F459263

General Info

Members Datasets Scaffolds Average Seq Length
525 354 467 151

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10007199|Ga0105237_100071992
Length 171
Sequence LYFLILIHFSGLALSATLGITKNIKKMKARILIKKADPEAYKALGVLSNYIANSSLSKTHQELIKIRASQINGCAYCIDMHTKDARKAGETEQRIYALNAWRETPFFTEEERAILALTEEVTLIQNHVSDKTYEEAERILGEKYLAQVIMAIINISAWNRIGIATGMQPGL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513020052 Flavobacterium sp. CF136 Isolate Rhizosphere
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
5 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
6 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
7 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
8 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
9 2643221600 Flavobacterium sp. Root186 Isolate Unclassified
10 2643221667 Flavobacterium sp. Root420 Isolate Unclassified
11 2643221714 Streptomyces sp. Root264 Isolate Unclassified
12 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
13 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
14 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
15 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
16 2739367857 Flavobacterium sp. GV029 Isolate Unclassified
17 2739367858 Flavobacterium sp. GV028 Isolate Unclassified
18 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
19 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
20 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
21 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
22 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
23 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
24 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
25 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
26 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
27 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
28 2857618242 Flavobacterium sp. R-74482 Isolate Unclassified
29 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
30 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
31 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
32 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
33 2919191525 Flavobacterium sp. 2755 Isolate Rhizosphere
34 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
35 2919683626 Flavobacterium piscis 4129 Isolate Unclassified
36 2929150217 Flavobacterium sp. R-74510 Hybrid assembly Isolate Unclassified
37 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
38 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
39 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
40 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
41 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
42 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
43 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
44 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
45 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
46 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
47 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
48 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
51 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
52 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
53 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
56 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
57 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
58 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
59 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
60 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
61 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
62 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
63 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
66 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
67 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
68 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
69 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
70 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
71 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
72 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
73 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
74 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
75 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
76 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
77 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
80 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
81 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
82 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
87 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
88 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
97 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
98 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
133 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
163 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
168 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
169 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
179 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
184 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
185 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
186 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
187 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
188 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
189 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
193 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
196 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
197 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
198 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
199 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
200 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
201 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
202 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
203 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
204 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
205 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
206 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
207 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
208 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
211 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
212 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
213 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
214 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
222 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
223 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
230 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
231 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
241 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
244 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
245 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
246 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
247 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
248 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
249 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
250 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
253 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
254 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
260 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
261 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
262 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
263 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
264 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
267 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
268 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
269 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
270 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
271 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
272 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
273 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
274 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
275 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
276 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
279 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
280 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
281 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
285 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
286 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
289 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
290 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
291 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
292 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
293 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
294 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
295 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
296 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
299 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
300 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
301 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
302 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
303 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
306 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
307 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
308 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
309 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
310 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
311 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
312 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
314 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
315 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
318 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
319 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
320 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
321 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
322 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
323 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
324 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
325 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
326 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
327 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
328 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
329 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
330 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
331 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
332 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
333 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
334 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
337 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
338 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
339 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
340 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
341 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
342 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
343 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
344 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
345 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
346 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
347 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
348 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
350 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
351 8022792930 Bacillus sp. Xin Isolate Rhizosphere
352 8054307821 Flavobacterium soyae SCIV07 Isolate Rhizosphere
353 8055419101 Flavobacterium tyrosinilyticum KCTC 42726 Isolate Rhizosphere
354 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.76
Metatranscriptomes 0.38
Isolates 10.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.86
Nodule 0.57
Rhizoplane 1.71
Rhizosphere 66.48
Stem 0
Stem Tuber 0
Unclassified 16.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3915940 2162886007 Bacteria 993
2 JGI24740J21852_10002037 3300001979 Bacteria 9242
3 JGI25162J39368_1000011 3300002737 Bacteria 379156
4 JGI25154J39366_1000041 3300002738 Bacteria 144221
5 JGI25157J39369_1003559 3300002741 Bacteria 3130
6 JGI25159J45721_1014250 3300002987 Bacteria 1801
7 JGI25151J46595_10006327 3300003187 Bacteria 5968
8 JGI25151J46595_10008495 3300003187 Bacteria 4934
9 JGI25153J46596_10003472 3300003215 Bacteria 8825
10 JGI25153J46596_10038521 3300003215 Unclassified 1506
11 rootH2_10005684 3300003320 Bacteria 48336
12 rootH2_10063502 3300003320 Bacteria 13069
13 rootH2_10212327 3300003320 Unclassified 1346
14 rootH2_10283979 3300003320 Bacteria 1082
15 rootL2_10071856 3300003322 Bacteria 3682
16 rootL2_10213467 3300003322 Bacteria 1207
17 rootH1_10037955 3300003323 Bacteria 16172
18 rootH1_10080260 3300003323 Bacteria 4994
19 rootH1_10103407 3300003323 Bacteria 4190
20 rootH1_10268703 3300003323 Bacteria 1666
21 JGI25160J50197_1032290 3300003354 Bacteria 1333
22 Ga0006562J51391_1057395 3300003578 Bacteria 609
23 Ga0055526_1076962 3300003771 Bacteria 660
24 Ga0055531_10000104 3300003794 Bacteria 92278
25 Ga0058860_12076626 3300004801 Bacteria 756
26 Ga0065165_1057060 3300005262 Bacteria 1083
27 Ga0065714_10071155 3300005288 Bacteria 3652
28 Ga0065714_10076072 3300005288 Bacteria 2832
29 Ga0065714_10244477 3300005288 Bacteria 768
30 Ga0065714_10248088 3300005288 Bacteria 781
31 Ga0065704_10072920 3300005289 Bacteria 7814
32 Ga0065704_10366593 3300005289 Bacteria 790
33 Ga0065715_10200358 3300005293 Bacteria 1365
34 Ga0065715_10536852 3300005293 Bacteria 751
35 Ga0070658_10330702 3300005327 Bacteria 1302
36 Ga0070680_100015323 3300005336 Bacteria 6007
37 Ga0070682_100000583 3300005337 Bacteria 22371
38 Ga0070660_100052884 3300005339 Bacteria 3132
39 Ga0070691_10001351 3300005341 Bacteria 10464
40 Ga0070669_100297274 3300005353 Bacteria 1298
41 Ga0070663_101499412 3300005455 Bacteria 599
42 Ga0070678_100189657 3300005456 Bacteria 1689
43 Ga0070681_10001864 3300005458 Bacteria 19041
44 Ga0070679_100000415 3300005530 Bacteria 36278
45 Ga0070679_101617181 3300005530 Bacteria 595
46 Ga0068853_100028605 3300005539 Bacteria 4689
47 Ga0068853_100141613 3300005539 Bacteria 2159
48 Ga0070672_100332812 3300005543 Bacteria 1292
49 Ga0070672_101441076 3300005543 Bacteria 616
50 Ga0070686_100000007 3300005544 Bacteria 242709
51 Ga0070693_100007791 3300005547 Bacteria 5252
52 Ga0070693_100007797 3300005547 Bacteria 5251
53 Ga0068855_100049427 3300005563 Bacteria 4960
54 Ga0068855_100060518 3300005563 Bacteria 4428
55 Ga0068857_102279237 3300005577 Bacteria 532
56 Ga0068854_100368588 3300005578 Bacteria 1180
57 Ga0068856_100016947 3300005614 Bacteria 7061
58 Ga0068870_10164973 3300005840 Bacteria 1317
59 Ga0068863_100013234 3300005841 Bacteria 7958
60 Ga0068860_100046394 3300005843 Bacteria 4143
61 Ga0075365_10041421 3300006038 Bacteria 3008
62 Ga0075368_10024780 3300006042 Bacteria 2299
63 Ga0070712_100012667 3300006175 Bacteria 5368
64 Ga0075367_10008634 3300006178 Bacteria 5286
65 Ga0075370_10124220 3300006353 Bacteria 1504
66 Ga0075370_10672915 3300006353 Bacteria 629
67 Ga0075428_102038951 3300006844 Bacteria 594
68 Ga0075429_100243476 3300006880 Bacteria 1575
69 Ga0099826_10436516 3300006948 Bacteria 627
70 Ga0105251_10030030 3300009011 Bacteria 2733
71 Ga0105244_10000201 3300009036 Bacteria 60835
72 Ga0105244_10187245 3300009036 Bacteria 980
73 Ga0105250_10010368 3300009092 Bacteria 3884
74 Ga0105250_10263920 3300009092 Bacteria 738
75 Ga0105240_10001681 3300009093 Bacteria 37540
76 Ga0105240_10003959 3300009093 Bacteria 22879
77 Ga0105240_10412696 3300009093 Bacteria 1518
78 Ga0105240_10509014 3300009093 Bacteria 1338
79 Ga0105240_10721060 3300009093 Bacteria 1087
80 Ga0105245_10463336 3300009098 Bacteria 1278
81 Ga0105247_10899222 3300009101 Bacteria 684
82 Ga0105243_10364562 3300009148 Bacteria 1331
83 Ga0105243_10992211 3300009148 Bacteria 842
84 Ga0105241_10000404 3300009174 Bacteria 32610
85 Ga0105241_10087105 3300009174 Bacteria 2457
86 Ga0105241_10181221 3300009174 Bacteria 1748
87 Ga0105248_11032500 3300009177 Bacteria 929
88 Ga0105237_10007199 3300009545 Bacteria 12215
89 Ga0105237_10010066 3300009545 Bacteria 10087
90 Ga0105237_10128103 3300009545 Bacteria 2532
91 Ga0105237_10918378 3300009545 Bacteria 882
92 Ga0105238_10137072 3300009551 Bacteria 2425
93 Ga0105238_10406951 3300009551 Bacteria 1354
94 Ga0105249_10108628 3300009553 Bacteria 2619
95 Ga0105249_12171746 3300009553 Bacteria 628
96 Ga0105239_10000008 3300010375 Bacteria 376925
97 Ga0105239_10000256 3300010375 Bacteria 79404
98 Ga0105239_10015160 3300010375 Bacteria 8541
99 Ga0105239_10119416 3300010375 Bacteria 2926
100 Ga0105239_10972266 3300010375 Bacteria 976
101 Ga0105246_10047265 3300011119 Bacteria 2938
102 Ga0157373_10002593 3300013100 Bacteria 13729
103 Ga0157373_10116952 3300013100 Bacteria 1874
104 Ga0157371_10003257 3300013102 Bacteria 14885
105 Ga0157371_10030689 3300013102 Bacteria 3876
106 Ga0157371_10600262 3300013102 Unclassified 819
107 Ga0157370_10000134 3300013104 Bacteria 89337
108 Ga0157370_10009827 3300013104 Bacteria 10142
109 Ga0157370_10203460 3300013104 Bacteria 1836
110 Ga0157370_11336599 3300013104 Bacteria 645
111 Ga0157369_10001052 3300013105 Bacteria 34841
112 Ga0163162_10440737 3300013306 Bacteria 1435
113 Ga0157372_10064294 3300013307 Bacteria 4117
114 Ga0157372_10094520 3300013307 Bacteria 3404
115 Ga0157375_10066839 3300013308 Bacteria 3590
116 Ga0163163_10599502 3300014325 Bacteria 1165
117 Ga0182008_10000034 3300014497 Bacteria 138235
118 Ga0157376_10855245 3300014969 Bacteria 925
119 Ga0157376_11077031 3300014969 Bacteria 829
120 Ga0157376_11699673 3300014969 Bacteria 666
121 Ga0182006_1002474 3300015261 Bacteria 10076
122 Ga0182006_1008371 3300015261 Bacteria 4686
123 Ga0182006_1017652 3300015261 Bacteria 3028
124 Ga0163161_10000922 3300017792 Bacteria 22691
125 Ga0163161_10196783 3300017792 Bacteria 1552
126 Ga0209147_106110 3300025229 Bacteria 1706
127 Ga0209437_100017 3300025233 Bacteria 694471
128 Ga0209646_1000122 3300025246 Bacteria 144486
129 Ga0209026_1000329 3300025250 Bacteria 47539
130 Ga0209673_1009305 3300025273 Bacteria 4276
131 Ga0209130_1039520 3300025284 Bacteria 918
132 Ga0209025_1001072 3300025294 Bacteria 39679
133 Ga0209025_1001789 3300025294 Bacteria 25516
134 Ga0209564_1008257 3300025295 Bacteria 5179
135 Ga0209758_1005260 3300025297 Bacteria 10124
136 Ga0207426_1001512 3300025302 Bacteria 18977
137 Ga0207426_1009457 3300025302 Bacteria 3855
138 Ga0209257_1000013 3300025304 Bacteria 1047305
139 Ga0207696_1112235 3300025711 Bacteria 738
140 Ga0207655_1000381 3300025728 Bacteria 61849
141 Ga0207655_1188995 3300025728 Bacteria 623
142 Ga0207713_1027134 3300025735 Bacteria 2607
143 Ga0207688_10296604 3300025901 Bacteria 988
144 Ga0207643_10110301 3300025908 Bacteria 1621
145 Ga0207705_11211901 3300025909 Bacteria 579
146 Ga0207654_10068651 3300025911 Bacteria 2098
147 Ga0207707_10002482 3300025912 Bacteria 16598
148 Ga0207695_10006276 3300025913 Bacteria 15475
149 Ga0207695_10007718 3300025913 Bacteria 13624
150 Ga0207695_10101866 3300025913 Unclassified 2865
151 Ga0207671_10005635 3300025914 Bacteria 11477
152 Ga0207671_10014905 3300025914 Bacteria 6114
153 Ga0207660_10005556 3300025917 Bacteria 8189
154 Ga0207657_10109514 3300025919 Bacteria 2282
155 Ga0207652_10000016 3300025921 Bacteria 188815
156 Ga0207652_10002176 3300025921 Bacteria 16750
157 Ga0207681_10651385 3300025923 Bacteria 873
158 Ga0207694_10267428 3300025924 Bacteria 1402
159 Ga0207650_11441008 3300025925 Bacteria 586
160 Ga0207709_10217813 3300025935 Bacteria 1375
161 Ga0207667_10069624 3300025949 Bacteria 3662
162 Ga0207667_10086441 3300025949 Bacteria 3245
163 Ga0207667_10141618 3300025949 Bacteria 2476
164 Ga0207640_10015839 3300025981 Bacteria 4374
165 Ga0207703_10807215 3300026035 Bacteria 896
166 Ga0207639_10107989 3300026041 Bacteria 2262
167 Ga0207639_12063627 3300026041 Bacteria 531
168 Ga0207641_10090940 3300026088 Bacteria 2670
169 Ga0207674_11144190 3300026116 Bacteria 748
170 Ga0207683_10233712 3300026121 Bacteria 1677
171 Ga0209813_10009922 3300027866 Bacteria 2450
172 Ga0265334_10254033 3300028573 Bacteria 605
173 Ga0307517_10016527 3300028786 Bacteria 9693
174 Ga0307515_10000353 3300028794 Bacteria 112876
175 Ga0307515_10005513 3300028794 Bacteria 25617
176 Ga0307515_10033940 3300028794 Bacteria 8378
177 Ga0307515_10132920 3300028794 Bacteria 2726
178 Ga0307515_10290675 3300028794 Bacteria 1330
179 Ga0307512_10050498 3300030522 Bacteria 3339
180 Ga0307512_10285186 3300030522 Bacteria 785
181 Ga0316177_1128036 3300030731 Bacteria 2413
182 Ga0265327_10000006 3300031251 Bacteria 693716
183 Ga0265327_10025157 3300031251 Bacteria 3478
184 Ga0265327_10075306 3300031251 Bacteria 1679
185 Ga0307513_10009379 3300031456 Bacteria 12382
186 Ga0307513_10047943 3300031456 Unclassified 4642
187 Ga0307513_10080791 3300031456 Bacteria 3352
188 Ga0307513_10576802 3300031456 Bacteria 835
189 Ga0307509_10748062 3300031507 Bacteria 643
190 Ga0307408_100042156 3300031548 Unclassified 3240
191 Ga0307508_10047628 3300031616 Bacteria 3821
192 Ga0307514_10197725 3300031649 Bacteria 1269
193 Ga0307514_10357840 3300031649 Bacteria 773
194 Ga0307405_10022711 3300031731 Unclassified 3552
195 Ga0307410_10851273 3300031852 Unclassified 778
196 Ga0307407_10069916 3300031903 Unclassified 2085
197 Ga0307412_10000049 3300031911 Bacteria 151588
198 Ga0307412_10765046 3300031911 Bacteria 835
199 Ga0307416_100022952 3300032002 Bacteria 4517
200 Ga0307416_100027471 3300032002 Unclassified 4215
201 Ga0307414_10005831 3300032004 Bacteria 6811
202 Ga0307414_10025379 3300032004 Bacteria 3796
203 Ga0307414_10049838 3300032004 Bacteria 2897
204 Ga0307414_10111620 3300032004 Bacteria 2082
205 Ga0307414_10167054 3300032004 Bacteria 1755
206 Ga0307414_11753461 3300032004 Bacteria 579
207 Ga0307411_10000004 3300032005 Bacteria 460327
208 Ga0307411_11099625 3300032005 Bacteria 716
209 Ga0307415_100019356 3300032126 Bacteria 4132
210 Ga0307507_10000362 3300033179 Bacteria 93053
211 Ga0307507_10311738 3300033179 Bacteria 955
212 Ga0307510_10068758 3300033180 Bacteria 3551
213 Ga0307510_10085718 3300033180 Bacteria 3025
214 Ga0395900_0619352 3300037418 Bacteria 1021
215 Ga0395900_0820778 3300037418 Bacteria 857
216 Ga0436363_1578705 3300039450 Unclassified 1152
217 Ga0436362_0649927 3300039453 Bacteria 683
218 Ga0436362_1225224 3300039453 Bacteria 1449
219 Ga0439436_0021983 3300041404 Bacteria 1891
220 Ga0439439_0106950 3300041406 Bacteria 773
221 Ga0439447_004295 3300041407 Bacteria 4941
222 Ga0451787_094168 3300041441 Bacteria 608
223 Ga0451793_0428212 3300041452 Unclassified 744
224 Ga0451793_1195031 3300041452 Unclassified 1345
225 Ga0451797_1207730 3300041453 Bacteria 952
226 Ga0451795_0246016 3300041456 Bacteria 553
227 Ga0451795_1578515 3300041456 Bacteria 1448
228 Ga0451802_0384759 3300041460 Bacteria 1135
229 Ga0451807_0222980 3300041486 Bacteria 911
230 Ga0451839_1165440 3300041496 Bacteria 592
231 Ga0451847_0955537 3300041503 Bacteria 530
232 Ga0451853_0842481 3300041512 Bacteria 2029
233 Ga0451853_0878125 3300041512 Bacteria 6787
234 Ga0451853_1390141 3300041512 Bacteria 6633
235 Ga0451853_1429198 3300041512 Bacteria 655
236 Ga0451853_2021448 3300041512 Bacteria 2569
237 Ga0451853_2072721 3300041512 Bacteria 1604
238 Ga0439442_027232 3300042002 Bacteria 1191
239 Ga0439448_0014792 3300042005 Bacteria 2357
240 Ga0439449_0010774 3300042007 Bacteria 3450
241 Ga0439449_0021745 3300042007 Bacteria 2401
242 Ga0439449_0160192 3300042007 Bacteria 840
243 Ga0439449_0317165 3300042007 Bacteria 589
244 Ga0439455_0003760 3300042012 Bacteria 2935
245 Ga0439457_019007 3300042014 Bacteria 1526
246 Ga0439462_0075525 3300042015 Bacteria 917
247 Ga0450894_000150 3300042131 Bacteria 12331
248 Ga0450896_026848 3300042133 Bacteria 860
249 Ga0450898_050851 3300042134 Bacteria 800
250 Ga0450899_001245 3300042135 Bacteria 2885
251 Ga0450903_008829 3300042138 Bacteria 1646
252 Ga0450906_005737 3300042145 Bacteria 2533
253 Ga0439458_0002003 3300042157 Bacteria 5059
254 Ga0466969_0000451 3300044656 Bacteria 22561
255 Ga0466972_0011561 3300044658 Bacteria 4432
256 Ga0466965_0001081 3300044683 Bacteria 10598
257 Ga0466966_0001814 3300044684 Bacteria 13849
258 Ga0466966_0003200 3300044684 Bacteria 10784
259 Ga0466961_0001727 3300044693 Bacteria 13590
260 Ga0466961_0002469 3300044693 Bacteria 11471
261 Ga0466963_0051646 3300044694 Bacteria 2725
262 Ga0466964_0299359 3300044706 Bacteria 810
263 Ga0466971_0001603 3300044719 Bacteria 9539
264 Ga0466970_0000971 3300044765 Bacteria 13790
265 Ga0466970_0012511 3300044765 Bacteria 4341
266 Ga0466970_0135403 3300044765 Bacteria 1355
267 Ga0466957_0002710 3300044842 Bacteria 9576
268 Ga0466957_0003736 3300044842 Bacteria 8414
269 Ga0466959_0000182 3300045049 Bacteria 41499
270 Ga0466959_0002105 3300045049 Bacteria 12594
271 Ga0466958_0000961 3300045836 Bacteria 13041
272 Ga0466967_0000560 3300045976 Bacteria 18187
273 Ga0495603_0033465 3300046455 Bacteria 3092
274 Ga0495590_0031788 3300046457 Bacteria 1847
275 Ga0495629_0018902 3300046459 Bacteria 4926
276 Ga0495638_0424890 3300046460 Bacteria 684
277 Ga0495650_0134882 3300046471 Bacteria 897
278 Ga0495650_0299202 3300046471 Bacteria 539
279 Ga0495605_0032866 3300046474 Bacteria 2638
280 Ga0495662_0192847 3300046476 Bacteria 1004
281 Ga0495585_0000388 3300046492 Bacteria 42445
282 Ga0495585_0107778 3300046492 Bacteria 1484
283 Ga0495585_0360579 3300046492 Unclassified 705
284 Ga0495585_0568018 3300046492 Bacteria 535
285 Ga0495594_0184624 3300046499 Bacteria 1187
286 Ga0495594_0429043 3300046499 Bacteria 752
287 Ga0495583_0143583 3300046506 Bacteria 992
288 Ga0495583_0317752 3300046506 Bacteria 617
289 Ga0495606_0000074 3300046507 Bacteria 170848
290 Ga0495606_0004380 3300046507 Bacteria 14156
291 Ga0495606_0006049 3300046507 Bacteria 11319
292 Ga0495606_0017582 3300046507 Bacteria 5398
293 Ga0495606_0028451 3300046507 Bacteria 3942
294 Ga0495606_0085940 3300046507 Bacteria 1945
295 Ga0495608_0073014 3300046511 Bacteria 2238
296 Ga0495610_0029208 3300046512 Bacteria 2907
297 Ga0495610_0057176 3300046512 Bacteria 1872
298 Ga0495616_0006996 3300046513 Bacteria 6791
299 Ga0495616_0008620 3300046513 Bacteria 6021
300 Ga0495616_0293361 3300046513 Bacteria 688
301 Ga0495618_0224704 3300046514 Bacteria 1183
302 Ga0495620_0004387 3300046515 Bacteria 7961
303 Ga0495620_0034178 3300046515 Bacteria 2300
304 Ga0495628_0067106 3300046516 Bacteria 2802
305 Ga0495630_0135145 3300046517 Bacteria 1874
306 Ga0495631_0011003 3300046518 Bacteria 4466
307 Ga0495637_0019315 3300046520 Bacteria 3153
308 Ga0495643_0006478 3300046522 Bacteria 7704
309 Ga0495643_0034893 3300046522 Bacteria 2772
310 Ga0495644_0163266 3300046523 Bacteria 854
311 Ga0495648_0008222 3300046524 Bacteria 8227
312 Ga0495648_0213277 3300046524 Bacteria 957
313 Ga0495663_0047279 3300046525 Bacteria 1324
314 Ga0495666_0025458 3300046526 Bacteria 2921
315 Ga0495642_0211994 3300046528 Bacteria 845
316 Ga0495652_0135326 3300046529 Bacteria 1945
317 Ga0495654_0261234 3300046530 Bacteria 718
318 Ga0495640_0103707 3300046533 Bacteria 1864
319 Ga0495609_0034029 3300046538 Bacteria 2311
320 Ga0495597_0085113 3300046542 Bacteria 1347
321 Ga0495622_0010743 3300046557 Bacteria 4224
322 Ga0495622_0055525 3300046557 Bacteria 1837
323 Ga0495622_0335435 3300046557 Bacteria 655
324 Ga0495633_0000027 3300046558 Bacteria 204613
325 Ga0495633_0004447 3300046558 Bacteria 8916
326 Ga0495633_0124349 3300046558 Bacteria 1194
327 Ga0495667_0672677 3300046559 Bacteria 642
328 Ga0495667_0821509 3300046559 Bacteria 572
329 Ga0495668_0000010 3300046616 Bacteria 487308
330 Ga0495668_0007298 3300046616 Bacteria 7087
331 Ga0495634_0381750 3300046642 Bacteria 839
332 Ga0495611_0000010 3300046648 Bacteria 156661
333 Ga0495611_0069259 3300046648 Bacteria 1611
334 Ga0495625_0022865 3300046660 Bacteria 4783
335 Ga0495625_0025338 3300046660 Bacteria 4499
336 Ga0495625_0043358 3300046660 Bacteria 3263
337 Ga0495625_0184263 3300046660 Bacteria 1386
338 Ga0495625_0401828 3300046660 Bacteria 856
339 Ga0495661_0040743 3300046665 Bacteria 2878
340 Ga0495657_0030837 3300046675 Bacteria 3751
341 Ga0495599_0404411 3300046678 Bacteria 813
342 Ga0495623_0038597 3300046679 Bacteria 3054
343 Ga0495646_0313190 3300046680 Bacteria 828
344 Ga0495658_0094445 3300046683 Bacteria 1776
345 Ga0495669_0466631 3300046684 Bacteria 613
346 Ga0495613_0787035 3300046689 Bacteria 621
347 Ga0495613_0791070 3300046689 Bacteria 619
348 Ga0495624_0032786 3300046690 Bacteria 3366
349 Ga0495624_0140191 3300046690 Bacteria 1481
350 Ga0495670_0152220 3300046691 Bacteria 1213
351 Ga0495671_0218809 3300046692 Bacteria 922
352 Ga0495649_0038296 3300046694 Bacteria 2631
353 Ga0495600_0851540 3300046809 Bacteria 540
354 Ga0495660_0078996 3300046810 Bacteria 1728
355 Ga0495660_0216802 3300046810 Bacteria 904
356 Ga0495660_0378822 3300046810 Bacteria 624
357 Ga0495581_0130138 3300047315 Bacteria 1466
358 Ga0495604_0045469 3300047317 Bacteria 3426
359 Ga0495636_0050896 3300047318 Bacteria 1735
360 Ga0495674_1399868 3300047319 Bacteria 521
361 Ga0495672_0081353 3300047320 Bacteria 1804
362 Ga0495676_0012453 3300047321 Bacteria 7661
363 Ga0495676_0068551 3300047321 Bacteria 2740
364 Ga0495680_0016059 3300047322 Bacteria 6437
365 Ga0495680_0018359 3300047322 Bacteria 5940
366 Ga0495683_0030126 3300047323 Bacteria 2770
367 Ga0495683_0044007 3300047323 Bacteria 2245
368 Ga0495687_011324 3300047443 Bacteria 4807
369 Ga0495687_049857 3300047443 Bacteria 1787
370 Ga0495687_157291 3300047443 Bacteria 769
371 Ga0495677_0163530 3300047445 Bacteria 860
372 Ga0495685_114709 3300047447 Bacteria 885
373 Ga0495681_0027610 3300047470 Bacteria 2933
374 Ga0495684_0865832 3300047471 Bacteria 585
375 Ga0495686_0000249 3300047472 Bacteria 96604
376 Ga0495686_0000386 3300047472 Bacteria 70225
377 Ga0495686_0000582 3300047472 Bacteria 51799
378 Ga0495686_0000587 3300047472 Bacteria 51313
379 Ga0495686_0001554 3300047472 Bacteria 24493
380 Ga0495686_0066967 3300047472 Bacteria 2218
381 Ga0495593_0008174 3300047673 Bacteria 6086
382 Ga0495593_0072907 3300047673 Bacteria 1782
383 Ga0495593_0313917 3300047673 Bacteria 784
384 Ga0495614_0013162 3300048089 Bacteria 3629
385 Ga0495614_0029728 3300048089 Bacteria 2351
386 Ga0495614_0070246 3300048089 Bacteria 1508
387 Ga0495626_0019938 3300048091 Bacteria 3345
388 Ga0496101_0281832 3300048904 Bacteria 1299
389 Ga0496116_0000024 3300048919 Bacteria 471420
390 Ga0496117_0218606 3300048920 Bacteria 1062
391 Ga0496118_0080707 3300048921 Bacteria 2288
392 Ga0496121_0019380 3300048924 Bacteria 6804
393 Ga0496121_0163799 3300048924 Bacteria 1623
394 Ga0496122_0000066 3300048925 Bacteria 231473
395 Ga0496123_0096876 3300048926 Bacteria 1730
396 Ga0496124_0017724 3300048927 Bacteria 6700
397 Ga0496124_0177392 3300048927 Bacteria 1643
398 Ga0496125_0000018 3300048928 Bacteria 482390
399 Ga0496126_0014506 3300048929 Bacteria 7963
400 Ga0496126_0018225 3300048929 Bacteria 6967
401 Ga0495678_056852 3300049459 Bacteria 1485
402 Ga0495682_0113112 3300049460 Bacteria 973
403 Ga0501032_0466896 3300049569 Bacteria 808
404 Ga0501033_0397782 3300049570 Unclassified 961
405 Ga0501034_0924455 3300049571 Bacteria 759
406 Ga0501070_0785365 3300049586 Bacteria 749
407 Ga0501198_090711 3300049649 Unclassified 606
408 Ga0501238_002146 3300049671 Bacteria 2330
409 Ga0501241_004732 3300049758 Bacteria 2540
410 Ga0501266_000002 3300049763 Bacteria 459947
411 Ga0501269_001832 3300049766 Bacteria 2697
412 Ga0501280_002242 3300049776 Unclassified 3282
413 Ga0501035_0436176 3300049822 Unclassified 1086
414 nmdc:mga03n38_716763_c1 3300050490 Bacteria 577
415 nmdc:mga0yw44_123704_c1 3300050492 Bacteria 1668
416 nmdc:mga06z11_5136_c1 3300050494 Bacteria 5219
417 nmdc:mga04h51_13231_c1 3300050495 Bacteria 2332
418 nmdc:mga0rr50_440802_c1 3300050513 Bacteria 1103
419 Ga0500635_0000558 3300053080 Bacteria 9937
420 Ga0500635_0021064 3300053080 Bacteria 2004
421 Ga0500644_0002380 3300053088 Bacteria 4720
422 Ga0500644_0012972 3300053088 Bacteria 2317
423 Ga0500644_0049063 3300053088 Bacteria 1439
424 Ga0500646_0011416 3300053090 Bacteria 2286
425 Ga0500646_0057660 3300053090 Bacteria 1135
426 Ga0500646_0167667 3300053090 Bacteria 737
427 Ga0500651_0000756 3300053093 Bacteria 15793
428 Ga0500651_0015489 3300053093 Unclassified 4680
429 Ga0500651_0037850 3300053093 Unclassified 3039
430 Ga0500651_0079716 3300053093 Bacteria 2029
431 Ga0500641_0000143 3300053096 Bacteria 26192
432 Ga0500641_0003775 3300053096 Bacteria 5353
433 Ga0500555_082418 3300053103 Bacteria 835
434 Ga0500560_058057 3300053107 Bacteria 1256
435 Ga0500562_000111 3300053108 Bacteria 28772
436 Ga0500569_000338 3300053109 Bacteria 7520
437 Ga0500594_0047530 3300053118 Bacteria 1197
438 Ga0500608_018193 3300053122 Bacteria 3203
439 Ga0500614_286395 3300053123 Bacteria 517
440 Ga0500618_000013 3300053125 Bacteria 183026
441 Ga0500642_0079083 3300053130 Bacteria 1507
442 Ga0500658_0000002 3300053134 Bacteria 548440
443 Ga0500658_0201695 3300053134 Bacteria 909
444 Ga0500561_0035330 3300053137 Bacteria 1289
445 Ga0500564_095564 3300053138 Bacteria 1319
446 Ga0500568_0062607 3300053139 Bacteria 1437
447 Ga0500573_0029975 3300053140 Bacteria 3137
448 Ga0500577_0000386 3300053142 Bacteria 11294
449 Ga0500589_144834 3300053147 Bacteria 974
450 Ga0500600_0322464 3300053149 Bacteria 650
451 Ga0500616_0007615 3300053153 Bacteria 6846
452 Ga0500616_0368440 3300053153 Bacteria 580
453 Ga0500616_0397564 3300053153 Bacteria 551
454 Ga0500622_0000042 3300053156 Bacteria 161253
455 Ga0500622_0000086 3300053156 Bacteria 99366
