F459197

General Info

Members Datasets Scaffolds Average Seq Length
524 229 1048 291

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_0077524|Ga0501036_0077524_689_1639
Length 316
Sequence MAEAYFRAGLPDTALAAAGRVGSGAVEPILVEVTRGPVVEARHVVHAVAVREGRVEEAFGDPQLVSFLRSSAKPIQALPVVRARPDLDDEEIALMCASHLGAPEQLAVVRRLLAAAPAEENELECGVDFTRIAHNCSGKHAGLLALCRAKEWLSAGYRLAGHPCQDAMLAEVAAAAELEPAEIPTAIDGCGVLTFGVTLERAAQAFARLPELEGGARVVAAMQANPDLLRGPVALDVQLIRSVPGWVAKGGAEGLLCAASPDGVGLCLKVADGAFRALAPATAYLLARLGVDAEGLGGLEVTNSHGEQVGELRVVE

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
142 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
143 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
144 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
145 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
157 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
158 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
159 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
162 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
227 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.38
Nodule 0
Rhizoplane 11.07
Rhizosphere 87.6
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_0077524 3300049572 Bacteria 2812
2 JGI25406J46586_10002997 3300003203 Bacteria 7972
3 JGI25407J50210_10006455 3300003373 Bacteria 2920
4 Ga0070658_10089502 3300005327 Bacteria 2534
5 Ga0070683_100007198 3300005329 Bacteria 9384
6 Ga0070683_100051104 3300005329 Bacteria 3827
7 Ga0070683_100174540 3300005329 Bacteria 2040
8 Ga0070683_100424714 3300005329 Bacteria 1268
9 Ga0070670_100157005 3300005331 Bacteria 1971
10 Ga0068869_100064746 3300005334 Bacteria 2690
11 Ga0070680_100009292 3300005336 Bacteria 7547
12 Ga0070680_100176726 3300005336 Bacteria 1797
13 Ga0070682_100014442 3300005337 Bacteria 4564
14 Ga0070682_100214848 3300005337 Unclassified 1365
15 Ga0070682_100334310 3300005337 Bacteria 1124
16 Ga0070660_100000698 3300005339 Bacteria 22262
17 Ga0070660_100171323 3300005339 Bacteria 1753
18 Ga0070660_100354463 3300005339 Bacteria 1209
19 Ga0070689_100021622 3300005340 Bacteria 4792
20 Ga0070689_100330288 3300005340 Bacteria 1275
21 Ga0070661_100003149 3300005344 Bacteria 11349
22 Ga0070692_10002673 3300005345 Bacteria 6982
23 Ga0070692_10079609 3300005345 Bacteria 1762
24 Ga0070668_100191686 3300005347 Bacteria 1674
25 Ga0070675_100263569 3300005354 Bacteria 1511
26 Ga0070671_100157039 3300005355 Bacteria 1922
27 Ga0070673_100071258 3300005364 Bacteria 2792
28 Ga0070659_100021169 3300005366 Bacteria 4948
29 Ga0070659_100021531 3300005366 Bacteria 4911
30 Ga0070659_100046880 3300005366 Bacteria 3388
31 Ga0070659_100139839 3300005366 Bacteria 1971
32 Ga0070659_100141928 3300005366 Bacteria 1956
33 Ga0070703_10012372 3300005406 Bacteria 2417
34 Ga0070709_10221067 3300005434 Bacteria 1351
35 Ga0070713_100062766 3300005436 Bacteria 3113
36 Ga0070701_10003099 3300005438 Bacteria 6516
37 Ga0070701_10149860 3300005438 Bacteria 1342
38 Ga0070708_100173208 3300005445 Bacteria 2016
39 Ga0070678_100184359 3300005456 Unclassified 1711
40 Ga0070662_100108124 3300005457 Bacteria 2115
41 Ga0070662_100172271 3300005457 Unclassified 1700
42 Ga0070681_10284437 3300005458 Bacteria 1564
43 Ga0070706_100008962 3300005467 Bacteria 9318
44 Ga0070706_100037624 3300005467 Bacteria 4468
45 Ga0070707_100472886 3300005468 Bacteria 1215
46 Ga0070707_100643136 3300005468 Bacteria 1023
47 Ga0070698_100002677 3300005471 Bacteria 19640
48 Ga0070698_100082974 3300005471 Bacteria 3196
49 Ga0070698_100091912 3300005471 Bacteria 3016
50 Ga0070698_100100707 3300005471 Bacteria 2862
51 Ga0070699_100053277 3300005518 Bacteria 3502
52 Ga0070699_100253071 3300005518 Bacteria 1574
53 Ga0070679_100022701 3300005530 Bacteria 6135
54 Ga0070679_100053458 3300005530 Bacteria 4020
55 Ga0070684_100017664 3300005535 Bacteria 5862
56 Ga0070684_100086223 3300005535 Bacteria 2786
57 Ga0070684_100144172 3300005535 Bacteria 2155
58 Ga0070684_100197616 3300005535 Bacteria 1831
59 Ga0070697_100133266 3300005536 Bacteria 2085
60 Ga0068853_100091761 3300005539 Bacteria 2671
61 Ga0068853_100115757 3300005539 Bacteria 2387
62 Ga0070672_100260837 3300005543 Bacteria 1461
63 Ga0070672_100471123 3300005543 Bacteria 1084
64 Ga0070686_100003170 3300005544 Bacteria 9002
65 Ga0070686_100151037 3300005544 Bacteria 1627
66 Ga0070695_100011173 3300005545 Bacteria 5369
67 Ga0070695_100108129 3300005545 Bacteria 1883
68 Ga0070696_100073824 3300005546 Bacteria 2404
69 Ga0070696_100400293 3300005546 Bacteria 1074
70 Ga0070693_100037864 3300005547 Bacteria 2692
71 Ga0070693_100055545 3300005547 Bacteria 2281
72 Ga0070693_100096312 3300005547 Unclassified 1794
73 Ga0070704_100006358 3300005549 Bacteria 6962
74 Ga0070704_100010058 3300005549 Bacteria 5748
75 Ga0070704_100020410 3300005549 Bacteria 4271
76 Ga0068855_100188830 3300005563 Bacteria 2325
77 Ga0070664_100024316 3300005564 Bacteria 5009
78 Ga0070664_100075469 3300005564 Bacteria 2895
79 Ga0070664_100233117 3300005564 Bacteria 1650
80 Ga0068857_100052455 3300005577 Bacteria 3619
81 Ga0068854_100008129 3300005578 Bacteria 6731
82 Ga0068854_100046439 3300005578 Bacteria 3092
83 Ga0068856_100028007 3300005614 Bacteria 5497
84 Ga0068856_100055913 3300005614 Bacteria 3894
85 Ga0070702_100224945 3300005615 Unclassified 1257
86 Ga0068852_100051543 3300005616 Bacteria 3532
87 Ga0068852_100087473 3300005616 Bacteria 2780
88 Ga0068852_100539646 3300005616 Bacteria 1165
89 Ga0068859_100009185 3300005617 Bacteria 9982
90 Ga0068864_100082297 3300005618 Bacteria 2824
91 Ga0068866_10011519 3300005718 Bacteria 3828
92 Ga0068866_10260417 3300005718 Bacteria 1065
93 Ga0068861_100107293 3300005719 Bacteria 2232
94 Ga0068861_100153494 3300005719 Bacteria 1892
95 Ga0068851_10034622 3300005834 Bacteria 2521
96 Ga0068870_10025897 3300005840 Bacteria 2917
97 Ga0068870_10079691 3300005840 Bacteria 1807
98 Ga0068870_10149653 3300005840 Bacteria 1374
99 Ga0068863_100034573 3300005841 Bacteria 4813
100 Ga0068858_100052254 3300005842 Bacteria 3780
101 Ga0068860_100126993 3300005843 Bacteria 2444
102 Ga0068862_100054323 3300005844 Bacteria 3429
103 Ga0068862_100344462 3300005844 Bacteria 1381
104 Ga0081455_10055929 3300005937 Bacteria 3353
105 Ga0081538_10003497 3300005981 Bacteria 14811
106 Ga0081538_10013125 3300005981 Bacteria 6580
107 Ga0081539_10003886 3300005985 Bacteria 17436
108 Ga0075365_10092488 3300006038 Bacteria 2062
109 Ga0075365_10118528 3300006038 Bacteria 1824
110 Ga0075432_10012084 3300006058 Bacteria 2934
111 Ga0070716_100038440 3300006173 Bacteria 2650
112 Ga0068871_100108646 3300006358 Bacteria 2332
113 Ga0068871_100470095 3300006358 Unclassified 1130
114 Ga0075428_100002030 3300006844 Bacteria 21820
115 Ga0075428_100005321 3300006844 Bacteria 14306
