | 10 | 141 |
| 2gmy-assembly1.cif.gz_C | crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd | 0.9801 | 4 | 144 |
| 7xw1-assembly1.cif.gz_A | the crystal structure of ahpd from pseudomonas aeruginosa | 0.967 | 10 | 141 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.962 | 1 | 144 |
| 2ijc-assembly2.cif.gz_I | structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa | 0.9555 | 1 | 144 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2gmyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9834 | 4 | 144 | 1.20.1290.10 |
| 2gmyF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9566 | 4 | 144 | 1.20.1290.10 |
| af_Q2FVE0_2_139_1.20.1290.10 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9557 | 6 | 140 | 1.20.1290.10 |
| 2ijcF00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9541 | 2 | 143 | 1.20.1290.10 |
| 2o4dA00 | Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like | 0.9488 | 2 | 144 | 1.20.1290.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A497ZF99-F1-model_v4 | deleted | 1.002 | 8 | 144 |
|
| AF-A0A1M7FJB3-F1-model_v4 | Alkylhydroperoxidase AhpD family core domain-containing protein | 1.001 | 1 | 144 |
GO:0051920
|
| AF-A0A1V9EQ61-F1-model_v4 | Carboxymuconolactone decarboxylase-like domain-containing protein | 0.9977 | 4 | 144 |
GO:0051920
|
| AF-A0A7Y7HAS2-F1-model_v4 | AhpD family alkylhydroperoxidase | 0.9976 | 3 | 144 |
GO:0051920
|
| AF-A0A0W8ELG8-F1-model_v4 | deleted | 0.996 | 4 | 144 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar