F459214

General Info

Members Datasets Scaffolds Average Seq Length
525 165 525 68

Family's Representative Sequence

Representative Sequence 3300002067|JGI24735J21928_10043591|JGI24735J21928_100435913
Length 69
Sequence VTDIVEAARYNSRVEADLARLYLESEGVESVLFDTEINYFYGGLFMPVRLMVLEEDLAEATRLLGDYKP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
118 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
119 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
120 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
121 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
122 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
123 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
124 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
137 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
138 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
149 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
154 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
155 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
156 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
165 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.43
Rhizosphere 96.57
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10011521 3300001979 Bacteria 3364
2 JGI24739J22299_10007060 3300001989 Bacteria 4226
3 JGI24739J22299_10007725 3300001989 Bacteria 4023
4 JGI24739J22299_10180429 3300001989 Bacteria 621
5 JGI24737J22298_10000312 3300001990 Bacteria 16238
6 JGI24737J22298_10010495 3300001990 Bacteria 3057
7 JGI24737J22298_10038451 3300001990 Bacteria 1473
8 JGI24735J21928_10043591 3300002067 Bacteria 1304
9 JGI24738J21930_10000308 3300002075 Bacteria 13430
10 Ga0070658_10004530 3300005327 Bacteria 11300
11 Ga0070658_10005046 3300005327 Bacteria 10747
12 Ga0070658_10243327 3300005327 Bacteria 1525
13 Ga0070658_10301814 3300005327 Bacteria 1365
14 Ga0070658_10419331 3300005327 Bacteria 1151
15 Ga0070658_10513199 3300005327 Bacteria 1036
16 Ga0070676_10126932 3300005328 Bacteria 1608
17 Ga0070676_10360958 3300005328 Bacteria 1001
18 Ga0070676_11355954 3300005328 Bacteria 544
19 Ga0070683_100008343 3300005329 Bacteria 8799
20 Ga0070683_100024905 3300005329 Bacteria 5366
21 Ga0070683_100610312 3300005329 Bacteria 1044
22 Ga0070683_101623902 3300005329 Bacteria 622
23 Ga0070690_100343013 3300005330 Bacteria 1082
24 Ga0070690_100478433 3300005330 Bacteria 928
25 Ga0070670_100009961 3300005331 Bacteria 8112
26 Ga0070670_101949743 3300005331 Bacteria 541
27 Ga0070666_10000591 3300005335 Bacteria 21857
28 Ga0070666_10630131 3300005335 Bacteria 783
29 Ga0070666_11382977 3300005335 Bacteria 526
30 Ga0070680_100004651 3300005336 Bacteria 10320
31 Ga0070680_100318119 3300005336 Bacteria 1321
32 Ga0070680_101226573 3300005336 Bacteria 649
33 Ga0070680_101598357 3300005336 Unclassified 565
34 Ga0070682_100092465 3300005337 Bacteria 1982
35 Ga0070682_100150536 3300005337 Bacteria 1596
36 Ga0070682_101527131 3300005337 Bacteria 575
37 Ga0068868_100551920 3300005338 Bacteria 1015
38 Ga0068868_102034061 3300005338 Unclassified 546
39 Ga0070660_100001567 3300005339 Bacteria 15721
40 Ga0070660_100189731 3300005339 Bacteria 1664
41 Ga0070660_100226437 3300005339 Bacteria 1521
42 Ga0070660_100230376 3300005339 Bacteria 1507
43 Ga0070660_101330940 3300005339 Bacteria 610
44 Ga0070660_101581384 3300005339 Unclassified 558
45 Ga0070691_10342333 3300005341 Bacteria 828
46 Ga0070661_100000354 3300005344 Bacteria 36155
47 Ga0070661_100108791 3300005344 Bacteria 2068
48 Ga0070661_100260541 3300005344 Bacteria 1341
49 Ga0070661_100265982 3300005344 Bacteria 1327
50 Ga0070661_100342088 3300005344 Bacteria 1172
51 Ga0070661_100394993 3300005344 Bacteria 1092
52 Ga0070661_101145110 3300005344 Bacteria 649
53 Ga0070692_10309742 3300005345 Bacteria 967
54 Ga0070692_10392467 3300005345 Bacteria 874
55 Ga0070692_10906740 3300005345 Bacteria 610
56 Ga0070669_100278755 3300005353 Bacteria 1339
57 Ga0070669_100597989 3300005353 Bacteria 924
58 Ga0070675_101672825 3300005354 Bacteria 587
59 Ga0070671_100001348 3300005355 Bacteria 18388
60 Ga0070671_100223947 3300005355 Bacteria 1596
61 Ga0070671_100641114 3300005355 Bacteria 919
62 Ga0070673_100051974 3300005364 Bacteria 3213
63 Ga0070659_100000311 3300005366 Bacteria 37881
64 Ga0070659_100000790 3300005366 Bacteria 23055
65 Ga0070659_100040331 3300005366 Bacteria 3647
66 Ga0070659_100065982 3300005366 Bacteria 2867
67 Ga0070659_100150780 3300005366 Bacteria 1897
68 Ga0070659_100166012 3300005366 Bacteria 1806
69 Ga0070659_100417185 3300005366 Unclassified 1135
70 Ga0070659_100865172 3300005366 Bacteria 788
71 Ga0070659_100963269 3300005366 Bacteria 748
72 Ga0070667_100088096 3300005367 Bacteria 2665
73 Ga0070667_100288601 3300005367 Bacteria 1475
74 Ga0070667_100355190 3300005367 Bacteria 1327
75 Ga0070713_100790469 3300005436 Bacteria 909
76 Ga0070663_100004050 3300005455 Bacteria 8555
77 Ga0070663_100047488 3300005455 Bacteria 3041
78 Ga0070663_100232452 3300005455 Bacteria 1452
79 Ga0070663_101036655 3300005455 Bacteria 715
80 Ga0070678_101518678 3300005456 Bacteria 627
81 Ga0070662_100001149 3300005457 Bacteria 16221
82 Ga0070662_100051397 3300005457 Bacteria 2976
83 Ga0070662_100151533 3300005457 Bacteria 1806
84 Ga0070662_100177064 3300005457 Bacteria 1679
85 Ga0070662_100189243 3300005457 Bacteria 1626
86 Ga0070662_101142956 3300005457 Bacteria 669
87 Ga0070681_10309265 3300005458 Bacteria 1490
88 Ga0070681_10480277 3300005458 Bacteria 1155
89 Ga0070681_10565595 3300005458 Bacteria 1051
90 Ga0070681_10631431 3300005458 Bacteria 986
91 Ga0070681_11143643 3300005458 Unclassified 700
92 Ga0070679_100574786 3300005530 Bacteria 1070
93 Ga0070679_100629098 3300005530 Bacteria 1016
94 Ga0070684_100001845 3300005535 Bacteria 15508
95 Ga0070684_100016327 3300005535 Bacteria 6066
96 Ga0070684_101366305 3300005535 Bacteria 667
97 Ga0068853_100001473 3300005539 Bacteria 17091
98 Ga0068853_100019120 3300005539 Bacteria 5676
99 Ga0068853_100044535 3300005539 Bacteria 3798
100 Ga0068853_100066720 3300005539 Bacteria 3125
101 Ga0068853_100530240 3300005539 Bacteria 1114
102 Ga0068853_100542070 3300005539 Bacteria 1101
103 Ga0068853_100607965 3300005539 Bacteria 1038
104 Ga0070672_100027911 3300005543 Bacteria 4216
105 Ga0070696_101016504 3300005546 Bacteria 693
106 Ga0070693_100004724 3300005547 Bacteria 6477
107 Ga0070693_100123177 3300005547 Bacteria 1611
108 Ga0070693_100125591 3300005547 Bacteria 1597
109 Ga0070693_100289486 3300005547 Bacteria 1100
110 Ga0070665_100002680 3300005548 Bacteria 19346
111 Ga0070665_100330040 3300005548 Bacteria 1530
112 Ga0068855_100000194 3300005563 Bacteria 78505
113 Ga0068855_100025803 3300005563 Bacteria 7028
114 Ga0068855_100347078 3300005563 Bacteria 1635
115 Ga0068855_100445966 3300005563 Bacteria 1413
116 Ga0068855_100865247 3300005563 Unclassified 957
117 Ga0070664_100000128 3300005564 Bacteria 50589
118 Ga0070664_100012119 3300005564 Bacteria 7002
119 Ga0070664_100201399 3300005564 Bacteria 1777
120 Ga0070664_100212612 3300005564 Bacteria 1729
121 Ga0070664_100336748 3300005564 Bacteria 1370
122 Ga0070664_100755101 3300005564 Bacteria 908
123 Ga0068857_100088923 3300005577 Bacteria 2763
124 Ga0068857_100232103 3300005577 Bacteria 1688
125 Ga0068854_100085693 3300005578 Bacteria 2334
126 Ga0068854_100114271 3300005578 Bacteria 2041
127 Ga0068854_100222961 3300005578 Bacteria 1492
128 Ga0068854_100254405 3300005578 Bacteria 1404
129 Ga0068854_100392994 3300005578 Bacteria 1146