116 Ga0075428_100024869 3300006844 Bacteria 6625
117 Ga0075428_100469909 3300006844 Bacteria 1346
118 Ga0075428_100529933 3300006844 Bacteria 1259
119 Ga0075430_100001912 3300006846 Bacteria 17086
120 Ga0075430_100129955 3300006846 Bacteria 2099
121 Ga0075431_100006727 3300006847 Bacteria 11418
122 Ga0075431_100012522 3300006847 Bacteria 8561
123 Ga0075433_10007426 3300006852 Bacteria 8704
124 Ga0075433_10013039 3300006852 Bacteria 6741
125 Ga0075433_10027370 3300006852 Bacteria 4835
126 Ga0075433_10140746 3300006852 Bacteria 2144
127 Ga0075434_100016975 3300006871 Bacteria 7003
128 Ga0075434_100148041 3300006871 Bacteria 2368
129 Ga0075429_100032088 3300006880 Bacteria 4565
130 Ga0068865_100130678 3300006881 Bacteria 1881
131 Ga0075436_100005816 3300006914 Bacteria 8466
132 Ga0075436_100011246 3300006914 Bacteria 6138
133 Ga0075436_100072008 3300006914 Bacteria 2391
134 Ga0097620_100009185 3300006931 Bacteria 9982
135 Ga0075435_100033680 3300007076 Bacteria 4053
136 Ga0075435_100052460 3300007076 Bacteria 3287
137 Ga0111539_10000950 3300009094 Bacteria 37974
138 Ga0111539_10090628 3300009094 Bacteria 3593
139 Ga0111539_10156179 3300009094 Bacteria 2670
140 Ga0111539_10461225 3300009094 Bacteria 1480
141 Ga0105245_10038161 3300009098 Bacteria 4273
142 Ga0105245_10501607 3300009098 Bacteria 1230
143 Ga0105247_10058241 3300009101 Bacteria 2390
144 Ga0114129_10027963 3300009147 Bacteria 7985
145 Ga0114129_10101734 3300009147 Bacteria 3975
146 Ga0114129_10122853 3300009147 Bacteria 3572
147 Ga0114129_10156414 3300009147 Bacteria 3117
148 Ga0114129_10219678 3300009147 Bacteria 2564
149 Ga0114129_10374456 3300009147 Bacteria 1881
150 Ga0114129_10431845 3300009147 Bacteria 1730
151 Ga0114129_11158449 3300009147 Unclassified 965
152 Ga0105243_10184334 3300009148 Bacteria 1818
153 Ga0105241_10059243 3300009174 Bacteria 2943
154 Ga0105241_10326054 3300009174 Bacteria 1326
155 Ga0105242_10016390 3300009176 Bacteria 5759
156 Ga0105242_10032460 3300009176 Bacteria 4175
157 Ga0105242_10080959 3300009176 Bacteria 2715
158 Ga0105238_10149565 3300009551 Bacteria 2310
159 Ga0105238_10446310 3300009551 Bacteria 1290
160 Ga0105249_10041126 3300009553 Bacteria 4201
161 Ga0105249_10109110 3300009553 Bacteria 2613
162 Ga0105239_10311447 3300010375 Bacteria 1774
163 Ga0105239_10415159 3300010375 Unclassified 1524
164 Ga0105239_10664836 3300010375 Bacteria 1190
165 Ga0105239_10696821 3300010375 Bacteria 1161
166 Ga0105246_10459901 3300011119 Bacteria 1072
167 Ga0105246_10493430 3300011119 Bacteria 1038
168 Ga0157371_10244379 3300013102 Bacteria 1292
169 Ga0157369_10039629 3300013105 Bacteria 5148
170 Ga0157374_10146184 3300013296 Bacteria 2296
171 Ga0157374_10246105 3300013296 Bacteria 1759
172 Ga0163162_10188825 3300013306 Bacteria 2188
173 Ga0163162_10299599 3300013306 Bacteria 1740
174 Ga0157375_10018668 3300013308 Bacteria 6294
175 Ga0157375_10239825 3300013308 Bacteria 1973
176 Ga0157375_10519085 3300013308 Bacteria 1354
177 Ga0157375_10833772 3300013308 Bacteria 1069
178 Ga0157380_10007221 3300014326 Bacteria 7876
179 Ga0157377_10000714 3300014745 Bacteria 13734
180 Ga0157377_10045296 3300014745 Bacteria 2457
181 Ga0157377_10082133 3300014745 Bacteria 1886
182 Ga0157377_10302911 3300014745 Bacteria 1055
183 Ga0157379_10010275 3300014968 Bacteria 8150
184 Ga0163161_10127530 3300017792 Bacteria 1917
185 Ga0206353_10934926 3300020082 Bacteria 1353