456 Ga0500622_0000354 3300053156 Bacteria 44739
457 Ga0500622_0001279 3300053156 Bacteria 20471
458 Ga0500624_000158 3300053157 Bacteria 27895
459 Ga0500627_0151586 3300053158 Bacteria 1047
460 Ga0500627_0237856 3300053158 Bacteria 809
461 Ga0500633_0000863 3300053160 Bacteria 5258
462 Ga0500636_0005090 3300053177 Bacteria 7463
463 Ga0500584_025201 3300053726 Bacteria 2765
464 Ga0500645_003030 3300053730 Bacteria 7083
465 Ga0500661_008673 3300055283 Bacteria 1869
466 Ga0466962_0002543 3300061719 Bacteria 8654
467 Ga0466962_0057525 3300061719 Bacteria 1856

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047443 Ga0495687_011324 Ga0495687_011324_2943_3461 123
2 3300041503 Ga0451847_0955537 Ga0451847_0955537_71_496 127
3 3300041512 Ga0451853_0878125 Ga0451853_0878125_5858_6277 127
4 3300042134 Ga0450898_050851 Ga0450898_050851_10_429 127
5 3300042135 Ga0450899_001245 Ga0450899_001245_2004_2423 127
6 3300042145 Ga0450906_005737 Ga0450906_005737_29_448 127
7 3300046471 Ga0495650_0299202 Ga0495650_0299202_32_457 127
8 3300046474 Ga0495605_0032866 Ga0495605_0032866_678_1103 127
9 3300046492 Ga0495585_0568018 Ga0495585_0568018_131_517 127
10 3300046506 Ga0495583_0143583 Ga0495583_0143583_450_875 127
11 3300046506 Ga0495583_0317752 Ga0495583_0317752_33_458 127
12 3300046515 Ga0495620_0004387 Ga0495620_0004387_5635_6060 127
13 3300046542 Ga0495597_0085113 Ga0495597_0085113_874_1299 127
14 3300046616 Ga0495668_0007298 Ga0495668_0007298_1216_1641 127
15 3300046660 Ga0495625_0022865 Ga0495625_0022865_3681_4106 127
16 3300046660 Ga0495625_0043358 Ga0495625_0043358_1355_1780 127
17 3300046678 Ga0495599_0404411 Ga0495599_0404411_346_771 127
18 3300046684 Ga0495669_0466631 Ga0495669_0466631_201_590 127
19 3300047319 Ga0495674_1399868 Ga0495674_1399868_13_438 127
20 3300047323 Ga0495683_0044007 Ga0495683_0044007_684_1109 127
21 3300047443 Ga0495687_157291 Ga0495687_157291_12_437 127
22 3300053149 Ga0500600_0322464 Ga0500600_0322464_49_474 127
23 3300041456 Ga0451795_1578515 Ga0451795_1578515_101_592 134
24 3300041496 Ga0451839_1165440 Ga0451839_1165440_43_534 134
25 3300041460 Ga0451802_0384759 Ga0451802_0384759_435_926 136
26 3300053156 Ga0500622_0000042 Ga0500622_0000042_155961_156380 138
27 iso_pu_bacteria 2643221600 2644011252 139
28 iso_pu_bacteria 2919191525 2919193786 139
29 3300009545 Ga0105237_10918378 Ga0105237_109183782 140
30 3300042014 Ga0439457_019007 Ga0439457_019007_439_897 140
31 3300042131 Ga0450894_000150 Ga0450894_000150_10180_10638 140
32 3300042133 Ga0450896_026848 Ga0450896_026848_358_816 140
33 3300046530 Ga0495654_0261234 Ga0495654_0261234_21_485 140
34 3300046648 Ga0495611_0000010 Ga0495611_0000010_99389_99853 140
35 3300046810 Ga0495660_0078996 Ga0495660_0078996_391_855 140
36 3300048925 Ga0496122_0000066 Ga0496122_0000066_477_914 140
37 3300048926 Ga0496123_0096876 Ga0496123_0096876_474_911 140
38 3300049586 Ga0501070_0785365 Ga0501070_0785365_232_690 140
39 3300053090 Ga0500646_0057660 Ga0500646_0057660_84_512 140
40 3300053093 Ga0500651_0079716 Ga0500651_0079716_1377_1805 140
41 3300053109 Ga0500569_000338 Ga0500569_000338_1137_1565 140
42 3300053134 Ga0500658_0201695 Ga0500658_0201695_420_848 140
43 3300053142 Ga0500577_0000386 Ga0500577_0000386_9779_10207 140
44 3300053153 Ga0500616_0007615 Ga0500616_0007615_60_488 140
45 iso_pu_bacteria 2513020052 2513235886 140
46 iso_pu_bacteria 2585428060 2587749435 140
47 iso_pu_bacteria 2588253712 2588446598 140
48 iso_pu_bacteria 2588254257 2590612089 140
49 iso_pu_bacteria 2643221600 2644008424 140
50 iso_pu_bacteria 2643221600 2644009616 140
51 iso_pu_bacteria 2643221667 2644372142 140
52 iso_pu_bacteria 2738541279 2738732697 140
53 iso_pu_bacteria 2738541285 2738765235 140
54 iso_pu_bacteria 2738543007 2739214278 140
55 iso_pu_bacteria 2739367857 2740003191 140
56 iso_pu_bacteria 2739367858 2740008008 140
57 iso_pu_bacteria 2739367874 2740057842 140
58 iso_pu_bacteria 2802428842 2802654901 140
59 iso_pu_bacteria 2816332295 2817482419 140
60 iso_pu_bacteria 2840677318 2840678189 140
61 iso_pu_bacteria 2857618242 2857618309 140
62 iso_pu_bacteria 2857618242 2857620083 140
63 iso_pu_bacteria 2896085136 2896086007 140
64 iso_pu_bacteria 2896109856 2896115212 140
65 iso_pu_bacteria 2919191525 2919195515 140
66 iso_pu_bacteria 2919191525 2919196503 140
67 iso_pu_bacteria 2919437846 2919440801 140
68 iso_pu_bacteria 2919683626 2919688360 140
69 iso_pu_bacteria 2929150217 2929150250 140
70 iso_pu_bacteria 2929239360 2929241154 140
71 iso_pu_bacteria 2929921140 2929925275 140
72 iso_pu_bacteria 2971410472 2971412278 140
73 iso_pu_bacteria 2977268062 2977271719 140
74 iso_pu_bacteria 3006858327 3006858347 140
75 iso_pu_bacteria 8022792930 8022794021 140
76 iso_pu_bacteria 8054307821 8054309860 140
77 iso_pu_bacteria 8055419101 8055423220 140
78 iso_pu_bacteria 8057582654 8057587295 140
79 3300026035 Ga0207703_10807215 Ga0207703_108072152 141
80 3300028786 Ga0307517_10016527 Ga0307517_100165277 141
81 3300046518 Ga0495631_0011003 Ga0495631_0011003_1262_1690 141
82 3300046660 Ga0495625_0401828 Ga0495625_0401828_83_514 141
83 3300047323 Ga0495683_0030126 Ga0495683_0030126_158_589 141
84 3300053122 Ga0500608_018193 Ga0500608_018193_177_605 141
85 3300053130 Ga0500642_0079083 Ga0500642_0079083_359_787 141
86 3300004801 Ga0058860_12076626 Ga0058860_120766261 142
87 3300005327 Ga0070658_10330702 Ga0070658_103307021 142
88 3300005336 Ga0070680_100015323 Ga0070680_1000153235 142
89 3300005337 Ga0070682_100000583 Ga0070682_10000058322 142
90 3300005339 Ga0070660_100052884 Ga0070660_1000528844 142
91 3300005341 Ga0070691_10001351 Ga0070691_100013518 142
92 3300005456 Ga0070678_100189657 Ga0070678_1001896573 142
93 3300005458 Ga0070681_10001864 Ga0070681_100018643 142
94 3300005530 Ga0070679_101617181 Ga0070679_1016171811 142
95 3300005539 Ga0068853_100028605 Ga0068853_1000286053 142
96 3300005547 Ga0070693_100007797 Ga0070693_1000077973 142
97 3300005563 Ga0068855_100060518 Ga0068855_1000605184 142
98 3300009093 Ga0105240_10001681 Ga0105240_100016813 142
99 3300009174 Ga0105241_10000404 Ga0105241_1000040431 142
100 3300009545 Ga0105237_10128103 Ga0105237_101281031 142
101 3300009551 Ga0105238_10406951 Ga0105238_104069512 142
102 3300013104 Ga0157370_10203460 Ga0157370_102034602 142
103 3300014969 Ga0157376_10855245 Ga0157376_108552451 142
104 3300025909 Ga0207705_11211901 Ga0207705_112119011 142
105 3300025911 Ga0207654_10068651 Ga0207654_100686512 142
106 3300025912 Ga0207707_10002482 Ga0207707_100024823 142
107 3300025913 Ga0207695_10006276 Ga0207695_1000627617 142
108 3300025917 Ga0207660_10005556 Ga0207660_100055564 142
109 3300025919 Ga0207657_10109514 Ga0207657_101095143 142
110 3300025921 Ga0207652_10002176 Ga0207652_1000217617 142
111 3300025924 Ga0207694_10267428 Ga0207694_102674283 142
112 3300025949 Ga0207667_10141618 Ga0207667_101416184 142
113 3300026041 Ga0207639_10107989 Ga0207639_101079893 142
114 3300026121 Ga0207683_10233712 Ga0207683_102337123 142
115 3300031507 Ga0307509_10748062 Ga0307509_107480622 142
116 iso_pu_bacteria 2675903060 2676487618 142
117 iso_pu_bacteria 2818991472 2819739549 142
118 3300005841 Ga0068863_100013234 Ga0068863_1000132346 143
119 3300005843 Ga0068860_100046394 Ga0068860_1000463943 143
120 3300006175 Ga0070712_100012667 Ga0070712_1000126672 143
121 3300006844 Ga0075428_102038951 Ga0075428_1020389511 143
122 3300006880 Ga0075429_100243476 Ga0075429_1002434762 143
123 3300009177 Ga0105248_11032500 Ga0105248_110325002 143
124 3300010375 Ga0105239_10119416 Ga0105239_101194162 143
125 3300025728 Ga0207655_1188995 Ga0207655_11889951 143
126 3300026088 Ga0207641_10090940 Ga0207641_100909401 143
127 3300028573 Ga0265334_10254033 Ga0265334_102540332 143
128 3300031456 Ga0307513_10080791 Ga0307513_100807912 143
129 3300039453 Ga0436362_0649927 Ga0436362_0649927_64_621 143
130 3300041453 Ga0451797_1207730 Ga0451797_1207730_169_603 143
131 3300041512 Ga0451853_1429198 Ga0451853_1429198_42_506 143
132 3300047673 Ga0495593_0313917 Ga0495593_0313917_123_554 143
133 3300050513 nmdc:mga0rr50_440802_c1 nmdc:mga0rr50_440802_c1_122_589 143
134 3300053103 Ga0500555_082418 Ga0500555_082418_230_709 143
135 3300053158 Ga0500627_0151586 Ga0500627_0151586_47_481 143
136 2162886007 SwRhRL2b_contig_3915940 SwRhRL2b_0547.00005540 144
137 3300001979 JGI24740J21852_10002037 JGI24740J21852_100020376 144
138 3300002737 JGI25162J39368_1000011 JGI25162J39368_1000011109 144