130 Ga0068854_101372480 3300005578 Bacteria 638
131 Ga0068856_100001416 3300005614 Bacteria 25152
132 Ga0068856_100597575 3300005614 Bacteria 1124
133 Ga0068856_100876911 3300005614 Bacteria 916
134 Ga0068856_101919208 3300005614 Unclassified 603
135 Ga0068852_100001980 3300005616 Bacteria 13967
136 Ga0068852_100004940 3300005616 Bacteria 9471
137 Ga0068852_100015771 3300005616 Bacteria 5875
138 Ga0068852_100155573 3300005616 Bacteria 2129
139 Ga0068852_100159891 3300005616 Bacteria 2102
140 Ga0068852_102491272 3300005616 Bacteria 537
141 Ga0068859_100388583 3300005617 Bacteria 1491
142 Ga0068859_100476231 3300005617 Bacteria 1344
143 Ga0068859_100563126 3300005617 Bacteria 1234
144 Ga0068864_100007983 3300005618 Bacteria 8726
145 Ga0068851_10015540 3300005834 Bacteria 3628
146 Ga0068851_10141510 3300005834 Bacteria 1308
147 Ga0068851_10439909 3300005834 Bacteria 773
148 Ga0068863_100221076 3300005841 Bacteria 1825
149 Ga0068863_100255892 3300005841 Bacteria 1692
150 Ga0068858_100655644 3300005842 Bacteria 1020
151 Ga0097621_101466256 3300006237 Bacteria 647
152 Ga0068871_100479955 3300006358 Bacteria 1118
153 Ga0097620_100388603 3300006931 Bacteria 1491
154 Ga0097620_100476130 3300006931 Bacteria 1344
155 Ga0097620_100563137 3300006931 Bacteria 1234
156 Ga0105240_10350455 3300009093 Bacteria 1675
157 Ga0105240_10637311 3300009093 Bacteria 1170
158 Ga0105241_10116350 3300009174 Bacteria 2147
159 Ga0105241_10131352 3300009174 Bacteria 2028
160 Ga0105241_10710611 3300009174 Bacteria 918
161 Ga0105241_11804042 3300009174 Bacteria 597
162 Ga0105248_10000206 3300009177 Bacteria 67932
163 Ga0105248_10011122 3300009177 Bacteria 9932
164 Ga0105237_10943880 3300009545 Bacteria 870
165 Ga0105238_10054040 3300009551 Bacteria 4035
166 Ga0105238_10123357 3300009551 Bacteria 2570
167 Ga0105238_10341427 3300009551 Bacteria 1486
168 Ga0105238_10595982 3300009551 Bacteria 1113
169 Ga0157373_10052316 3300013100 Bacteria 2906
170 Ga0157373_10131941 3300013100 Bacteria 1757
171 Ga0157373_10161955 3300013100 Bacteria 1574
172 Ga0157373_10191492 3300013100 Bacteria 1441
173 Ga0157373_10282590 3300013100 Bacteria 1176
174 Ga0157373_10287877 3300013100 Bacteria 1165
175 Ga0157373_10301753 3300013100 Bacteria 1137
176 Ga0157373_10375348 3300013100 Bacteria 1017
177 Ga0157373_11492839 3300013100 Bacteria 516
178 Ga0157371_10006809 3300013102 Bacteria 9341
179 Ga0157371_10094407 3300013102 Bacteria 2120
180 Ga0157371_10505028 3300013102 Bacteria 893
181 Ga0157371_10521276 3300013102 Bacteria 879
182 Ga0157370_10048264 3300013104 Bacteria 4078
183 Ga0157370_10254672 3300013104 Bacteria 1623
184 Ga0157369_10006712 3300013105 Bacteria 13283
185 Ga0157369_10037659 3300013105 Bacteria 5294
186 Ga0157369_10076591 3300013105 Bacteria 3586
187 Ga0157369_10469152 3300013105 Bacteria 1303
188 Ga0157369_12357171 3300013105 Bacteria 539
189 Ga0157374_10174075 3300013296 Bacteria 2100
190 Ga0157374_10249850 3300013296 Bacteria 1745
191 Ga0157374_10709061 3300013296 Bacteria 1019
192 Ga0157378_11116681 3300013297 Bacteria 826
193 Ga0163162_12562804 3300013306 Bacteria 587
194 Ga0157372_10031243 3300013307 Bacteria 5831
195 Ga0157372_10262698 3300013307 Bacteria 2005
196 Ga0157372_11040203 3300013307 Bacteria 948
197 Ga0157372_11086775 3300013307 Bacteria 925
198 Ga0157372_11099167 3300013307 Unclassified 920
199 Ga0157372_12073201 3300013307 Bacteria 653
200 Ga0157372_12536604 3300013307 Unclassified 588
201 Ga0163163_10000286 3300014325 Bacteria 50173
202 Ga0182008_10123137 3300014497 Bacteria 1289
203 Ga0157379_10012836 3300014968 Bacteria 7326
204 Ga0157379_12081008 3300014968 Bacteria 562
205 Ga0207656_10082711 3300025321 Bacteria 1445
206 Ga0207656_10257440 3300025321 Bacteria 856
207 Ga0207656_10704373 3300025321 Bacteria 517
208 Ga0207688_11022746 3300025901 Bacteria 522
209 Ga0207680_10014571 3300025903 Bacteria 4075
210 Ga0207680_10035008 3300025903 Bacteria 2878
211 Ga0207680_11092485 3300025903 Bacteria 570
212 Ga0207647_10005488 3300025904 Bacteria 9283
213 Ga0207647_10059353 3300025904 Bacteria 2341
214 Ga0207647_10427831 3300025904 Bacteria 744
215 Ga0207645_10015763 3300025907 Bacteria 5012
216 Ga0207645_10975986 3300025907 Bacteria 574
217 Ga0207705_10004248 3300025909 Bacteria 10845
218 Ga0207705_10008507 3300025909 Bacteria 7488
219 Ga0207705_10036469 3300025909 Bacteria 3518
220 Ga0207705_10215656 3300025909 Bacteria 1456
221 Ga0207705_10237949 3300025909 Bacteria 1386
222 Ga0207705_10277711 3300025909 Bacteria 1282
223 Ga0207705_10360413 3300025909 Bacteria 1121
224 Ga0207705_10442018 3300025909 Bacteria 1008
225 Ga0207654_10044387 3300025911 Bacteria 2524
226 Ga0207654_10797344 3300025911 Bacteria 682
227 Ga0207707_10074804 3300025912 Bacteria 2955
228 Ga0207707_10354970 3300025912 Bacteria 1263
229 Ga0207707_10896087 3300025912 Bacteria 734
230 Ga0207707_11390493 3300025912 Bacteria 560
231 Ga0207695_10108802 3300025913 Bacteria 2755
232 Ga0207695_10464532 3300025913 Bacteria 1148
233 Ga0207671_10168955 3300025914 Bacteria 1697
234 Ga0207660_10001233 3300025917 Bacteria 17134
235 Ga0207660_10192546 3300025917 Bacteria 1589
236 Ga0207657_10000398 3300025919 Bacteria 46000
237 Ga0207657_10028164 3300025919 Bacteria 5131
238 Ga0207657_10091540 3300025919 Bacteria 2536
239 Ga0207657_10109438 3300025919 Bacteria 2283
240 Ga0207657_10143613 3300025919 Bacteria 1948
241 Ga0207657_10160452 3300025919 Bacteria 1826
242 Ga0207657_10220190 3300025919 Bacteria 1521
243 Ga0207657_10434664 3300025919 Bacteria 1031
244 Ga0207649_10002077 3300025920 Bacteria 11388
245 Ga0207649_10045003 3300025920 Bacteria 2704
246 Ga0207649_10083738 3300025920 Bacteria 2071
247 Ga0207649_10123063 3300025920 Bacteria 1751
248 Ga0207649_10213526 3300025920 Bacteria 1370
249 Ga0207649_10243459 3300025920 Bacteria 1292
250 Ga0207649_10393892 3300025920 Bacteria 1035
251 Ga0207649_10744350 3300025920 Bacteria 762
252 Ga0207652_10246678 3300025921 Bacteria 1610
253 Ga0207652_10431248 3300025921 Bacteria 1188
254 Ga0207652_10675144 3300025921 Bacteria 923
255 Ga0207694_10001947 3300025924 Bacteria 17083
256 Ga0207694_10015155 3300025924 Bacteria 5814
257 Ga0207694_10040976 3300025924 Bacteria 3568
258 Ga0207650_10005229 3300025925 Bacteria 8847
259 Ga0207650_11782257 3300025925 Bacteria 521
260 Ga0207659_11469337 3300025926 Bacteria 583
261 Ga0207644_10061733 3300025931 Bacteria 2716
262 Ga0207644_10353039 3300025931 Bacteria 1194
263 Ga0207690_10000118 3300025932 Bacteria 65435
264 Ga0207690_10001613 3300025932 Bacteria 14054
265 Ga0207690_10094833 3300025932 Bacteria 2118
266 Ga0207690_10131661 3300025932 Bacteria 1831
267 Ga0207690_10212284 3300025932 Bacteria 1476
268 Ga0207690_10446921 3300025932 Bacteria 1038
269 Ga0207690_10849054 3300025932 Bacteria 756
270 Ga0207690_10944479 3300025932 Bacteria 716
271 Ga0207706_10001030 3300025933 Bacteria 28340
272 Ga0207706_10034152 3300025933 Bacteria 4525
273 Ga0207706_10539291 3300025933 Bacteria 1005
274 Ga0207691_10177124 3300025940 Bacteria 1864
275 Ga0207711_10003902 3300025941 Bacteria 12832
276 Ga0207711_10005230 3300025941 Bacteria 10997
277 Ga0207661_10108834 3300025944 Bacteria 2340
278 Ga0207661_10999121 3300025944 Bacteria 771
279 Ga0207661_11439319 3300025944 Bacteria 632
280 Ga0207661_11459273 3300025944 Bacteria 627
281 Ga0207679_10002671 3300025945 Bacteria 11010
282 Ga0207679_10074292 3300025945 Bacteria 2575
283 Ga0207679_10152437 3300025945 Bacteria 1883