186 Ga0206353_11326146 3300020082 Bacteria 1713
187 Ga0207656_10027111 3300025321 Bacteria 2341
188 Ga0207656_10027206 3300025321 Bacteria 2337
189 Ga0207653_10018931 3300025885 Bacteria 2169
190 Ga0207688_10005838 3300025901 Bacteria 6699
191 Ga0207688_10031878 3300025901 Bacteria 2911
192 Ga0207688_10068345 3300025901 Bacteria 2012
193 Ga0207699_10290748 3300025906 Bacteria 1138
194 Ga0207643_10012452 3300025908 Bacteria 4597
195 Ga0207643_10056513 3300025908 Bacteria 2232
196 Ga0207705_10069273 3300025909 Bacteria 2555
197 Ga0207684_10180827 3300025910 Bacteria 1818
198 Ga0207693_10013969 3300025915 Bacteria 6466
199 Ga0207693_10014334 3300025915 Bacteria 6377
200 Ga0207693_10017688 3300025915 Bacteria 5683
201 Ga0207693_10180854 3300025915 Bacteria 1659
202 Ga0207660_10145411 3300025917 Bacteria 1816
203 Ga0207662_10140189 3300025918 Unclassified 1531
204 Ga0207657_10019025 3300025919 Bacteria 6535
205 Ga0207657_10129542 3300025919 Bacteria 2069
206 Ga0207657_10336864 3300025919 Bacteria 1191
207 Ga0207681_10091895 3300025923 Bacteria 2169
208 Ga0207687_10097158 3300025927 Bacteria 2160
209 Ga0207700_10144498 3300025928 Bacteria 1959
210 Ga0207644_10290282 3300025931 Unclassified 1315
211 Ga0207690_10060154 3300025932 Bacteria 2577
212 Ga0207690_10124477 3300025932 Bacteria 1878
213 Ga0207706_10020137 3300025933 Bacteria 5995
214 Ga0207706_10141693 3300025933 Bacteria 2115
215 Ga0207709_10003794 3300025935 Bacteria 8875
216 Ga0207709_10189158 3300025935 Bacteria 1461
217 Ga0207670_10020742 3300025936 Bacteria 4042
218 Ga0207669_10323435 3300025937 Bacteria 1181
219 Ga0207665_10069864 3300025939 Bacteria 2395
220 Ga0207691_10007137 3300025940 Bacteria 10785
221 Ga0207691_10013763 3300025940 Bacteria 7730
222 Ga0207661_10000864 3300025944 Bacteria 19886
223 Ga0207661_10025519 3300025944 Bacteria 4493
224 Ga0207679_10033732 3300025945 Bacteria 3605
225 Ga0207679_10052362 3300025945 Bacteria 2993
226 Ga0207651_10104751 3300025960 Bacteria 2108
227 Ga0207712_10146597 3300025961 Bacteria 1818
228 Ga0207668_10190627 3300025972 Bacteria 1624
229 Ga0207640_10011277 3300025981 Bacteria 5057
230 Ga0207677_10121048 3300026023 Bacteria 1969
231 Ga0207677_10286506 3300026023 Bacteria 1355
232 Ga0207703_10083695 3300026035 Bacteria 2666
233 Ga0207639_10019825 3300026041 Bacteria 4803
234 Ga0207678_10161922 3300026067 Bacteria 1911
235 Ga0207708_10028336 3300026075 Bacteria 4242
236 Ga0207702_10046888 3300026078 Bacteria 3640
237 Ga0207641_10142349 3300026088 Bacteria 2165
238 Ga0207648_10107197 3300026089 Bacteria 2452
239 Ga0207648_10127793 3300026089 Bacteria 2236
240 Ga0207676_10061651 3300026095 Bacteria 2970
241 Ga0207674_10056471 3300026116 Bacteria 3987
242 Ga0207674_10116847 3300026116 Bacteria 2638
243 Ga0207675_100162998 3300026118 Bacteria 2128
244 Ga0207683_10055899 3300026121 Bacteria 3461
245 Ga0207683_10062026 3300026121 Bacteria 3292
246 Ga0207683_10156968 3300026121 Bacteria 2055
247 Ga0207698_10350871 3300026142 Bacteria 1393
248 Ga0207698_10509674 3300026142 Bacteria 1172
249 Ga0207428_10000511 3300027907 Bacteria 46384
250 Ga0207428_10002836 3300027907 Bacteria 17198
251 Ga0207428_10010475 3300027907 Bacteria 8276
252 Ga0207428_10037872 3300027907 Bacteria 3923
253 Ga0207428_10243709 3300027907 Unclassified 1342
254 Ga0268266_10050648 3300028379 Bacteria 3563
255 Ga0268266_10234892 3300028379 Bacteria 1690