139 3300002738 JGI25154J39366_1000041 JGI25154J39366_100004159 144
140 3300002741 JGI25157J39369_1003559 JGI25157J39369_10035594 144
141 3300002987 JGI25159J45721_1014250 JGI25159J45721_10142501 144
142 3300003187 JGI25151J46595_10006327 JGI25151J46595_100063273 144
143 3300003187 JGI25151J46595_10008495 JGI25151J46595_100084954 144
144 3300003215 JGI25153J46596_10003472 JGI25153J46596_100034726 144
145 3300003215 JGI25153J46596_10038521 JGI25153J46596_100385212 144
146 3300003320 rootH2_10005684 rootH2_1000568421 144
147 3300003320 rootH2_10063502 rootH2_100635027 144
148 3300003320 rootH2_10212327 rootH2_102123272 144
149 3300003320 rootH2_10283979 rootH2_102839792 144
150 3300003322 rootL2_10071856 rootL2_100718563 144
151 3300003322 rootL2_10213467 rootL2_102134672 144
152 3300003323 rootH1_10037955 rootH1_1003795510 144
153 3300003323 rootH1_10080260 rootH1_100802602 144
154 3300003323 rootH1_10103407 rootH1_101034071 144
155 3300003323 rootH1_10268703 rootH1_102687032 144
156 3300003354 JGI25160J50197_1032290 JGI25160J50197_10322902 144
157 3300003578 Ga0006562J51391_1057395 Ga0006562J51391_10573951 144
158 3300003771 Ga0055526_1076962 Ga0055526_10769621 144
159 3300003794 Ga0055531_10000104 Ga0055531_100001049 144
160 3300005262 Ga0065165_1057060 Ga0065165_10570601 144
161 3300005288 Ga0065714_10071155 Ga0065714_100711554 144
162 3300005288 Ga0065714_10076072 Ga0065714_100760721 144
163 3300005288 Ga0065714_10244477 Ga0065714_102444771 144
164 3300005288 Ga0065714_10248088 Ga0065714_102480882 144
165 3300005289 Ga0065704_10072920 Ga0065704_100729205 144
166 3300005289 Ga0065704_10366593 Ga0065704_103665932 144
167 3300005293 Ga0065715_10200358 Ga0065715_102003582 144
168 3300005293 Ga0065715_10536852 Ga0065715_105368522 144
169 3300005353 Ga0070669_100297274 Ga0070669_1002972741 144
170 3300005455 Ga0070663_101499412 Ga0070663_1014994121 144
171 3300005530 Ga0070679_100000415 Ga0070679_1000004159 144
172 3300005539 Ga0068853_100141613 Ga0068853_1001416132 144
173 3300005543 Ga0070672_100332812 Ga0070672_1003328122 144
174 3300005543 Ga0070672_101441076 Ga0070672_1014410761 144
175 3300005544 Ga0070686_100000007 Ga0070686_100000007185 144
176 3300005547 Ga0070693_100007791 Ga0070693_1000077913 144
177 3300005563 Ga0068855_100049427 Ga0068855_1000494272 144
178 3300005577 Ga0068857_102279237 Ga0068857_1022792371 144
179 3300005578 Ga0068854_100368588 Ga0068854_1003685881 144
180 3300005614 Ga0068856_100016947 Ga0068856_1000169473 144
181 3300005840 Ga0068870_10164973 Ga0068870_101649732 144
182 3300006038 Ga0075365_10041421 Ga0075365_100414213 144
183 3300006042 Ga0075368_10024780 Ga0075368_100247802 144
184 3300006178 Ga0075367_10008634 Ga0075367_100086344 144
185 3300006353 Ga0075370_10124220 Ga0075370_101242202 144
186 3300006353 Ga0075370_10672915 Ga0075370_106729151 144
187 3300006948 Ga0099826_10436516 Ga0099826_104365161 144
188 3300009011 Ga0105251_10030030 Ga0105251_100300304 144
189 3300009036 Ga0105244_10000201 Ga0105244_1000020117 144
190 3300009036 Ga0105244_10187245 Ga0105244_101872451 144
191 3300009092 Ga0105250_10010368 Ga0105250_100103682 144
192 3300009092 Ga0105250_10263920 Ga0105250_102639201 144
193 3300009093 Ga0105240_10003959 Ga0105240_1000395910 144
194 3300009093 Ga0105240_10412696 Ga0105240_104126962 144
195 3300009093 Ga0105240_10509014 Ga0105240_105090141 144
196 3300009093 Ga0105240_10721060 Ga0105240_107210602 144
197 3300009098 Ga0105245_10463336 Ga0105245_104633362 144
198 3300009101 Ga0105247_10899222 Ga0105247_108992221 144
199 3300009148 Ga0105243_10364562 Ga0105243_103645622 144
200 3300009148 Ga0105243_10992211 Ga0105243_109922111 144
201 3300009174 Ga0105241_10087105 Ga0105241_100871052 144
202 3300009174 Ga0105241_10181221 Ga0105241_101812212 144
203 3300009545 Ga0105237_10007199 Ga0105237_100071992 144
204 3300009545 Ga0105237_10010066 Ga0105237_100100663 144
205 3300009551 Ga0105238_10137072 Ga0105238_101370724 144
206 3300009553 Ga0105249_10108628 Ga0105249_101086282 144
207 3300009553 Ga0105249_12171746 Ga0105249_121717461 144
208 3300010375 Ga0105239_10000008 Ga0105239_10000008110 144
209 3300010375 Ga0105239_10000256 Ga0105239_1000025648 144
210 3300010375 Ga0105239_10015160 Ga0105239_100151602 144
211 3300010375 Ga0105239_10972266 Ga0105239_109722662 144
212 3300011119 Ga0105246_10047265 Ga0105246_100472651 144
213 3300013100 Ga0157373_10002593 Ga0157373_100025932 144
214 3300013100 Ga0157373_10116952 Ga0157373_101169522 144
215 3300013102 Ga0157371_10003257 Ga0157371_100032578 144
216 3300013102 Ga0157371_10030689 Ga0157371_100306896 144
217 3300013102 Ga0157371_10600262 Ga0157371_106002621 144
218 3300013104 Ga0157370_10000134 Ga0157370_1000013496 144
219 3300013104 Ga0157370_10009827 Ga0157370_100098278 144
220 3300013104 Ga0157370_11336599 Ga0157370_113365992 144
221 3300013105 Ga0157369_10001052 Ga0157369_100010526 144
222 3300013306 Ga0163162_10440737 Ga0163162_104407372 144
223 3300013307 Ga0157372_10064294 Ga0157372_100642945 144
224 3300013307 Ga0157372_10094520 Ga0157372_100945204 144
225 3300013308 Ga0157375_10066839 Ga0157375_100668395 144
226 3300014325 Ga0163163_10599502 Ga0163163_105995022 144
227 3300014497 Ga0182008_10000034 Ga0182008_1000003459 144
228 3300014969 Ga0157376_11077031 Ga0157376_110770311 144
229 3300014969 Ga0157376_11699673 Ga0157376_116996732 144
230 3300015261 Ga0182006_1002474 Ga0182006_10024743 144
231 3300015261 Ga0182006_1008371 Ga0182006_10083714 144
232 3300015261 Ga0182006_1017652 Ga0182006_10176523 144
233 3300017792 Ga0163161_10000922 Ga0163161_1000092215 144
234 3300017792 Ga0163161_10196783 Ga0163161_101967832 144
235 3300025229 Ga0209147_106110 Ga0209147_1061102 144
236 3300025233 Ga0209437_100017 Ga0209437_100017272 144
237 3300025246 Ga0209646_1000122 Ga0209646_100012260 144
238 3300025250 Ga0209026_1000329 Ga0209026_100032921 144
239 3300025273 Ga0209673_1009305 Ga0209673_10093052 144
240 3300025284 Ga0209130_1039520 Ga0209130_10395201 144
241 3300025294 Ga0209025_1001072 Ga0209025_100107222 144
242 3300025294 Ga0209025_1001789 Ga0209025_100178920 144
243 3300025295 Ga0209564_1008257 Ga0209564_10082572 144
244 3300025297 Ga0209758_1005260 Ga0209758_10052609 144
245 3300025302 Ga0207426_1001512 Ga0207426_10015126 144
246 3300025302 Ga0207426_1009457 Ga0207426_10094575 144
247 3300025304 Ga0209257_1000013 Ga0209257_1000013244 144
248 3300025711 Ga0207696_1112235 Ga0207696_11122351 144
249 3300025728 Ga0207655_1000381 Ga0207655_100038117 144
250 3300025735 Ga0207713_1027134 Ga0207713_10271341 144
251 3300025901 Ga0207688_10296604 Ga0207688_102966042 144
252 3300025908 Ga0207643_10110301 Ga0207643_101103012 144
253 3300025913 Ga0207695_10007718 Ga0207695_100077185 144
254 3300025913 Ga0207695_10101866 Ga0207695_101018665 144
255 3300025914 Ga0207671_10005635 Ga0207671_100056353 144
256 3300025914 Ga0207671_10014905 Ga0207671_100149054 144
257 3300025921 Ga0207652_10000016 Ga0207652_1000001617 144
258 3300025923 Ga0207681_10651385 Ga0207681_106513851 144
259 3300025925 Ga0207650_11441008 Ga0207650_114410081 144
260 3300025935 Ga0207709_10217813 Ga0207709_102178132 144
261 3300025949 Ga0207667_10069624 Ga0207667_100696245 144
262 3300025949 Ga0207667_10086441 Ga0207667_100864413 144
263 3300025981 Ga0207640_10015839 Ga0207640_100158396 144
264 3300026041 Ga0207639_12063627 Ga0207639_120636271 144
265 3300026116 Ga0207674_11144190 Ga0207674_111441901 144
266 3300027866 Ga0209813_10009922 Ga0209813_100099222 144
267 3300028794 Ga0307515_10000353 Ga0307515_1000035373 144
268 3300028794 Ga0307515_10005513 Ga0307515_1000551330 144
269 3300028794 Ga0307515_10033940 Ga0307515_100339403 144
270 3300028794 Ga0307515_10132920 Ga0307515_101329203 144
271 3300028794 Ga0307515_10290675 Ga0307515_102906751 144
272 3300030522 Ga0307512_10050498 Ga0307512_100504983 144
273 3300030522 Ga0307512_10285186 Ga0307512_102851861 144
274 3300030731 Ga0316177_1128036 Ga0316177_11280362 144
275 3300031251 Ga0265327_10000006 Ga0265327_10000006230 144
276 3300031251 Ga0265327_10025157 Ga0265327_100251574 144
277 3300031251 Ga0265327_10075306 Ga0265327_100753063 144
278 3300031456 Ga0307513_10009379 Ga0307513_100093793 144
279 3300031456 Ga0307513_10047943 Ga0307513_100479431 144
280 3300031456 Ga0307513_10576802 Ga0307513_105768021 144
281 3300031548 Ga0307408_100042156 Ga0307408_1000421562 144
282 3300031616 Ga0307508_10047628 Ga0307508_100476284 144