284 Ga0207679_10466191 3300025945 Bacteria 1122
285 Ga0207679_10679128 3300025945 Bacteria 933
286 Ga0207667_10002436 3300025949 Bacteria 23296
287 Ga0207667_10056858 3300025949 Bacteria 4107
288 Ga0207667_10148173 3300025949 Bacteria 2416
289 Ga0207667_10698677 3300025949 Bacteria 1017
290 Ga0207667_10865780 3300025949 Bacteria 897
291 Ga0207651_10049260 3300025960 Bacteria 2853
292 Ga0207651_10428551 3300025960 Bacteria 1131
293 Ga0207640_10035062 3300025981 Bacteria 3137
294 Ga0207640_10103916 3300025981 Bacteria 1999
295 Ga0207640_10345897 3300025981 Bacteria 1193
296 Ga0207640_10456039 3300025981 Bacteria 1055
297 Ga0207640_11953371 3300025981 Bacteria 531
298 Ga0207658_10071436 3300025986 Bacteria 2628
299 Ga0207658_10106011 3300025986 Bacteria 2212
300 Ga0207677_10238917 3300026023 Bacteria 1468
301 Ga0207703_10031903 3300026035 Bacteria 4169
302 Ga0207639_10001100 3300026041 Bacteria 18365
303 Ga0207639_10007359 3300026041 Bacteria 7503
304 Ga0207639_10067069 3300026041 Bacteria 2791
305 Ga0207639_10423140 3300026041 Bacteria 1204
306 Ga0207639_10808224 3300026041 Bacteria 874
307 Ga0207639_11626856 3300026041 Bacteria 606
308 Ga0207639_11717041 3300026041 Unclassified 588
309 Ga0207678_10008428 3300026067 Bacteria 9092
310 Ga0207678_10014184 3300026067 Bacteria 7006
311 Ga0207678_10049159 3300026067 Bacteria 3644
312 Ga0207702_10000074 3300026078 Bacteria 113070
313 Ga0207702_10511472 3300026078 Bacteria 1171
314 Ga0207702_12118681 3300026078 Bacteria 552
315 Ga0207641_10194089 3300026088 Bacteria 1868
316 Ga0207641_10639557 3300026088 Bacteria 1044
317 Ga0207676_10006747 3300026095 Bacteria 8126
318 Ga0207674_10076670 3300026116 Bacteria 3350
319 Ga0207674_10187154 3300026116 Bacteria 2021
320 Ga0207674_11984853 3300026116 Bacteria 547
321 Ga0207683_11066260 3300026121 Bacteria 750
322 Ga0207698_10002256 3300026142 Bacteria 11410
323 Ga0207698_10010710 3300026142 Bacteria 5915
324 Ga0207698_10122355 3300026142 Bacteria 2205
325 Ga0207698_10237640 3300026142 Bacteria 1658
326 Ga0207698_10271929 3300026142 Bacteria 1562
327 Ga0207698_10329662 3300026142 Bacteria 1433
328 Ga0268266_10008309 3300028379 Bacteria 9243
329 Ga0268266_10222516 3300028379 Bacteria 1736
330 Ga0307408_101596340 3300031548 Bacteria 619
331 Ga0307405_10019663 3300031731 Bacteria 3757
332 Ga0307413_10179695 3300031824 Bacteria 1507
333 Ga0307410_10014675 3300031852 Bacteria 4620
334 Ga0307406_10062150 3300031901 Bacteria 2415
335 Ga0307407_10030927 3300031903 Bacteria 2894
336 Ga0307412_10520883 3300031911 Bacteria 993
337 Ga0307409_100046015 3300031995 Bacteria 3300
338 Ga0307416_100313104 3300032002 Bacteria 1567
339 Ga0307416_103535411 3300032002 Bacteria 523
340 Ga0307414_10174267 3300032004 Bacteria 1723
341 Ga0307411_10107787 3300032005 Bacteria 1986
342 Ga0307411_10718659 3300032005 Bacteria 872
343 Ga0307411_11277942 3300032005 Bacteria 668
344 Ga0307415_100008121 3300032126 Bacteria 5798
345 Ga0373930_0090523 3300034816 Bacteria 717
346 Ga0373950_0053022 3300034818 Bacteria 800
347 Ga0373959_0122365 3300034820 Bacteria 637
348 Ga0373929_0040317 3300035085 Bacteria 1034
349 Ga0373941_0219608 3300035115 Bacteria 730
350 Ga0373960_0012452 3300035121 Bacteria 2114
351 Ga0373962_0313104 3300035242 Bacteria 559
352 Ga0373931_0011619 3300035691 Bacteria 4254
353 Ga0373947_1131176 3300035725 Unclassified 534
354 Ga0395899_0000157 3300037312 Bacteria 103574
355 Ga0395899_0005498 3300037312 Bacteria 9818
356 Ga0395899_0006779 3300037312 Bacteria 8873
357 Ga0395899_0031909 3300037312 Bacteria 3958
358 Ga0395899_0037733 3300037312 Bacteria 3621
359 Ga0395899_0115069 3300037312 Bacteria 1931
360 Ga0395899_0273958 3300037312 Bacteria 1150
361 Ga0395899_0294981 3300037312 Bacteria 1099
362 Ga0395899_0323435 3300037312 Bacteria 1038
363 Ga0395900_0000296 3300037418 Bacteria 74995
364 Ga0395900_0003608 3300037418 Bacteria 16633
365 Ga0395900_0034862 3300037418 Bacteria 5185
366 Ga0395900_0052806 3300037418 Bacteria 4183
367 Ga0395900_0095259 3300037418 Bacteria 3058
368 Ga0395900_0115216 3300037418 Bacteria 2758
369 Ga0395900_0129707 3300037418 Bacteria 2584
370 Ga0395900_0265293 3300037418 Bacteria 1713
371 Ga0395900_0334110 3300037418 Bacteria 1492
372 Ga0395900_0383436 3300037418 Bacteria 1373
373 Ga0395900_0603518 3300037418 Bacteria 1038
374 Ga0395900_0609136 3300037418 Bacteria 1032
375 Ga0395900_0970239 3300037418 Bacteria 771
376 Ga0395900_1082315 3300037418 Bacteria 719
377 Ga0395900_1174320 3300037418 Bacteria 683
378 Ga0395900_1388589 3300037418 Bacteria 615
379 Ga0395898_0000054 3300037466 Bacteria 279561
380 Ga0395898_0012372 3300037466 Bacteria 8824
381 Ga0395898_0026173 3300037466 Bacteria 5871
382 Ga0395898_0150021 3300037466 Bacteria 2231
383 Ga0395898_0486469 3300037466 Bacteria 1174
384 Ga0395898_0917307 3300037466 Bacteria 814
385 Ga0395898_0999167 3300037466 Unclassified 772
386 Ga0395898_1894744 3300037466 Bacteria 516
387 Ga0395898_1908884 3300037466 Bacteria 514
388 Ga0395905_0000046 3300037471 Bacteria 240463
389 Ga0395905_0001856 3300037471 Bacteria 24336
390 Ga0395905_0003152 3300037471 Bacteria 17761
391 Ga0395905_0017019 3300037471 Bacteria 6902
392 Ga0395905_0028239 3300037471 Bacteria 5288
393 Ga0395905_0052877 3300037471 Bacteria 3802
394 Ga0395905_0090433 3300037471 Bacteria 2869
395 Ga0395905_0158978 3300037471 Bacteria 2124
396 Ga0395905_0280774 3300037471 Bacteria 1551
397 Ga0395905_0287324 3300037471 Bacteria 1531
398 Ga0395905_0305976 3300037471 Bacteria 1477
399 Ga0395905_0308923 3300037471 Bacteria 1469
400 Ga0395905_0364652 3300037471 Bacteria 1337
401 Ga0395905_0365575 3300037471 Bacteria 1336
402 Ga0395905_0689404 3300037471 Bacteria 924
403 Ga0395905_0700551 3300037471 Bacteria 915
404 Ga0395905_1114509 3300037471 Bacteria 692
405 Ga0395905_1144669 3300037471 Bacteria 681
406 Ga0395905_1159364 3300037471 Bacteria 676
407 Ga0395905_1530869 3300037471 Bacteria 571
408 Ga0395901_0000086 3300038443 Bacteria 125359
409 Ga0395901_0001078 3300038443 Bacteria 29167
410 Ga0395901_0001633 3300038443 Bacteria 23187
411 Ga0395901_0008013 3300038443 Bacteria 10668
412 Ga0395901_0057600 3300038443 Bacteria 4041
413 Ga0395901_0126212 3300038443 Bacteria 2689
414 Ga0395901_0179789 3300038443 Bacteria 2218
415 Ga0395901_0302146 3300038443 Bacteria 1659
416 Ga0395901_0389697 3300038443 Bacteria 1433
417 Ga0395901_0559999 3300038443 Bacteria 1157
418 Ga0439448_0009481 3300042005 Bacteria 2871
419 Ga0439455_0002064 3300042012 Bacteria 3567
420 Ga0439458_0000052 3300042157 Bacteria 19610
421 Ga0466969_0063363 3300044656 Bacteria 1792
422 Ga0466972_0026297 3300044658 Bacteria 2884
423 Ga0466972_0519535 3300044658 Bacteria 561
424 Ga0466965_0280803 3300044683 Bacteria 899
425 Ga0466961_0008199 3300044693 Bacteria 6655
426 Ga0466961_0013906 3300044693 Bacteria 5157
427 Ga0466961_0065739 3300044693 Bacteria 2304
428 Ga0466961_0268565 3300044693 Unclassified 1045
429 Ga0466963_0001030 3300044694 Bacteria 14471
430 Ga0466963_0003606 3300044694 Bacteria 8898
431 Ga0466963_0017691 3300044694 Bacteria 4445
432 Ga0466963_0017817 3300044694 Bacteria 4432
433 Ga0466963_0032264 3300044694 Bacteria 3391
434 Ga0466963_0053726 3300044694 Bacteria 2675
435 Ga0466963_0193873 3300044694 Bacteria 1420
436 Ga0466963_0249255 3300044694 Bacteria 1246
437 Ga0466963_0721361 3300044694 Bacteria 703
438 Ga0466963_1118325 3300044694 Bacteria 554
439 Ga0466964_0009399 3300044706 Bacteria 3679
440 Ga0466964_0014289 3300044706 Bacteria 3018