256 Ga0268265_10069119 3300028380 Bacteria 2742
257 Ga0268264_10572451 3300028381 Bacteria 1110
258 Ga0373948_0001748 3300034817 Bacteria 3087
259 Ga0373959_0004113 3300034820 Bacteria 2333
260 Ga0373938_0000440 3300034957 Bacteria 6747
261 Ga0373928_0002910 3300035084 Bacteria 3302
262 Ga0373929_0004587 3300035085 Bacteria 2475
263 Ga0373952_0002426 3300035092 Bacteria 3363
264 Ga0373939_0003231 3300035114 Bacteria 3818
265 Ga0373941_0027825 3300035115 Bacteria 1654
266 Ga0373962_0001026 3300035242 Bacteria 6464
267 Ga0373962_0028962 3300035242 Unclassified 1506
268 Ga0373962_0034916 3300035242 Bacteria 1395
269 Ga0373931_0065496 3300035691 Bacteria 1969
270 Ga0395899_0033474 3300037312 Bacteria 3859
271 Ga0395899_0034249 3300037312 Bacteria 3813
272 Ga0395899_0047897 3300037312 Unclassified 3181
273 Ga0395899_0121539 3300037312 Bacteria 1870
274 Ga0395899_0164187 3300037312 Bacteria 1567
275 Ga0395900_0008283 3300037418 Bacteria 10702
276 Ga0395900_0036938 3300037418 Bacteria 5035
277 Ga0395900_0052751 3300037418 Bacteria 4186
278 Ga0395900_0068475 3300037418 Bacteria 3647
279 Ga0395900_0197515 3300037418 Bacteria 2037
280 Ga0395900_0280974 3300037418 Bacteria 1656
281 Ga0395900_0573336 3300037418 Bacteria 1071
282 Ga0395898_0007926 3300037466 Bacteria 11267
283 Ga0395898_0010273 3300037466 Bacteria 9799
284 Ga0395898_0018437 3300037466 Bacteria 7116
285 Ga0395898_0041472 3300037466 Bacteria 4546
286 Ga0395898_0042994 3300037466 Bacteria 4453
287 Ga0395898_0089260 3300037466 Bacteria 2966
288 Ga0395898_0146217 3300037466 Bacteria 2262
289 Ga0395898_0173372 3300037466 Bacteria 2062
290 Ga0395898_0178477 3300037466 Bacteria 2029
291 Ga0395898_0432247 3300037466 Bacteria 1254
292 Ga0395905_0004929 3300037471 Bacteria 13743
293 Ga0395905_0010566 3300037471 Bacteria 8966
294 Ga0395905_0010819 3300037471 Bacteria 8838
295 Ga0395905_0065257 3300037471 Unclassified 3408
296 Ga0395905_0197641 3300037471 Bacteria 1885
297 Ga0395905_0612952 3300037471 Bacteria 990
298 Ga0395901_0000370 3300038443 Bacteria 54012
299 Ga0395901_0000944 3300038443 Bacteria 31637
300 Ga0395901_0010224 3300038443 Bacteria 9505
301 Ga0395901_0038377 3300038443 Bacteria 4954
302 Ga0395901_0041988 3300038443 Bacteria 4740
303 Ga0395901_0080337 3300038443 Bacteria 3404
304 Ga0395901_0201137 3300038443 Bacteria 2088
305 Ga0395901_0210539 3300038443 Bacteria 2035
306 Ga0451847_0826902 3300041503 Bacteria 2134
307 Ga0451849_0025055 3300041505 Bacteria 3311
308 Ga0451851_0432785 3300041507 Bacteria 1764
309 Ga0451843_1668580 3300041509 Bacteria 2309
310 Ga0451853_1194868 3300041512 Unclassified 1400
311 Ga0450909_016386 3300042185 Bacteria 1095
312 Ga0439460_0067135 3300042461 Bacteria 1104
313 Ga0495603_0063209 3300046455 Bacteria 2184
314 Ga0495629_0047499 3300046459 Bacteria 3011
315 Ga0495582_0183281 3300046473 Bacteria 1193
316 Ga0495586_0082672 3300046535 Bacteria 1766
317 Ga0495634_0004864 3300046642 Bacteria 10411
318 Ga0495659_0016926 3300046664 Bacteria 2410
319 Ga0495581_0005008 3300047315 Bacteria 7675
320 Ga0496100_0046867 3300048903 Bacteria 2782
321 Ga0496100_0272495 3300048903 Bacteria 1259
322 Ga0496101_0029878 3300048904 Bacteria 3814
323 Ga0496101_0109754 3300048904 Unclassified 2075
324 Ga0496101_0112114 3300048904 Bacteria 2054
325 Ga0496101_0401267 3300048904 Bacteria 1080
326 Ga0496102_0165884 3300048905 Bacteria 2078