283 3300031649 Ga0307514_10197725 Ga0307514_101977252 144
284 3300031649 Ga0307514_10357840 Ga0307514_103578401 144
285 3300031731 Ga0307405_10022711 Ga0307405_100227114 144
286 3300031852 Ga0307410_10851273 Ga0307410_108512732 144
287 3300031903 Ga0307407_10069916 Ga0307407_100699161 144
288 3300031911 Ga0307412_10000049 Ga0307412_1000004937 144
289 3300031911 Ga0307412_10765046 Ga0307412_107650461 144
290 3300032002 Ga0307416_100022952 Ga0307416_1000229524 144
291 3300032002 Ga0307416_100027471 Ga0307416_1000274712 144
292 3300032004 Ga0307414_10005831 Ga0307414_100058316 144
293 3300032004 Ga0307414_10025379 Ga0307414_100253793 144
294 3300032004 Ga0307414_10049838 Ga0307414_100498384 144
295 3300032004 Ga0307414_10111620 Ga0307414_101116202 144
296 3300032004 Ga0307414_10167054 Ga0307414_101670542 144
297 3300032004 Ga0307414_11753461 Ga0307414_117534611 144
298 3300032005 Ga0307411_10000004 Ga0307411_10000004443 144
299 3300032005 Ga0307411_11099625 Ga0307411_110996251 144
300 3300032126 Ga0307415_100019356 Ga0307415_1000193564 144
301 3300033179 Ga0307507_10000362 Ga0307507_1000036211 144
302 3300033179 Ga0307507_10311738 Ga0307507_103117381 144
303 3300033180 Ga0307510_10068758 Ga0307510_100687582 144
304 3300033180 Ga0307510_10085718 Ga0307510_100857181 144
305 3300037418 Ga0395900_0619352 Ga0395900_0619352_173_658 144
306 3300037418 Ga0395900_0820778 Ga0395900_0820778_13_483 144
307 3300039450 Ga0436363_1578705 Ga0436363_1578705_353_823 144
308 3300039453 Ga0436362_1225224 Ga0436362_1225224_589_1032 144
309 3300041404 Ga0439436_0021983 Ga0439436_0021983_271_738 144
310 3300041406 Ga0439439_0106950 Ga0439439_0106950_21_461 144
311 3300041407 Ga0439447_004295 Ga0439447_004295_189_623 144
312 3300041441 Ga0451787_094168 Ga0451787_094168_93_581 144
313 3300041452 Ga0451793_0428212 Ga0451793_0428212_12_479 144
314 3300041452 Ga0451793_1195031 Ga0451793_1195031_427_864 144
315 3300041456 Ga0451795_0246016 Ga0451795_0246016_48_497 144
316 3300041486 Ga0451807_0222980 Ga0451807_0222980_237_728 144
317 3300041512 Ga0451853_0842481 Ga0451853_0842481_1211_1702 144
318 3300041512 Ga0451853_1390141 Ga0451853_1390141_5571_6056 144
319 3300041512 Ga0451853_2021448 Ga0451853_2021448_1589_2074 144
320 3300041512 Ga0451853_2072721 Ga0451853_2072721_566_1051 144
321 3300042002 Ga0439442_027232 Ga0439442_027232_517_984 144
322 3300042005 Ga0439448_0014792 Ga0439448_0014792_1617_2105 144
323 3300042007 Ga0439449_0010774 Ga0439449_0010774_883_1323 144
324 3300042007 Ga0439449_0021745 Ga0439449_0021745_1658_2125 144
325 3300042007 Ga0439449_0160192 Ga0439449_0160192_156_647 144
326 3300042007 Ga0439449_0317165 Ga0439449_0317165_20_493 144
327 3300042012 Ga0439455_0003760 Ga0439455_0003760_1811_2299 144
328 3300042015 Ga0439462_0075525 Ga0439462_0075525_37_504 144
329 3300042138 Ga0450903_008829 Ga0450903_008829_432_920 144
330 3300042157 Ga0439458_0002003 Ga0439458_0002003_453_941 144
331 3300044656 Ga0466969_0000451 Ga0466969_0000451_18528_18968 144
332 3300044658 Ga0466972_0011561 Ga0466972_0011561_1643_2128 144
333 3300044683 Ga0466965_0001081 Ga0466965_0001081_248_733 144
334 3300044684 Ga0466966_0001814 Ga0466966_0001814_11386_11871 144
335 3300044684 Ga0466966_0003200 Ga0466966_0003200_1254_1694 144
336 3300044693 Ga0466961_0001727 Ga0466961_0001727_8179_8619 144
337 3300044693 Ga0466961_0002469 Ga0466961_0002469_1785_2270 144
338 3300044694 Ga0466963_0051646 Ga0466963_0051646_262_747 144
339 3300044706 Ga0466964_0299359 Ga0466964_0299359_150_635 144
340 3300044719 Ga0466971_0001603 Ga0466971_0001603_8822_9307 144
341 3300044765 Ga0466970_0000971 Ga0466970_0000971_6334_6819 144
342 3300044765 Ga0466970_0012511 Ga0466970_0012511_1472_1912 144
343 3300044765 Ga0466970_0135403 Ga0466970_0135403_654_1187 144
344 3300044842 Ga0466957_0002710 Ga0466957_0002710_8821_9306 144
345 3300044842 Ga0466957_0003736 Ga0466957_0003736_6003_6440 144
346 3300045049 Ga0466959_0000182 Ga0466959_0000182_35706_36146 144
347 3300045049 Ga0466959_0002105 Ga0466959_0002105_9953_10438 144
348 3300045836 Ga0466958_0000961 Ga0466958_0000961_11387_11872 144
349 3300045976 Ga0466967_0000560 Ga0466967_0000560_10765_11250 144
350 3300046455 Ga0495603_0033465 Ga0495603_0033465_1094_1585 144
351 3300046457 Ga0495590_0031788 Ga0495590_0031788_382_873 144
352 3300046459 Ga0495629_0018902 Ga0495629_0018902_1911_2402 144
353 3300046460 Ga0495638_0424890 Ga0495638_0424890_183_617 144
354 3300046471 Ga0495650_0134882 Ga0495650_0134882_410_844 144
355 3300046476 Ga0495662_0192847 Ga0495662_0192847_198_689 144
356 3300046492 Ga0495585_0000388 Ga0495585_0000388_25848_26288 144
357 3300046492 Ga0495585_0107778 Ga0495585_0107778_450_941 144
358 3300046492 Ga0495585_0360579 Ga0495585_0360579_258_695 144
359 3300046499 Ga0495594_0184624 Ga0495594_0184624_247_738 144
360 3300046499 Ga0495594_0429043 Ga0495594_0429043_247_738 144
361 3300046507 Ga0495606_0000074 Ga0495606_0000074_69499_69933 144
362 3300046507 Ga0495606_0004380 Ga0495606_0004380_9999_10490 144
363 3300046507 Ga0495606_0006049 Ga0495606_0006049_3677_4111 144
364 3300046507 Ga0495606_0017582 Ga0495606_0017582_2456_2920 144
365 3300046507 Ga0495606_0028451 Ga0495606_0028451_362_811 144
366 3300046507 Ga0495606_0085940 Ga0495606_0085940_1059_1496 144
367 3300046511 Ga0495608_0073014 Ga0495608_0073014_950_1441 144
368 3300046512 Ga0495610_0029208 Ga0495610_0029208_969_1460 144
369 3300046512 Ga0495610_0057176 Ga0495610_0057176_291_725 144
370 3300046513 Ga0495616_0006996 Ga0495616_0006996_3656_4093 144
371 3300046513 Ga0495616_0008620 Ga0495616_0008620_3008_3499 144
372 3300046513 Ga0495616_0293361 Ga0495616_0293361_224_664 144
373 3300046514 Ga0495618_0224704 Ga0495618_0224704_602_1093 144
374 3300046515 Ga0495620_0034178 Ga0495620_0034178_445_936 144
375 3300046516 Ga0495628_0067106 Ga0495628_0067106_1044_1535 144
376 3300046517 Ga0495630_0135145 Ga0495630_0135145_140_631 144
377 3300046520 Ga0495637_0019315 Ga0495637_0019315_751_1242 144
378 3300046522 Ga0495643_0006478 Ga0495643_0006478_1653_2144 144
379 3300046522 Ga0495643_0034893 Ga0495643_0034893_1903_2346 144
380 3300046523 Ga0495644_0163266 Ga0495644_0163266_125_559 144
381 3300046524 Ga0495648_0008222 Ga0495648_0008222_454_894 144
382 3300046524 Ga0495648_0213277 Ga0495648_0213277_58_498 144
383 3300046525 Ga0495663_0047279 Ga0495663_0047279_50_484 144
384 3300046526 Ga0495666_0025458 Ga0495666_0025458_2380_2871 144
385 3300046528 Ga0495642_0211994 Ga0495642_0211994_370_807 144
386 3300046529 Ga0495652_0135326 Ga0495652_0135326_1432_1923 144
387 3300046533 Ga0495640_0103707 Ga0495640_0103707_1311_1802 144
388 3300046538 Ga0495609_0034029 Ga0495609_0034029_333_767 144
389 3300046557 Ga0495622_0010743 Ga0495622_0010743_2637_3128 144
390 3300046557 Ga0495622_0055525 Ga0495622_0055525_1361_1801 144
391 3300046557 Ga0495622_0335435 Ga0495622_0335435_40_531 144
392 3300046558 Ga0495633_0000027 Ga0495633_0000027_151792_152232 144
393 3300046558 Ga0495633_0004447 Ga0495633_0004447_3577_4014 144
394 3300046558 Ga0495633_0124349 Ga0495633_0124349_56_490 144
395 3300046559 Ga0495667_0672677 Ga0495667_0672677_12_503 144
396 3300046559 Ga0495667_0821509 Ga0495667_0821509_62_553 144
397 3300046616 Ga0495668_0000010 Ga0495668_0000010_38600_39040 144
398 3300046642 Ga0495634_0381750 Ga0495634_0381750_192_683 144
399 3300046648 Ga0495611_0069259 Ga0495611_0069259_247_738 144
400 3300046660 Ga0495625_0025338 Ga0495625_0025338_3551_3988 144
401 3300046660 Ga0495625_0184263 Ga0495625_0184263_748_1182 144
402 3300046665 Ga0495661_0040743 Ga0495661_0040743_1219_1710 144
403 3300046675 Ga0495657_0030837 Ga0495657_0030837_2173_2664 144
404 3300046679 Ga0495623_0038597 Ga0495623_0038597_524_1015 144
405 3300046680 Ga0495646_0313190 Ga0495646_0313190_44_535 144
406 3300046683 Ga0495658_0094445 Ga0495658_0094445_244_684 144
407 3300046689 Ga0495613_0787035 Ga0495613_0787035_117_608 144
408 3300046689 Ga0495613_0791070 Ga0495613_0791070_107_598 144
409 3300046690 Ga0495624_0032786 Ga0495624_0032786_2509_3000 144
410 3300046690 Ga0495624_0140191 Ga0495624_0140191_252_743 144
411 3300046691 Ga0495670_0152220 Ga0495670_0152220_249_683 144
412 3300046692 Ga0495671_0218809 Ga0495671_0218809_29_463 144
413 3300046694 Ga0495649_0038296 Ga0495649_0038296_1533_2024 144
414 3300046809 Ga0495600_0851540 Ga0495600_0851540_21_512 144
415 3300046810 Ga0495660_0216802 Ga0495660_0216802_364_855 144