441 Ga0466964_0179721 3300044706 Bacteria 1002
442 Ga0466964_0392780 3300044706 Bacteria 723
443 Ga0466964_0758635 3300044706 Unclassified 545
444 Ga0466971_0007864 3300044719 Bacteria 4644
445 Ga0466971_0094038 3300044719 Bacteria 1374
446 Ga0466971_0107676 3300044719 Bacteria 1284
447 Ga0466971_0137171 3300044719 Bacteria 1138
448 Ga0466971_0291259 3300044719 Bacteria 783
449 Ga0466968_0017208 3300044735 Bacteria 2886
450 Ga0466970_0005244 3300044765 Bacteria 6416
451 Ga0466970_0016574 3300044765 Bacteria 3801
452 Ga0466970_0227945 3300044765 Bacteria 1041
453 Ga0466957_0001015 3300044842 Bacteria 14460
454 Ga0466957_0020116 3300044842 Bacteria 3928
455 Ga0466957_0021129 3300044842 Bacteria 3833
456 Ga0466957_0052624 3300044842 Bacteria 2479
457 Ga0466957_0058754 3300044842 Bacteria 2356
458 Ga0466957_0076115 3300044842 Bacteria 2083
459 Ga0466957_0126227 3300044842 Bacteria 1635
460 Ga0466957_0252225 3300044842 Bacteria 1174
461 Ga0466957_0869809 3300044842 Bacteria 643
462 Ga0466959_0106155 3300045049 Bacteria 2008
463 Ga0466959_0160206 3300045049 Bacteria 1582
464 Ga0466959_0278467 3300045049 Bacteria 1148
465 Ga0466959_0608793 3300045049 Bacteria 734
466 Ga0466959_0660364 3300045049 Bacteria 702
467 Ga0466958_0005152 3300045836 Bacteria 6988
468 Ga0466958_0010586 3300045836 Bacteria 5169
469 Ga0466958_0014789 3300045836 Bacteria 4459
470 Ga0466958_0027157 3300045836 Bacteria 3387
471 Ga0466958_0107223 3300045836 Bacteria 1742
472 Ga0466958_0565688 3300045836 Bacteria 739
473 Ga0466958_1175188 3300045836 Bacteria 501
474 Ga0466967_0010506 3300045976 Bacteria 6950
475 Ga0466967_0015358 3300045976 Bacteria 5998
476 Ga0466967_0020008 3300045976 Bacteria 5398
477 Ga0466967_0022531 3300045976 Bacteria 5142
478 Ga0466967_0033079 3300045976 Bacteria 4374
479 Ga0466967_0033452 3300045976 Bacteria 4352
480 Ga0466967_0061713 3300045976 Bacteria 3326
481 Ga0466967_0070142 3300045976 Bacteria 3134
482 Ga0466967_0097936 3300045976 Bacteria 2677
483 Ga0466967_0110833 3300045976 Bacteria 2521
484 Ga0466967_0147558 3300045976 Bacteria 2195
485 Ga0466967_0168154 3300045976 Bacteria 2061
486 Ga0466967_0173157 3300045976 Bacteria 2032
487 Ga0466967_0202772 3300045976 Bacteria 1879
488 Ga0466967_0269789 3300045976 Bacteria 1630
489 Ga0466967_0354126 3300045976 Bacteria 1421
490 Ga0466967_0385949 3300045976 Bacteria 1360
491 Ga0466967_0465453 3300045976 Bacteria 1237
492 Ga0466967_0912542 3300045976 Bacteria 874
493 Ga0466967_1359394 3300045976 Bacteria 707
494 Ga0466967_1665863 3300045976 Bacteria 635
495 Ga0466967_1751706 3300045976 Bacteria 618
496 Ga0495663_0318429 3300046525 Bacteria 562
497 Ga0495642_0036913 3300046528 Bacteria 1976
498 Ga0495669_0018249 3300046684 Bacteria 3015
499 Ga0496100_0070924 3300048903 Bacteria 2325
500 Ga0496101_0062078 3300048904 Bacteria 2716
501 Ga0496106_0007523 3300048909 Bacteria 8055
502 Ga0496106_0222685 3300048909 Bacteria 1505
503 Ga0496107_0007836 3300048910 Bacteria 7374
504 Ga0496107_0295044 3300048910 Bacteria 1207
505 Ga0496107_0316725 3300048910 Bacteria 1161
506 Ga0496108_0165274 3300048911 Bacteria 1913
507 Ga0496109_0035112 3300048912 Bacteria 4521
508 Ga0496109_1427940 3300048912 Bacteria 627
509 Ga0496110_0210020 3300048913 Bacteria 1769
510 Ga0496111_0002221 3300048914 Bacteria 11637
511 Ga0496111_0310759 3300048914 Bacteria 1168
512 Ga0496112_0004584 3300048915 Bacteria 11750
513 Ga0496112_0079029 3300048915 Bacteria 3253
514 Ga0496113_0092123 3300048916 Bacteria 2337
515 Ga0496113_0110695 3300048916 Bacteria 2137
516 Ga0496114_1272969 3300048917 Bacteria 622
517 Ga0501047_0292648 3300049581 Bacteria 1472
518 Ga0501073_0198153 3300049589 Bacteria 1389
519 Ga0501080_0042513 3300049742 Bacteria 4231
520 Ga0466962_0002505 3300061719 Bacteria 8716
521 Ga0466962_0019137 3300061719 Bacteria 3288
522 Ga0466962_0053039 3300061719 Bacteria 1938
523 Ga0466962_0073912 3300061719 Bacteria 1629
524 Ga0466962_0199641 3300061719 Bacteria 977
525 Ga0466962_0289934 3300061719 Bacteria 808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044694 Ga0466963_1118325 Ga0466963_1118325_171_380 62
2 3300045976 Ga0466967_0269789 Ga0466967_0269789_193_402 62
3 3300005578 Ga0068854_101372480 Ga0068854_1013724802 66
4 3300037471 Ga0395905_0052877 Ga0395905_0052877_29_232 67
5 3300045976 Ga0466967_0173157 Ga0466967_0173157_650_853 67
6 3300001979 JGI24740J21852_10011521 JGI24740J21852_100115214 68
7 3300001989 JGI24739J22299_10007060 JGI24739J22299_100070603 68
8 3300001989 JGI24739J22299_10007725 JGI24739J22299_100077255 68
9 3300001989 JGI24739J22299_10180429 JGI24739J22299_101804292 68
10 3300001990 JGI24737J22298_10000312 JGI24737J22298_1000031215 68
11 3300001990 JGI24737J22298_10010495 JGI24737J22298_100104953 68
12 3300001990 JGI24737J22298_10038451 JGI24737J22298_100384513 68
13 3300002067 JGI24735J21928_10043591 JGI24735J21928_100435913 68
14 3300002075 JGI24738J21930_10000308 JGI24738J21930_1000030813 68
15 3300005327 Ga0070658_10004530 Ga0070658_100045303 68
16 3300005327 Ga0070658_10005046 Ga0070658_100050464 68
17 3300005327 Ga0070658_10243327 Ga0070658_102433273 68
18 3300005327 Ga0070658_10301814 Ga0070658_103018143 68
19 3300005327 Ga0070658_10419331 Ga0070658_104193312 68
20 3300005327 Ga0070658_10513199 Ga0070658_105131992 68
21 3300005328 Ga0070676_10126932 Ga0070676_101269323 68
22 3300005328 Ga0070676_10360958 Ga0070676_103609582 68
23 3300005328 Ga0070676_11355954 Ga0070676_113559542 68
24 3300005329 Ga0070683_100008343 Ga0070683_10000834310 68
25 3300005329 Ga0070683_100024905 Ga0070683_1000249058 68
26 3300005329 Ga0070683_100610312 Ga0070683_1006103122 68
27 3300005329 Ga0070683_101623902 Ga0070683_1016239022 68
28 3300005330 Ga0070690_100343013 Ga0070690_1003430132 68
29 3300005330 Ga0070690_100478433 Ga0070690_1004784332 68
30 3300005331 Ga0070670_100009961 Ga0070670_1000099615 68
31 3300005331 Ga0070670_101949743 Ga0070670_1019497431 68
32 3300005335 Ga0070666_10000591 Ga0070666_100005916 68
33 3300005335 Ga0070666_10630131 Ga0070666_106301312 68
34 3300005335 Ga0070666_11382977 Ga0070666_113829772 68
35 3300005336 Ga0070680_100004651 Ga0070680_1000046515 68
36 3300005336 Ga0070680_100318119 Ga0070680_1003181192 68
37 3300005336 Ga0070680_101226573 Ga0070680_1012265732 68
38 3300005336 Ga0070680_101598357 Ga0070680_1015983572 68
39 3300005337 Ga0070682_100092465 Ga0070682_1000924653 68
40 3300005337 Ga0070682_100150536 Ga0070682_1001505363 68
41 3300005337 Ga0070682_101527131 Ga0070682_1015271312 68
42 3300005338 Ga0068868_100551920 Ga0068868_1005519202 68
43 3300005338 Ga0068868_102034061 Ga0068868_1020340611 68
44 3300005339 Ga0070660_100001567 Ga0070660_1000015678 68
45 3300005339 Ga0070660_100189731 Ga0070660_1001897312 68
46 3300005339 Ga0070660_100226437 Ga0070660_1002264373 68
47 3300005339 Ga0070660_100230376 Ga0070660_1002303762 68
48 3300005339 Ga0070660_101330940 Ga0070660_1013309401 68
49 3300005339 Ga0070660_101581384 Ga0070660_1015813842 68
50 3300005341 Ga0070691_10342333 Ga0070691_103423332 68
51 3300005344 Ga0070661_100000354 Ga0070661_10000035427 68
52 3300005344 Ga0070661_100108791 Ga0070661_1001087911 68
53 3300005344 Ga0070661_100260541 Ga0070661_1002605412 68
54 3300005344 Ga0070661_100265982 Ga0070661_1002659823 68
55 3300005344 Ga0070661_100342088 Ga0070661_1003420882 68
56 3300005344 Ga0070661_100394993 Ga0070661_1003949933 68
57 3300005344 Ga0070661_101145110 Ga0070661_1011451102 68
58 3300005345 Ga0070692_10309742 Ga0070692_103097422 68