327 Ga0496102_0280170 3300048905 Bacteria 1572
328 Ga0496102_0375237 3300048905 Unclassified 1338
329 Ga0496103_0021081 3300048906 Bacteria 3920
330 Ga0496103_0047511 3300048906 Bacteria 2652
331 Ga0496104_0011870 3300048907 Bacteria 7821
332 Ga0496104_0173866 3300048907 Bacteria 2064
333 Ga0496105_0022095 3300048908 Bacteria 5152
334 Ga0496105_0125896 3300048908 Bacteria 2112
335 Ga0496105_0241542 3300048908 Unclassified 1465
336 Ga0496106_0108463 3300048909 Bacteria 2159
337 Ga0496106_0112930 3300048909 Bacteria 2117
338 Ga0496107_0083295 3300048910 Bacteria 2332
339 Ga0496107_0093027 3300048910 Bacteria 2205
340 Ga0496107_0093875 3300048910 Unclassified 2194
341 Ga0496107_0228715 3300048910 Bacteria 1384
342 Ga0496108_0000458 3300048911 Bacteria 32618
343 Ga0496108_0031176 3300048911 Bacteria 4421
344 Ga0496108_0191019 3300048911 Bacteria 1775
345 Ga0496109_0001285 3300048912 Bacteria 20840
346 Ga0496109_0001477 3300048912 Bacteria 19508
347 Ga0496109_0001523 3300048912 Bacteria 19293
348 Ga0496109_0036914 3300048912 Bacteria 4413
349 Ga0496109_0114001 3300048912 Bacteria 2514
350 Ga0496109_0383954 3300048912 Bacteria 1327
351 Ga0496110_0002872 3300048913 Bacteria 13019
352 Ga0496110_0015847 3300048913 Bacteria 6285
353 Ga0496110_0025434 3300048913 Bacteria 5058
354 Ga0496110_0055583 3300048913 Bacteria 3483
355 Ga0496110_0092392 3300048913 Bacteria 2708
356 Ga0496110_0126379 3300048913 Bacteria 2307
357 Ga0496111_0000528 3300048914 Bacteria 19789
358 Ga0496111_0005931 3300048914 Bacteria 7879
359 Ga0496111_0038503 3300048914 Bacteria 3426
360 Ga0496111_0042435 3300048914 Bacteria 3266
361 Ga0496111_0065208 3300048914 Bacteria 2643
362 Ga0496111_0078231 3300048914 Bacteria 2412
363 Ga0496111_0110349 3300048914 Bacteria 2026
364 Ga0496112_0025076 3300048915 Bacteria 5721
365 Ga0496112_0034492 3300048915 Bacteria 4925
366 Ga0496112_0036156 3300048915 Bacteria 4816
367 Ga0496112_0056021 3300048915 Bacteria 3879
368 Ga0496112_0200868 3300048915 Bacteria 1953
369 Ga0496112_0250895 3300048915 Bacteria 1721
370 Ga0496112_0534029 3300048915 Bacteria 1107
371 Ga0496113_0014295 3300048916 Bacteria 5412
372 Ga0496113_0021475 3300048916 Bacteria 4555
373 Ga0496113_0027947 3300048916 Bacteria 4050
374 Ga0496114_0041928 3300048917 Bacteria 3792
375 Ga0496114_0142714 3300048917 Bacteria 2074
376 Ga0496115_0067269 3300048918 Bacteria 2897
377 Ga0496115_0241791 3300048918 Unclassified 1488
378 Ga0501031_0000767 3300049568 Bacteria 19300
379 Ga0501031_0006840 3300049568 Bacteria 7439
380 Ga0501031_0015910 3300049568 Bacteria 4884
381 Ga0501032_0068715 3300049569 Bacteria 2364
382 Ga0501033_0032362 3300049570 Bacteria 3928
383 Ga0501033_0049832 3300049570 Bacteria 3108
384 Ga0501033_0071238 3300049570 Bacteria 2553
385 Ga0501034_0414476 3300049571 Bacteria 1269
386 Ga0501034_0458226 3300049571 Bacteria 1192
387 Ga0501036_0003590 3300049572 Bacteria 12399
388 Ga0501036_0012791 3300049572 Bacteria 6962
389 Ga0501036_0030120 3300049572 Bacteria 4585
390 Ga0501037_0071315 3300049573 Bacteria 2527
391 Ga0501037_0148485 3300049573 Bacteria 1676
392 Ga0501038_0007188 3300049574 Bacteria 10293
393 Ga0501038_0018109 3300049574 Bacteria 6363
394 Ga0501039_0004741 3300049575 Bacteria 10301
395 Ga0501039_0006217 3300049575 Bacteria 9069
396 Ga0501039_0028813 3300049575 Bacteria 4276
397 Ga0501039_0057552 3300049575 Bacteria 3010