416 3300046810 Ga0495660_0378822 Ga0495660_0378822_41_535 144
417 3300047315 Ga0495581_0130138 Ga0495581_0130138_772_1263 144
418 3300047317 Ga0495604_0045469 Ga0495604_0045469_2545_3036 144
419 3300047318 Ga0495636_0050896 Ga0495636_0050896_1223_1714 144
420 3300047320 Ga0495672_0081353 Ga0495672_0081353_16_507 144
421 3300047321 Ga0495676_0012453 Ga0495676_0012453_3195_3686 144
422 3300047321 Ga0495676_0068551 Ga0495676_0068551_883_1374 144
423 3300047322 Ga0495680_0016059 Ga0495680_0016059_293_784 144
424 3300047322 Ga0495680_0018359 Ga0495680_0018359_5409_5900 144
425 3300047443 Ga0495687_011324 Ga0495687_011324_922_1413 144
426 3300047443 Ga0495687_049857 Ga0495687_049857_612_1103 144
427 3300047445 Ga0495677_0163530 Ga0495677_0163530_345_836 144
428 3300047447 Ga0495685_114709 Ga0495685_114709_342_833 144
429 3300047470 Ga0495681_0027610 Ga0495681_0027610_25_516 144
430 3300047471 Ga0495684_0865832 Ga0495684_0865832_33_524 144
431 3300047472 Ga0495686_0000249 Ga0495686_0000249_27507_27941 144
432 3300047472 Ga0495686_0000386 Ga0495686_0000386_8186_8629 144
433 3300047472 Ga0495686_0000582 Ga0495686_0000582_10678_11115 144
434 3300047472 Ga0495686_0000587 Ga0495686_0000587_35750_36190 144
435 3300047472 Ga0495686_0001554 Ga0495686_0001554_17491_17925 144
436 3300047472 Ga0495686_0066967 Ga0495686_0066967_1742_2176 144
437 3300047673 Ga0495593_0008174 Ga0495593_0008174_2044_2535 144
438 3300047673 Ga0495593_0072907 Ga0495593_0072907_25_516 144
439 3300048089 Ga0495614_0013162 Ga0495614_0013162_2357_2797 144
440 3300048089 Ga0495614_0029728 Ga0495614_0029728_1795_2286 144
441 3300048089 Ga0495614_0070246 Ga0495614_0070246_46_537 144
442 3300048091 Ga0495626_0019938 Ga0495626_0019938_2839_3330 144
443 3300048904 Ga0496101_0281832 Ga0496101_0281832_707_1147 144
444 3300048919 Ga0496116_0000024 Ga0496116_0000024_465914_466399 144
445 3300048920 Ga0496117_0218606 Ga0496117_0218606_301_786 144
446 3300048921 Ga0496118_0080707 Ga0496118_0080707_452_937 144
447 3300048924 Ga0496121_0019380 Ga0496121_0019380_2225_2659 144
448 3300048924 Ga0496121_0163799 Ga0496121_0163799_838_1323 144
449 3300048927 Ga0496124_0017724 Ga0496124_0017724_3611_4096 144
450 3300048927 Ga0496124_0177392 Ga0496124_0177392_889_1323 144
451 3300048928 Ga0496125_0000018 Ga0496125_0000018_5167_5652 144
452 3300048929 Ga0496126_0014506 Ga0496126_0014506_3149_3634 144
453 3300048929 Ga0496126_0018225 Ga0496126_0018225_6443_6883 144
454 3300049459 Ga0495678_056852 Ga0495678_056852_236_727 144
455 3300049460 Ga0495682_0113112 Ga0495682_0113112_48_539 144
456 3300049569 Ga0501032_0466896 Ga0501032_0466896_333_767 144
457 3300049570 Ga0501033_0397782 Ga0501033_0397782_136_570 144
458 3300049571 Ga0501034_0924455 Ga0501034_0924455_225_659 144
459 3300049649 Ga0501198_090711 Ga0501198_090711_64_543 144
460 3300049671 Ga0501238_002146 Ga0501238_002146_514_948 144
461 3300049758 Ga0501241_004732 Ga0501241_004732_718_1152 144
462 3300049763 Ga0501266_000002 Ga0501266_000002_4415_4849 144
463 3300049766 Ga0501269_001832 Ga0501269_001832_1705_2139 144
464 3300049776 Ga0501280_002242 Ga0501280_002242_2705_3148 144
465 3300049822 Ga0501035_0436176 Ga0501035_0436176_112_546 144
466 3300050490 nmdc:mga03n38_716763_c1 nmdc:mga03n38_716763_c1_43_534 144
467 3300050492 nmdc:mga0yw44_123704_c1 nmdc:mga0yw44_123704_c1_410_904 144
468 3300050494 nmdc:mga06z11_5136_c1 nmdc:mga06z11_5136_c1_3617_4096 144
469 3300050495 nmdc:mga04h51_13231_c1 nmdc:mga04h51_13231_c1_725_1204 144
470 3300053080 Ga0500635_0000558 Ga0500635_0000558_1612_2058 144
471 3300053080 Ga0500635_0021064 Ga0500635_0021064_161_595 144
472 3300053088 Ga0500644_0002380 Ga0500644_0002380_1338_1832 144
473 3300053088 Ga0500644_0012972 Ga0500644_0012972_85_519 144
474 3300053088 Ga0500644_0049063 Ga0500644_0049063_66_500 144
475 3300053090 Ga0500646_0011416 Ga0500646_0011416_1383_1817 144
476 3300053090 Ga0500646_0167667 Ga0500646_0167667_256_690 144
477 3300053093 Ga0500651_0000756 Ga0500651_0000756_2314_2772 144
478 3300053093 Ga0500651_0015489 Ga0500651_0015489_2275_2712 144
479 3300053093 Ga0500651_0037850 Ga0500651_0037850_1252_1686 144
480 3300053096 Ga0500641_0000143 Ga0500641_0000143_4041_4475 144
481 3300053096 Ga0500641_0003775 Ga0500641_0003775_3723_4157 144
482 3300053107 Ga0500560_058057 Ga0500560_058057_705_1193 144
483 3300053108 Ga0500562_000111 Ga0500562_000111_4402_4836 144
484 3300053118 Ga0500594_0047530 Ga0500594_0047530_100_534 144
485 3300053123 Ga0500614_286395 Ga0500614_286395_46_486 144
486 3300053125 Ga0500618_000013 Ga0500618_000013_128462_128896 144
487 3300053134 Ga0500658_0000002 Ga0500658_0000002_543636_544070 144
488 3300053137 Ga0500561_0035330 Ga0500561_0035330_172_666 144
489 3300053138 Ga0500564_095564 Ga0500564_095564_751_1188 144
490 3300053139 Ga0500568_0062607 Ga0500568_0062607_463_897 144
491 3300053140 Ga0500573_0029975 Ga0500573_0029975_79_567 144
492 3300053147 Ga0500589_144834 Ga0500589_144834_310_804 144
493 3300053153 Ga0500616_0368440 Ga0500616_0368440_49_486 144
494 3300053153 Ga0500616_0397564 Ga0500616_0397564_57_500 144
495 3300053156 Ga0500622_0000086 Ga0500622_0000086_29037_29471 144
496 3300053156 Ga0500622_0000354 Ga0500622_0000354_20451_20888 144
497 3300053156 Ga0500622_0001279 Ga0500622_0001279_8035_8469 144
498 3300053157 Ga0500624_000158 Ga0500624_000158_4797_5234 144
499 3300053158 Ga0500627_0237856 Ga0500627_0237856_106_543 144
500 3300053160 Ga0500633_0000863 Ga0500633_0000863_2904_3398 144
501 3300053177 Ga0500636_0005090 Ga0500636_0005090_4615_5109 144
502 3300053726 Ga0500584_025201 Ga0500584_025201_1560_1994 144
503 3300053730 Ga0500645_003030 Ga0500645_003030_4910_5344 144
504 3300055283 Ga0500661_008673 Ga0500661_008673_1405_1839 144
505 3300061719 Ga0466962_0002543 Ga0466962_0002543_8134_8619 144
506 3300061719 Ga0466962_0057525 Ga0466962_0057525_217_657 144
507 iso_pu_bacteria 2582581313 2585306219 144
508 iso_pu_bacteria 2582581314 2585313782 144
509 iso_pu_bacteria 2616644814 2616696632 144
510 iso_pu_bacteria 2643221714 2644633144 144
511 iso_pu_bacteria 2751185782 2753266273 144
512 iso_pu_bacteria 2784746763 2785339210 144
513 iso_pu_bacteria 2784746768 2785370929 144
514 iso_pu_bacteria 2786546132 2786672105 144
515 iso_pu_bacteria 2808606359 2808843486 144
516 iso_pu_bacteria 2862382967 2862382990 144
517 iso_pu_bacteria 2863404153 2863410727 144
518 iso_pu_bacteria 2946072368 2946077254 144
519 iso_pu_bacteria 2954002825 2954004889 144
520 iso_pu_bacteria 2954673503 2954678378 144
521 iso_pu_bacteria 2954682443 2954685777 144
522 iso_pu_bacteria 2954691527 2954695414 144
523 iso_pu_bacteria 2954701450 2954710607 144
524 iso_pu_bacteria 2990059506 2990066828 144
525 iso_pu_bacteria 8008558824 8008564770 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02627

CMD

Carboxymuconolactone decarboxylase family

38

120

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.9815 10 141
2gmy-assembly1.cif.gz_C crystal structure of a protein of unknown function atu0492 from agrobacterium tumefaciens, putative antioxidant defence protein ahpd 0.9801 4 144
7xw1-assembly1.cif.gz_A the crystal structure of ahpd from pseudomonas aeruginosa 0.967 10 141
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.962 1 144
2ijc-assembly2.cif.gz_I structure of a conserved protein of unknown function pa0269 from pseudomonas aeruginosa 0.9555 1 144
ID Description Score Start End Superfamily
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9834 4 144 1.20.1290.10
2gmyF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9566 4 144 1.20.1290.10
af_Q2FVE0_2_139_1.20.1290.10 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9557 6 140 1.20.1290.10
2ijcF00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9541 2 143 1.20.1290.10
2o4dA00 Mainly Alpha;Up-down Bundle;AhpD-like;AhpD-like 0.9488 2 144 1.20.1290.10
ID Description Score Start End GO Terms
AF-A0A497ZF99-F1-model_v4 deleted 1.002 8 144
AF-A0A1M7FJB3-F1-model_v4 Alkylhydroperoxidase AhpD family core domain-containing protein 1.001 1 144 GO:0051920
AF-A0A1V9EQ61-F1-model_v4 Carboxymuconolactone decarboxylase-like domain-containing protein 0.9977 4 144 GO:0051920
AF-A0A7Y7HAS2-F1-model_v4 AhpD family alkylhydroperoxidase 0.9976 3 144 GO:0051920
AF-A0A0W8ELG8-F1-model_v4 deleted 0.996 4 144

Feature Viewer

pLDDT pTM Quality
97.38 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map