59 3300005345 Ga0070692_10392467 Ga0070692_103924672 68
60 3300005345 Ga0070692_10906740 Ga0070692_109067402 68
61 3300005353 Ga0070669_100278755 Ga0070669_1002787552 68
62 3300005353 Ga0070669_100597989 Ga0070669_1005979893 68
63 3300005354 Ga0070675_101672825 Ga0070675_1016728252 68
64 3300005355 Ga0070671_100001348 Ga0070671_10000134812 68
65 3300005355 Ga0070671_100223947 Ga0070671_1002239472 68
66 3300005355 Ga0070671_100641114 Ga0070671_1006411142 68
67 3300005364 Ga0070673_100051974 Ga0070673_1000519743 68
68 3300005366 Ga0070659_100000311 Ga0070659_10000031110 68
69 3300005366 Ga0070659_100000790 Ga0070659_1000007904 68
70 3300005366 Ga0070659_100040331 Ga0070659_1000403313 68
71 3300005366 Ga0070659_100065982 Ga0070659_1000659825 68
72 3300005366 Ga0070659_100150780 Ga0070659_1001507802 68
73 3300005366 Ga0070659_100166012 Ga0070659_1001660123 68
74 3300005366 Ga0070659_100417185 Ga0070659_1004171852 68
75 3300005366 Ga0070659_100865172 Ga0070659_1008651722 68
76 3300005366 Ga0070659_100963269 Ga0070659_1009632691 68
77 3300005367 Ga0070667_100088096 Ga0070667_1000880963 68
78 3300005367 Ga0070667_100288601 Ga0070667_1002886013 68
79 3300005367 Ga0070667_100355190 Ga0070667_1003551903 68
80 3300005436 Ga0070713_100790469 Ga0070713_1007904692 68
81 3300005455 Ga0070663_100004050 Ga0070663_1000040503 68
82 3300005455 Ga0070663_100047488 Ga0070663_1000474883 68
83 3300005455 Ga0070663_100232452 Ga0070663_1002324523 68
84 3300005455 Ga0070663_101036655 Ga0070663_1010366552 68
85 3300005456 Ga0070678_101518678 Ga0070678_1015186781 68
86 3300005457 Ga0070662_100001149 Ga0070662_10000114910 68
87 3300005457 Ga0070662_100051397 Ga0070662_1000513974 68
88 3300005457 Ga0070662_100151533 Ga0070662_1001515333 68
89 3300005457 Ga0070662_100177064 Ga0070662_1001770643 68
90 3300005457 Ga0070662_100189243 Ga0070662_1001892433 68
91 3300005457 Ga0070662_101142956 Ga0070662_1011429562 68
92 3300005458 Ga0070681_10309265 Ga0070681_103092653 68
93 3300005458 Ga0070681_10480277 Ga0070681_104802773 68
94 3300005458 Ga0070681_10565595 Ga0070681_105655952 68
95 3300005458 Ga0070681_10631431 Ga0070681_106314313 68
96 3300005458 Ga0070681_11143643 Ga0070681_111436432 68
97 3300005530 Ga0070679_100574786 Ga0070679_1005747862 68
98 3300005530 Ga0070679_100629098 Ga0070679_1006290982 68
99 3300005535 Ga0070684_100001845 Ga0070684_10000184516 68
100 3300005535 Ga0070684_100016327 Ga0070684_1000163272 68
101 3300005535 Ga0070684_101366305 Ga0070684_1013663052 68
102 3300005539 Ga0068853_100001473 Ga0068853_10000147310 68
103 3300005539 Ga0068853_100019120 Ga0068853_1000191203 68
104 3300005539 Ga0068853_100044535 Ga0068853_1000445353 68
105 3300005539 Ga0068853_100066720 Ga0068853_1000667203 68
106 3300005539 Ga0068853_100530240 Ga0068853_1005302402 68
107 3300005539 Ga0068853_100542070 Ga0068853_1005420701 68
108 3300005539 Ga0068853_100607965 Ga0068853_1006079652 68
109 3300005543 Ga0070672_100027911 Ga0070672_1000279113 68
110 3300005546 Ga0070696_101016504 Ga0070696_1010165042 68
111 3300005547 Ga0070693_100004724 Ga0070693_1000047245 68
112 3300005547 Ga0070693_100123177 Ga0070693_1001231773 68
113 3300005547 Ga0070693_100125591 Ga0070693_1001255912 68
114 3300005547 Ga0070693_100289486 Ga0070693_1002894863 68
115 3300005548 Ga0070665_100002680 Ga0070665_1000026806 68
116 3300005548 Ga0070665_100330040 Ga0070665_1003300403 68
117 3300005563 Ga0068855_100000194 Ga0068855_1000001943 68
118 3300005563 Ga0068855_100025803 Ga0068855_1000258035 68
119 3300005563 Ga0068855_100347078 Ga0068855_1003470782 68
120 3300005563 Ga0068855_100445966 Ga0068855_1004459663 68
121 3300005563 Ga0068855_100865247 Ga0068855_1008652473 68
122 3300005564 Ga0070664_100000128 Ga0070664_10000012829 68
123 3300005564 Ga0070664_100012119 Ga0070664_1000121192 68
124 3300005564 Ga0070664_100201399 Ga0070664_1002013993 68
125 3300005564 Ga0070664_100212612 Ga0070664_1002126123 68
126 3300005564 Ga0070664_100336748 Ga0070664_1003367483 68
127 3300005564 Ga0070664_100755101 Ga0070664_1007551012 68
128 3300005577 Ga0068857_100088923 Ga0068857_1000889233 68
129 3300005577 Ga0068857_100232103 Ga0068857_1002321033 68
130 3300005578 Ga0068854_100085693 Ga0068854_1000856932 68
131 3300005578 Ga0068854_100114271 Ga0068854_1001142712 68
132 3300005578 Ga0068854_100222961 Ga0068854_1002229613 68
133 3300005578 Ga0068854_100254405 Ga0068854_1002544052 68
134 3300005578 Ga0068854_100392994 Ga0068854_1003929942 68
135 3300005614 Ga0068856_100001416 Ga0068856_10000141610 68
136 3300005614 Ga0068856_100597575 Ga0068856_1005975752 68
137 3300005614 Ga0068856_100876911 Ga0068856_1008769112 68
138 3300005614 Ga0068856_101919208 Ga0068856_1019192082 68
139 3300005616 Ga0068852_100001980 Ga0068852_1000019805 68
140 3300005616 Ga0068852_100004940 Ga0068852_10000494011 68
141 3300005616 Ga0068852_100015771 Ga0068852_1000157718 68
142 3300005616 Ga0068852_100155573 Ga0068852_1001555733 68
143 3300005616 Ga0068852_100159891 Ga0068852_1001598913 68
144 3300005616 Ga0068852_102491272 Ga0068852_1024912722 68
145 3300005617 Ga0068859_100388583 Ga0068859_1003885832 68
146 3300005617 Ga0068859_100476231 Ga0068859_1004762313 68
147 3300005617 Ga0068859_100563126 Ga0068859_1005631263 68
148 3300005618 Ga0068864_100007983 Ga0068864_1000079835 68
149 3300005834 Ga0068851_10015540 Ga0068851_100155402 68
150 3300005834 Ga0068851_10141510 Ga0068851_101415103 68
151 3300005834 Ga0068851_10439909 Ga0068851_104399092 68
152 3300005841 Ga0068863_100221076 Ga0068863_1002210762 68
153 3300005841 Ga0068863_100255892 Ga0068863_1002558923 68
154 3300005842 Ga0068858_100655644 Ga0068858_1006556441 68
155 3300006237 Ga0097621_101466256 Ga0097621_1014662562 68
156 3300006358 Ga0068871_100479955 Ga0068871_1004799552 68
157 3300006931 Ga0097620_100388603 Ga0097620_1003886032 68
158 3300006931 Ga0097620_100476130 Ga0097620_1004761303 68
159 3300006931 Ga0097620_100563137 Ga0097620_1005631373 68
160 3300009093 Ga0105240_10350455 Ga0105240_103504553 68
161 3300009093 Ga0105240_10637311 Ga0105240_106373112 68
162 3300009174 Ga0105241_10116350 Ga0105241_101163503 68
163 3300009174 Ga0105241_10131352 Ga0105241_101313523 68
164 3300009174 Ga0105241_10710611 Ga0105241_107106112 68
165 3300009174 Ga0105241_11804042 Ga0105241_118040422 68
166 3300009177 Ga0105248_10000206 Ga0105248_1000020648 68
167 3300009177 Ga0105248_10011122 Ga0105248_100111225 68
168 3300009545 Ga0105237_10943880 Ga0105237_109438802 68
169 3300009551 Ga0105238_10054040 Ga0105238_100540404 68
170 3300009551 Ga0105238_10123357 Ga0105238_101233573 68
171 3300009551 Ga0105238_10341427 Ga0105238_103414273 68
172 3300009551 Ga0105238_10595982 Ga0105238_105959823 68
173 3300013100 Ga0157373_10052316 Ga0157373_100523163 68
174 3300013100 Ga0157373_10131941 Ga0157373_101319413 68
175 3300013100 Ga0157373_10161955 Ga0157373_101619553 68
176 3300013100 Ga0157373_10191492 Ga0157373_101914923 68
177 3300013100 Ga0157373_10282590 Ga0157373_102825902 68
178 3300013100 Ga0157373_10287877 Ga0157373_102878772 68
179 3300013100 Ga0157373_10301753 Ga0157373_103017533 68
180 3300013100 Ga0157373_10375348 Ga0157373_103753482 68
181 3300013100 Ga0157373_11492839 Ga0157373_114928392 68
182 3300013102 Ga0157371_10006809 Ga0157371_100068098 68
183 3300013102 Ga0157371_10094407 Ga0157371_100944073 68
184 3300013102 Ga0157371_10505028 Ga0157371_105050282 68
185 3300013102 Ga0157371_10521276 Ga0157371_105212763 68
186 3300013104 Ga0157370_10048264 Ga0157370_100482643 68