398 Ga0501040_0016639 3300049576 Bacteria 4872
399 Ga0501040_0021465 3300049576 Bacteria 4313
400 Ga0501040_0044742 3300049576 Bacteria 3018
401 Ga0501040_0087109 3300049576 Bacteria 2168
402 Ga0501040_0207676 3300049576 Bacteria 1392
403 Ga0501040_0225614 3300049576 Bacteria 1333
404 Ga0501041_0004529 3300049577 Bacteria 8059
405 Ga0501041_0006411 3300049577 Bacteria 6886
406 Ga0501041_0027068 3300049577 Bacteria 3454
407 Ga0501041_0030288 3300049577 Bacteria 3266
408 Ga0501041_0391053 3300049577 Bacteria 880
409 Ga0501042_0008941 3300049578 Bacteria 6646
410 Ga0501042_0020952 3300049578 Bacteria 4552
411 Ga0501042_0049211 3300049578 Bacteria 3006
412 Ga0501042_0063714 3300049578 Bacteria 2634
413 Ga0501043_0016865 3300049579 Bacteria 5725
414 Ga0501046_0003596 3300049580 Bacteria 14200
415 Ga0501046_0018644 3300049580 Bacteria 5768
416 Ga0501046_0030675 3300049580 Bacteria 4362
417 Ga0501046_0198460 3300049580 Bacteria 1493
418 Ga0501048_0001042 3300049582 Bacteria 20773
419 Ga0501048_0004133 3300049582 Bacteria 11066
420 Ga0501048_0028522 3300049582 Bacteria 4052
421 Ga0501048_0152043 3300049582 Bacteria 1637
422 Ga0501067_0030185 3300049583 Bacteria 3006
423 Ga0501067_0114471 3300049583 Bacteria 1500
424 Ga0501068_0007965 3300049584 Bacteria 5875
425 Ga0501068_0026575 3300049584 Bacteria 3412
426 Ga0501068_0035099 3300049584 Bacteria 2992
427 Ga0501068_0092662 3300049584 Bacteria 1865
428 Ga0501069_0001831 3300049585 Bacteria 10605
429 Ga0501069_0054485 3300049585 Bacteria 2227
430 Ga0501069_0085110 3300049585 Bacteria 1784
431 Ga0501070_0027054 3300049586 Bacteria 4811
432 Ga0501070_0047503 3300049586 Bacteria 3567
433 Ga0501070_0066806 3300049586 Bacteria 2978
434 Ga0501070_0096957 3300049586 Bacteria 2439
435 Ga0501071_0006319 3300049587 Bacteria 7686
436 Ga0501071_0007078 3300049587 Bacteria 7330
437 Ga0501071_0009961 3300049587 Bacteria 6350
438 Ga0501071_0023548 3300049587 Bacteria 4301
439 Ga0501071_0041586 3300049587 Bacteria 3291
440 Ga0501071_0159470 3300049587 Bacteria 1685
441 Ga0501071_0167538 3300049587 Bacteria 1644
442 Ga0501072_0004365 3300049588 Bacteria 10731
443 Ga0501072_0009246 3300049588 Bacteria 7490
444 Ga0501072_0019039 3300049588 Bacteria 5301
445 Ga0501072_0028584 3300049588 Bacteria 4353
446 Ga0501072_0044937 3300049588 Bacteria 3472
447 Ga0501073_0019659 3300049589 Bacteria 4873
448 Ga0501073_0142978 3300049589 Unclassified 1658
449 Ga0501074_0001875 3300049590 Bacteria 14422
450 Ga0501074_0011987 3300049590 Bacteria 6300
451 Ga0501074_0032380 3300049590 Bacteria 3787
452 Ga0501075_0002637 3300049591 Bacteria 11981
453 Ga0501075_0004020 3300049591 Bacteria 9918
454 Ga0501075_0015809 3300049591 Bacteria 5425
455 Ga0501075_0039723 3300049591 Bacteria 3521
456 Ga0501075_0074199 3300049591 Bacteria 2573
457 Ga0501076_0002926 3300049592 Bacteria 11839
458 Ga0501076_0010698 3300049592 Bacteria 6820
459 Ga0501076_0019235 3300049592 Bacteria 5216
460 Ga0501076_0065403 3300049592 Bacteria 2899
461 Ga0501076_0119602 3300049592 Bacteria 2133
462 Ga0501076_0128239 3300049592 Bacteria 2056
463 Ga0501077_0006693 3300049593 Bacteria 7085
464 Ga0501077_0006794 3300049593 Bacteria 7039
465 Ga0501077_0010947 3300049593 Bacteria 5654
466 Ga0501079_0002593 3300049741 Bacteria 13140
467 Ga0501079_0024525 3300049741 Bacteria 4628
468 Ga0501079_0099760 3300049741 Bacteria 2251
469 Ga0501079_0447340 3300049741 Bacteria 1014