187 3300013104 Ga0157370_10254672 Ga0157370_102546722 68
188 3300013105 Ga0157369_10006712 Ga0157369_100067128 68
189 3300013105 Ga0157369_10037659 Ga0157369_100376595 68
190 3300013105 Ga0157369_10076591 Ga0157369_100765913 68
191 3300013105 Ga0157369_10469152 Ga0157369_104691522 68
192 3300013105 Ga0157369_12357171 Ga0157369_123571712 68
193 3300013296 Ga0157374_10174075 Ga0157374_101740753 68
194 3300013296 Ga0157374_10249850 Ga0157374_102498503 68
195 3300013296 Ga0157374_10709061 Ga0157374_107090612 68
196 3300013297 Ga0157378_11116681 Ga0157378_111166812 68
197 3300013306 Ga0163162_12562804 Ga0163162_125628042 68
198 3300013307 Ga0157372_10031243 Ga0157372_100312438 68
199 3300013307 Ga0157372_10262698 Ga0157372_102626983 68
200 3300013307 Ga0157372_11040203 Ga0157372_110402032 68
201 3300013307 Ga0157372_11086775 Ga0157372_110867752 68
202 3300013307 Ga0157372_11099167 Ga0157372_110991672 68
203 3300013307 Ga0157372_12073201 Ga0157372_120732012 68
204 3300013307 Ga0157372_12536604 Ga0157372_125366042 68
205 3300014325 Ga0163163_10000286 Ga0163163_1000028637 68
206 3300014497 Ga0182008_10123137 Ga0182008_101231373 68
207 3300014968 Ga0157379_10012836 Ga0157379_100128365 68
208 3300014968 Ga0157379_12081008 Ga0157379_120810082 68
209 3300025321 Ga0207656_10082711 Ga0207656_100827113 68
210 3300025321 Ga0207656_10257440 Ga0207656_102574402 68
211 3300025321 Ga0207656_10704373 Ga0207656_107043732 68
212 3300025901 Ga0207688_11022746 Ga0207688_110227461 68
213 3300025903 Ga0207680_10014571 Ga0207680_100145716 68
214 3300025903 Ga0207680_10035008 Ga0207680_100350083 68
215 3300025903 Ga0207680_11092485 Ga0207680_110924852 68
216 3300025904 Ga0207647_10005488 Ga0207647_1000548811 68
217 3300025904 Ga0207647_10059353 Ga0207647_100593533 68
218 3300025904 Ga0207647_10427831 Ga0207647_104278311 68
219 3300025907 Ga0207645_10015763 Ga0207645_100157632 68
220 3300025907 Ga0207645_10975986 Ga0207645_109759862 68
221 3300025909 Ga0207705_10004248 Ga0207705_100042484 68
222 3300025909 Ga0207705_10008507 Ga0207705_1000850710 68
223 3300025909 Ga0207705_10036469 Ga0207705_100364693 68
224 3300025909 Ga0207705_10215656 Ga0207705_102156563 68
225 3300025909 Ga0207705_10237949 Ga0207705_102379493 68
226 3300025909 Ga0207705_10277711 Ga0207705_102777113 68
227 3300025909 Ga0207705_10360413 Ga0207705_103604132 68
228 3300025909 Ga0207705_10442018 Ga0207705_104420182 68
229 3300025911 Ga0207654_10044387 Ga0207654_100443873 68
230 3300025911 Ga0207654_10797344 Ga0207654_107973442 68
231 3300025912 Ga0207707_10074804 Ga0207707_100748043 68
232 3300025912 Ga0207707_10354970 Ga0207707_103549703 68
233 3300025912 Ga0207707_10896087 Ga0207707_108960872 68
234 3300025912 Ga0207707_11390493 Ga0207707_113904932 68
235 3300025913 Ga0207695_10108802 Ga0207695_101088023 68
236 3300025913 Ga0207695_10464532 Ga0207695_104645322 68
237 3300025914 Ga0207671_10168955 Ga0207671_101689553 68
238 3300025917 Ga0207660_10001233 Ga0207660_1000123314 68
239 3300025917 Ga0207660_10192546 Ga0207660_101925463 68
240 3300025919 Ga0207657_10000398 Ga0207657_1000039825 68
241 3300025919 Ga0207657_10028164 Ga0207657_100281645 68
242 3300025919 Ga0207657_10091540 Ga0207657_100915403 68
243 3300025919 Ga0207657_10109438 Ga0207657_101094383 68
244 3300025919 Ga0207657_10143613 Ga0207657_101436133 68
245 3300025919 Ga0207657_10160452 Ga0207657_101604523 68
246 3300025919 Ga0207657_10220190 Ga0207657_102201902 68
247 3300025919 Ga0207657_10434664 Ga0207657_104346642 68
248 3300025920 Ga0207649_10002077 Ga0207649_100020774 68
249 3300025920 Ga0207649_10045003 Ga0207649_100450032 68
250 3300025920 Ga0207649_10083738 Ga0207649_100837382 68
251 3300025920 Ga0207649_10123063 Ga0207649_101230633 68
252 3300025920 Ga0207649_10213526 Ga0207649_102135263 68
253 3300025920 Ga0207649_10243459 Ga0207649_102434593 68
254 3300025920 Ga0207649_10393892 Ga0207649_103938922 68
255 3300025920 Ga0207649_10744350 Ga0207649_107443502 68
256 3300025921 Ga0207652_10246678 Ga0207652_102466782 68
257 3300025921 Ga0207652_10431248 Ga0207652_104312482 68
258 3300025921 Ga0207652_10675144 Ga0207652_106751442 68
259 3300025924 Ga0207694_10001947 Ga0207694_1000194720 68
260 3300025924 Ga0207694_10015155 Ga0207694_100151554 68
261 3300025924 Ga0207694_10040976 Ga0207694_100409764 68
262 3300025925 Ga0207650_10005229 Ga0207650_100052295 68
263 3300025925 Ga0207650_11782257 Ga0207650_117822572 68
264 3300025926 Ga0207659_11469337 Ga0207659_114693372 68
265 3300025931 Ga0207644_10061733 Ga0207644_100617333 68
266 3300025931 Ga0207644_10353039 Ga0207644_103530393 68
267 3300025932 Ga0207690_10000118 Ga0207690_1000011844 68
268 3300025932 Ga0207690_10001613 Ga0207690_1000161310 68
269 3300025932 Ga0207690_10094833 Ga0207690_100948333 68
270 3300025932 Ga0207690_10131661 Ga0207690_101316613 68
271 3300025932 Ga0207690_10212284 Ga0207690_102122842 68
272 3300025932 Ga0207690_10446921 Ga0207690_104469212 68
273 3300025932 Ga0207690_10849054 Ga0207690_108490541 68
274 3300025932 Ga0207690_10944479 Ga0207690_109444792 68
275 3300025933 Ga0207706_10001030 Ga0207706_100010303 68
276 3300025933 Ga0207706_10034152 Ga0207706_100341523 68
277 3300025933 Ga0207706_10539291 Ga0207706_105392912 68
278 3300025940 Ga0207691_10177124 Ga0207691_101771243 68
279 3300025941 Ga0207711_10003902 Ga0207711_100039023 68
280 3300025941 Ga0207711_10005230 Ga0207711_1000523011 68
281 3300025944 Ga0207661_10108834 Ga0207661_101088343 68
282 3300025944 Ga0207661_10999121 Ga0207661_109991212 68
283 3300025944 Ga0207661_11439319 Ga0207661_114393192 68
284 3300025944 Ga0207661_11459273 Ga0207661_114592732 68
285 3300025945 Ga0207679_10002671 Ga0207679_1000267110 68
286 3300025945 Ga0207679_10074292 Ga0207679_100742923 68
287 3300025945 Ga0207679_10152437 Ga0207679_101524372 68
288 3300025945 Ga0207679_10466191 Ga0207679_104661912 68
289 3300025945 Ga0207679_10679128 Ga0207679_106791282 68
290 3300025949 Ga0207667_10002436 Ga0207667_1000243610 68
291 3300025949 Ga0207667_10056858 Ga0207667_100568583 68
292 3300025949 Ga0207667_10148173 Ga0207667_101481733 68
293 3300025949 Ga0207667_10698677 Ga0207667_106986772 68
294 3300025949 Ga0207667_10865780 Ga0207667_108657802 68
295 3300025960 Ga0207651_10049260 Ga0207651_100492603 68
296 3300025960 Ga0207651_10428551 Ga0207651_104285512 68
297 3300025981 Ga0207640_10035062 Ga0207640_100350622 68
298 3300025981 Ga0207640_10103916 Ga0207640_101039163 68
299 3300025981 Ga0207640_10345897 Ga0207640_103458972 68
300 3300025981 Ga0207640_10456039 Ga0207640_104560393 68
301 3300025981 Ga0207640_11953371 Ga0207640_119533711 68
302 3300025986 Ga0207658_10071436 Ga0207658_100714363 68
303 3300025986 Ga0207658_10106011 Ga0207658_101060112 68
304 3300026023 Ga0207677_10238917 Ga0207677_102389172 68
305 3300026035 Ga0207703_10031903 Ga0207703_100319031 68
306 3300026041 Ga0207639_10001100 Ga0207639_100011006 68
307 3300026041 Ga0207639_10007359 Ga0207639_100073594 68
308 3300026041 Ga0207639_10067069 Ga0207639_100670692 68
309 3300026041 Ga0207639_10423140 Ga0207639_104231402 68
310 3300026041 Ga0207639_10808224 Ga0207639_108082242 68
311 3300026041 Ga0207639_11626856 Ga0207639_116268562 68
312 3300026041 Ga0207639_11717041 Ga0207639_117170412 68
313 3300026067 Ga0207678_10008428 Ga0207678_100084283 68
314 3300026067 Ga0207678_10014184 Ga0207678_100141843 68
315 3300026067 Ga0207678_10049159 Ga0207678_100491593 68
316 3300026078 Ga0207702_10000074 Ga0207702_1000007485 68
317 3300026078 Ga0207702_10511472 Ga0207702_105114722 68
318 3300026078 Ga0207702_12118681 Ga0207702_121186812 68
319 3300026088 Ga0207641_10194089 Ga0207641_101940893 68
320 3300026088 Ga0207641_10639557 Ga0207641_106395572 68
321 3300026095 Ga0207676_10006747 Ga0207676_100067474 68
322 3300026116 Ga0207674_10076670 Ga0207674_100766704 68
323 3300026116 Ga0207674_10187154 Ga0207674_101871543 68
324 3300026116 Ga0207674_11984853 Ga0207674_119848532 68
325 3300026121 Ga0207683_11066260 Ga0207683_110662602 68
326 3300026142 Ga0207698_10002256 Ga0207698_1000225611 68
327 3300026142 Ga0207698_10010710 Ga0207698_100107103 68
328 3300026142 Ga0207698_10122355 Ga0207698_101223552 68
329 3300026142 Ga0207698_10237640 Ga0207698_102376403 68
330 3300026142 Ga0207698_10271929 Ga0207698_102719293 68
331 3300026142 Ga0207698_10329662 Ga0207698_103296622 68
332 3300028379 Ga0268266_10008309 Ga0268266_100083096 68
333 3300028379 Ga0268266_10222516 Ga0268266_102225163 68
334 3300031548 Ga0307408_101596340 Ga0307408_1015963402 68
335 3300031731 Ga0307405_10019663 Ga0307405_100196633 68
336 3300031824 Ga0307413_10179695 Ga0307413_101796952 68
337 3300031852 Ga0307410_10014675 Ga0307410_100146753 68
338 3300031901 Ga0307406_10062150 Ga0307406_100621503 68
339 3300031903 Ga0307407_10030927 Ga0307407_100309273 68
340 3300031911 Ga0307412_10520883 Ga0307412_105208832 68
341 3300031995 Ga0307409_100046015 Ga0307409_1000460152 68
342 3300032002 Ga0307416_100313104 Ga0307416_1003131042 68
343 3300032002 Ga0307416_103535411 Ga0307416_1035354112 68
344 3300032004 Ga0307414_10174267 Ga0307414_101742673 68
345 3300032005 Ga0307411_10107787 Ga0307411_101077872 68
346 3300032005 Ga0307411_10718659 Ga0307411_107186593 68
347 3300032005 Ga0307411_11277942 Ga0307411_112779422 68
348 3300032126 Ga0307415_100008121 Ga0307415_1000081213 68
349 3300034816 Ga0373930_0090523 Ga0373930_0090523_462_668 68
350 3300034818 Ga0373950_0053022 Ga0373950_0053022_108_314 68
351 3300034820 Ga0373959_0122365 Ga0373959_0122365_220_426 68
352 3300035085 Ga0373929_0040317 Ga0373929_0040317_698_904 68
353 3300035115 Ga0373941_0219608 Ga0373941_0219608_461_667 68
354 3300035121 Ga0373960_0012452 Ga0373960_0012452_1082_1288 68
355 3300035242 Ga0373962_0313104 Ga0373962_0313104_250_456 68
356 3300035691 Ga0373931_0011619 Ga0373931_0011619_582_788 68
357 3300035725 Ga0373947_1131176 Ga0373947_1131176_282_488 68
358 3300037312 Ga0395899_0000157 Ga0395899_0000157_22924_23130 68
359 3300037312 Ga0395899_0005498 Ga0395899_0005498_178_384 68
360 3300037312 Ga0395899_0006779 Ga0395899_0006779_8000_8209 68
361 3300037312 Ga0395899_0031909 Ga0395899_0031909_2123_2332 68
362 3300037312 Ga0395899_0037733 Ga0395899_0037733_3045_3251 68
363 3300037312 Ga0395899_0115069 Ga0395899_0115069_440_646 68
364 3300037312 Ga0395899_0273958 Ga0395899_0273958_291_500 68
365 3300037312 Ga0395899_0294981 Ga0395899_0294981_30_236 68
366 3300037312 Ga0395899_0323435 Ga0395899_0323435_70_276 68
367 3300037418 Ga0395900_0000296 Ga0395900_0000296_68537_68743 68
368 3300037418 Ga0395900_0003608 Ga0395900_0003608_3946_4155 68
369 3300037418 Ga0395900_0034862 Ga0395900_0034862_4947_5156 68
370 3300037418 Ga0395900_0052806 Ga0395900_0052806_3889_4095 68
371 3300037418 Ga0395900_0095259 Ga0395900_0095259_372_578 68
372 3300037418 Ga0395900_0115216 Ga0395900_0115216_355_561 68
373 3300037418 Ga0395900_0129707 Ga0395900_0129707_1066_1275 68
374 3300037418 Ga0395900_0265293 Ga0395900_0265293_364_573 68
375 3300037418 Ga0395900_0334110 Ga0395900_0334110_923_1129 68
376 3300037418 Ga0395900_0383436 Ga0395900_0383436_899_1105 68
377 3300037418 Ga0395900_0603518 Ga0395900_0603518_746_952 68
378 3300037418 Ga0395900_0609136 Ga0395900_0609136_72_278 68
379 3300037418 Ga0395900_0970239 Ga0395900_0970239_162_368 68
380 3300037418 Ga0395900_1082315 Ga0395900_1082315_394_600 68
381 3300037418 Ga0395900_1174320 Ga0395900_1174320_118_324 68
382 3300037418 Ga0395900_1388589 Ga0395900_1388589_377_583 68
383 3300037466 Ga0395898_0000054 Ga0395898_0000054_130756_130962 68
384 3300037466 Ga0395898_0012372 Ga0395898_0012372_6122_6328 68
385 3300037466 Ga0395898_0026173 Ga0395898_0026173_2845_3054 68
386 3300037466 Ga0395898_0150021 Ga0395898_0150021_1276_1485 68
387 3300037466 Ga0395898_0486469 Ga0395898_0486469_272_478 68
388 3300037466 Ga0395898_0917307 Ga0395898_0917307_547_753 68
389 3300037466 Ga0395898_0999167 Ga0395898_0999167_195_401 68
390 3300037466 Ga0395898_1894744 Ga0395898_1894744_21_230 68
391 3300037466 Ga0395898_1908884 Ga0395898_1908884_111_317 68
392 3300037471 Ga0395905_0000046 Ga0395905_0000046_91762_91968 68
393 3300037471 Ga0395905_0001856 Ga0395905_0001856_20772_20978 68
394 3300037471 Ga0395905_0003152 Ga0395905_0003152_12194_12400 68
395 3300037471 Ga0395905_0017019 Ga0395905_0017019_5499_5705 68
396 3300037471 Ga0395905_0028239 Ga0395905_0028239_2201_2407 68
397 3300037471 Ga0395905_0090433 Ga0395905_0090433_1310_1519 68
398 3300037471 Ga0395905_0158978 Ga0395905_0158978_90_296 68
399 3300037471 Ga0395905_0280774 Ga0395905_0280774_1067_1273 68
400 3300037471 Ga0395905_0287324 Ga0395905_0287324_534_743 68
401 3300037471 Ga0395905_0305976 Ga0395905_0305976_406_615 68
402 3300037471 Ga0395905_0308923 Ga0395905_0308923_823_1032 68
403 3300037471 Ga0395905_0364652 Ga0395905_0364652_534_743 68
404 3300037471 Ga0395905_0365575 Ga0395905_0365575_303_509 68
405 3300037471 Ga0395905_0689404 Ga0395905_0689404_472_678 68
406 3300037471 Ga0395905_0700551 Ga0395905_0700551_689_895 68
407 3300037471 Ga0395905_1114509 Ga0395905_1114509_214_420 68
408 3300037471 Ga0395905_1144669 Ga0395905_1144669_103_309 68
409 3300037471 Ga0395905_1159364 Ga0395905_1159364_451_657 68
410 3300037471 Ga0395905_1530869 Ga0395905_1530869_120_326 68
411 3300038443 Ga0395901_0000086 Ga0395901_0000086_68638_68847 68
412 3300038443 Ga0395901_0001078 Ga0395901_0001078_22027_22236 68
413 3300038443 Ga0395901_0001633 Ga0395901_0001633_16665_16871 68
414 3300038443 Ga0395901_0008013 Ga0395901_0008013_7182_7388 68
415 3300038443 Ga0395901_0057600 Ga0395901_0057600_2007_2213 68
416 3300038443 Ga0395901_0126212 Ga0395901_0126212_1002_1208 68
417 3300038443 Ga0395901_0179789 Ga0395901_0179789_371_577 68
418 3300038443 Ga0395901_0302146 Ga0395901_0302146_910_1116 68
419 3300038443 Ga0395901_0389697 Ga0395901_0389697_699_905 68
420 3300038443 Ga0395901_0559999 Ga0395901_0559999_737_946 68
421 3300042005 Ga0439448_0009481 Ga0439448_0009481_278_484 68
422 3300042012 Ga0439455_0002064 Ga0439455_0002064_3037_3243 68
423 3300042157 Ga0439458_0000052 Ga0439458_0000052_16701_16907 68
424 3300044656 Ga0466969_0063363 Ga0466969_0063363_173_379 68
425 3300044658 Ga0466972_0026297 Ga0466972_0026297_768_974 68
426 3300044658 Ga0466972_0519535 Ga0466972_0519535_323_532 68
427 3300044683 Ga0466965_0280803 Ga0466965_0280803_416_622 68
428 3300044693 Ga0466961_0008199 Ga0466961_0008199_2527_2733 68
429 3300044693 Ga0466961_0013906 Ga0466961_0013906_1597_1806 68
430 3300044693 Ga0466961_0065739 Ga0466961_0065739_1160_1366 68
431 3300044693 Ga0466961_0268565 Ga0466961_0268565_652_858 68
432 3300044694 Ga0466963_0001030 Ga0466963_0001030_3948_4154 68
433 3300044694 Ga0466963_0003606 Ga0466963_0003606_6789_6998 68
434 3300044694 Ga0466963_0017691 Ga0466963_0017691_635_841 68
435 3300044694 Ga0466963_0017817 Ga0466963_0017817_2036_2242 68
436 3300044694 Ga0466963_0032264 Ga0466963_0032264_2485_2694 68
437 3300044694 Ga0466963_0053726 Ga0466963_0053726_2096_2302 68
438 3300044694 Ga0466963_0193873 Ga0466963_0193873_894_1100 68
439 3300044694 Ga0466963_0249255 Ga0466963_0249255_59_265 68
440 3300044694 Ga0466963_0721361 Ga0466963_0721361_163_372 68
441 3300044706 Ga0466964_0009399 Ga0466964_0009399_1277_1483 68
442 3300044706 Ga0466964_0014289 Ga0466964_0014289_2128_2334 68
443 3300044706 Ga0466964_0179721 Ga0466964_0179721_32_238 68
444 3300044706 Ga0466964_0392780 Ga0466964_0392780_309_518 68
445 3300044706 Ga0466964_0758635 Ga0466964_0758635_202_408 68
446 3300044719 Ga0466971_0007864 Ga0466971_0007864_1008_1217 68
447 3300044719 Ga0466971_0094038 Ga0466971_0094038_55_261 68
448 3300044719 Ga0466971_0107676 Ga0466971_0107676_80_286 68
449 3300044719 Ga0466971_0137171 Ga0466971_0137171_578_784 68
450 3300044719 Ga0466971_0291259 Ga0466971_0291259_319_528 68
451 3300044735 Ga0466968_0017208 Ga0466968_0017208_1359_1565 68
452 3300044765 Ga0466970_0005244 Ga0466970_0005244_3622_3828 68
453 3300044765 Ga0466970_0016574 Ga0466970_0016574_1847_2053 68
454 3300044765 Ga0466970_0227945 Ga0466970_0227945_487_696 68
455 3300044842 Ga0466957_0001015 Ga0466957_0001015_627_833 68
456 3300044842 Ga0466957_0020116 Ga0466957_0020116_3636_3842 68
457 3300044842 Ga0466957_0021129 Ga0466957_0021129_1388_1594 68
458 3300044842 Ga0466957_0052624 Ga0466957_0052624_1302_1511 68
459 3300044842 Ga0466957_0058754 Ga0466957_0058754_1533_1739 68
460 3300044842 Ga0466957_0076115 Ga0466957_0076115_1601_1810 68
461 3300044842 Ga0466957_0126227 Ga0466957_0126227_716_925 68
462 3300044842 Ga0466957_0252225 Ga0466957_0252225_857_1063 68
463 3300044842 Ga0466957_0869809 Ga0466957_0869809_403_609 68
464 3300045049 Ga0466959_0106155 Ga0466959_0106155_811_1017 68
465 3300045049 Ga0466959_0160206 Ga0466959_0160206_1202_1408 68
466 3300045049 Ga0466959_0278467 Ga0466959_0278467_372_581 68
467 3300045049 Ga0466959_0608793 Ga0466959_0608793_86_292 68
468 3300045049 Ga0466959_0660364 Ga0466959_0660364_217_426 68
469 3300045836 Ga0466958_0005152 Ga0466958_0005152_2210_2419 68
470 3300045836 Ga0466958_0010586 Ga0466958_0010586_2870_3076 68
471 3300045836 Ga0466958_0014789 Ga0466958_0014789_2558_2764 68
472 3300045836 Ga0466958_0027157 Ga0466958_0027157_2305_2511 68
473 3300045836 Ga0466958_0107223 Ga0466958_0107223_1278_1487 68
474 3300045836 Ga0466958_0565688 Ga0466958_0565688_116_325 68
475 3300045836 Ga0466958_1175188 Ga0466958_1175188_258_464 68
476 3300045976 Ga0466967_0010506 Ga0466967_0010506_1456_1662 68
477 3300045976 Ga0466967_0015358 Ga0466967_0015358_1404_1610 68
478 3300045976 Ga0466967_0020008 Ga0466967_0020008_4681_4887 68
479 3300045976 Ga0466967_0022531 Ga0466967_0022531_3642_3848 68
480 3300045976 Ga0466967_0033079 Ga0466967_0033079_1408_1614 68
481 3300045976 Ga0466967_0033452 Ga0466967_0033452_579_785 68
482 3300045976 Ga0466967_0061713 Ga0466967_0061713_721_927 68
483 3300045976 Ga0466967_0070142 Ga0466967_0070142_807_1013 68
484 3300045976 Ga0466967_0097936 Ga0466967_0097936_958_1164 68
485 3300045976 Ga0466967_0110833 Ga0466967_0110833_1438_1647 68
486 3300045976 Ga0466967_0147558 Ga0466967_0147558_266_472 68
487 3300045976 Ga0466967_0168154 Ga0466967_0168154_160_369 68
488 3300045976 Ga0466967_0202772 Ga0466967_0202772_1124_1330 68
489 3300045976 Ga0466967_0354126 Ga0466967_0354126_274_483 68
490 3300045976 Ga0466967_0385949 Ga0466967_0385949_370_579 68
491 3300045976 Ga0466967_0465453 Ga0466967_0465453_846_1052 68
492 3300045976 Ga0466967_0912542 Ga0466967_0912542_271_477 68
493 3300045976 Ga0466967_1359394 Ga0466967_1359394_119_328 68
494 3300045976 Ga0466967_1665863 Ga0466967_1665863_262_468 68
495 3300045976 Ga0466967_1751706 Ga0466967_1751706_25_231 68
496 3300046525 Ga0495663_0318429 Ga0495663_0318429_250_456 68
497 3300046528 Ga0495642_0036913 Ga0495642_0036913_1602_1808 68
498 3300046684 Ga0495669_0018249 Ga0495669_0018249_1693_1899 68
499 3300048903 Ga0496100_0070924 Ga0496100_0070924_889_1095 68
500 3300048904 Ga0496101_0062078 Ga0496101_0062078_1107_1313 68
501 3300048909 Ga0496106_0007523 Ga0496106_0007523_5130_5336 68
502 3300048909 Ga0496106_0222685 Ga0496106_0222685_889_1095 68
503 3300048910 Ga0496107_0007836 Ga0496107_0007836_964_1170 68
504 3300048910 Ga0496107_0295044 Ga0496107_0295044_178_387 68
505 3300048910 Ga0496107_0316725 Ga0496107_0316725_407_613 68
506 3300048911 Ga0496108_0165274 Ga0496108_0165274_924_1130 68
507 3300048912 Ga0496109_0035112 Ga0496109_0035112_1599_1805 68
508 3300048912 Ga0496109_1427940 Ga0496109_1427940_116_322 68
509 3300048913 Ga0496110_0210020 Ga0496110_0210020_1336_1542 68
510 3300048914 Ga0496111_0002221 Ga0496111_0002221_1617_1823 68
511 3300048914 Ga0496111_0310759 Ga0496111_0310759_508_714 68
512 3300048915 Ga0496112_0004584 Ga0496112_0004584_10959_11165 68
513 3300048915 Ga0496112_0079029 Ga0496112_0079029_981_1187 68
514 3300048916 Ga0496113_0092123 Ga0496113_0092123_574_780 68
515 3300048916 Ga0496113_0110695 Ga0496113_0110695_1614_1820 68
516 3300048917 Ga0496114_1272969 Ga0496114_1272969_206_412 68
517 3300049581 Ga0501047_0292648 Ga0501047_0292648_1156_1362 68
518 3300049589 Ga0501073_0198153 Ga0501073_0198153_194_400 68
519 3300049742 Ga0501080_0042513 Ga0501080_0042513_2143_2349 68
520 3300061719 Ga0466962_0002505 Ga0466962_0002505_6085_6291 68
521 3300061719 Ga0466962_0019137 Ga0466962_0019137_1352_1561 68
522 3300061719 Ga0466962_0053039 Ga0466962_0053039_683_889 68
523 3300061719 Ga0466962_0073912 Ga0466962_0073912_881_1087 68
524 3300061719 Ga0466962_0199641 Ga0466962_0199641_679_885 68
525 3300061719 Ga0466962_0289934 Ga0466962_0289934_82_288 68

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09413

DUF2007

Putative prokaryotic signal transducing protein

4

68

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4w4m-assembly10.cif.gz_J crystal structure of prgk 19-92 0.9194 4 67
1yj7-assembly1.cif.gz_A crystal structure of enteropathogenic e.coli (epec) type iii secretion system protein escj 0.8934 4 67
8axn-assembly1.cif.gz_a inner membrane ring and secretin n0 n1 domains of the type 3 secretion system of shigella flexneri 0.8914 4 67
2y9j-assembly1.cif.gz_Y three-dimensional model of salmonella's needle complex at subnanometer resolution 0.8878 5 67
5vli-assembly1.cif.gz_C computationally designed inhibitor peptide hb1.6928.2.3 in complex with influenza hemagglutinin (a/puertorico/8/1934) 0.8857 8 52
ID Description Score Start End Superfamily
af_P0AD21_4_109_2.60.40.1130 Mainly Beta;Sandwich;Immunoglobulin-like;Rab geranylgeranyltransferase alpha-subunit, insert domain 0.882 11 66 2.60.40.1130
1yj7B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Hypothetical protein rpa1041 0.8405 2 67 3.30.70.1530
2lepA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8205 9 65 3.30.70.2350
af_Q58907_1063_1222_3.10.28.10 Alpha Beta;Roll;Endonuclease I-creI;Homing endonucleases 0.8191 9 59 3.10.28.10
af_P09391_1_67_3.30.70.2350 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8113 5 66 3.30.70.2350
ID Description Score Start End GO Terms
AF-A0A3D3YNG6-F1-model_v4 DUF2007 domain-containing protein 0.973 4 67
AF-A0A520Y7Y3-F1-model_v4 DUF2007 domain-containing protein 0.9512 4 68
AF-A0A3D1F0L4-F1-model_v4 DUF2007 domain-containing protein 0.9486 3 67
AF-A0A7V1BU07-F1-model_v4 DUF2007 domain-containing protein 0.9481 2 66
AF-A0A651GTL1-F1-model_v4 DUF2007 domain-containing protein 0.9461 3 67

Feature Viewer

pLDDT pTM Quality
78.46 0.59 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map