470 Ga0501080_0002220 3300049742 Bacteria 16878
471 Ga0501080_0008104 3300049742 Bacteria 9520
472 Ga0501080_0021678 3300049742 Bacteria 5949
473 Ga0501080_0076912 3300049742 Bacteria 3103
474 Ga0501080_0396181 3300049742 Bacteria 1243
475 Ga0501081_0001664 3300049743 Bacteria 13747
476 Ga0501081_0008539 3300049743 Bacteria 6655
477 Ga0501081_0023987 3300049743 Bacteria 4092
478 Ga0501081_0026397 3300049743 Bacteria 3916
479 Ga0501081_0121139 3300049743 Bacteria 1864
480 Ga0501083_0017950 3300049744 Bacteria 4934
481 Ga0501083_0019877 3300049744 Bacteria 4674
482 Ga0501083_0027326 3300049744 Bacteria 3938
483 Ga0501035_0002880 3300049822 Bacteria 16597
484 Ga0501035_0175003 3300049822 Bacteria 1852
485 Ga0501044_0039581 3300049823 Bacteria 4917
486 Ga0501044_0187122 3300049823 Bacteria 2035
487 Ga0501045_0096326 3300049824 Bacteria 2189
488 nmdc:mga05p37_24082_c1 3300050507 Bacteria 7395
489 nmdc:mga05p37_255719_c1 3300050507 Bacteria 2099
490 nmdc:mga05p37_298664_c1 3300050507 Bacteria 1914
491 nmdc:mga05p37_335413_c1 3300050507 Bacteria 1785
492 nmdc:mga05p37_55234_c1 3300050507 Bacteria 4886
493 nmdc:mga05p37_72820_c1 3300050507 Bacteria 4228
494 nmdc:mga09592_10398_c1 3300050508 Bacteria 7573
495 nmdc:mga09592_127975_c1 3300050508 Bacteria 2184
496 nmdc:mga0qj67_7406_c1 3300050509 Bacteria 8112
497 nmdc:mga06r32_34659_c1 3300050510 Bacteria 4761
498 nmdc:mga08y16_105747_c1 3300050511 Bacteria 2930
499 nmdc:mga08y16_215776_c1 3300050511 Bacteria 1987
500 nmdc:mga08y16_31345_c1 3300050511 Bacteria 5591
501 nmdc:mga08y16_55231_c1 3300050511 Bacteria 4151
502 nmdc:mga0n895_15076_c1 3300050512 Bacteria 7043
503 nmdc:mga0n895_508895_c1 3300050512 Unclassified 1213
504 nmdc:mga0n895_82155_c1 3300050512 Bacteria 3212
505 nmdc:mga0rr50_108447_c1 3300050513 Bacteria 2194
506 nmdc:mga0rr50_18956_c1 3300050513 Bacteria 4635
507 nmdc:mga08x19_15039_c1 3300050514 Bacteria 4700
508 nmdc:mga08x19_91274_c1 3300050514 Bacteria 2011
509 nmdc:mga0a205_27930_c1 3300050515 Bacteria 5391
510 nmdc:mga0a205_325695_c1 3300050515 Bacteria 1407
511 nmdc:mga0a205_40048_c1 3300050515 Bacteria 4511
512 nmdc:mga0a205_48623_c1 3300050515 Bacteria 4094
513 Ga0495655_0058958 3300053083 Bacteria 1041
514 Ga0501084_0000917 3300054114 Bacteria 22781
515 Ga0501084_0037399 3300054114 Bacteria 4055
516 Ga0501082_0009008 3300060353 Bacteria 8612
517 Ga0501082_0011455 3300060353 Bacteria 7633
518 Ga0501082_0035350 3300060353 Bacteria 4306
519 Ga0501082_0055479 3300060353 Bacteria 3413
520 Ga0530510_0003469 3300061734 Bacteria 10842
521 Ga0530510_0026744 3300061734 Bacteria 4131
522 Ga0530510_0035891 3300061734 Bacteria 3574
523 Ga0530510_0093486 3300061734 Bacteria 2195
524 Ga0530510_0180664 3300061734 Bacteria 1565
525 Ga0501036_0077524
526 JGI25406J46586_10002997
527 JGI25407J50210_10006455
528 Ga0070658_10089502
529 Ga0070683_100007198
530 Ga0070683_100051104
531 Ga0070683_100174540
532 Ga0070683_100424714
533 Ga0070670_100157005
534 Ga0068869_100064746
535 Ga0070680_100009292
536 Ga0070680_100176726
537 Ga0070682_100014442
538 Ga0070682_100214848
539 Ga0070682_100334310
540 Ga0070660_100000698
541 Ga0070660_100171323
542 Ga0070660_100354463
543 Ga0070689_100021622
544 Ga0070689_100330288
545 Ga0070661_100003149
546 Ga0070692_10002673
547 Ga0070692_10079609
548 Ga0070668_100191686
549 Ga0070675_100263569
550 Ga0070671_100157039
551 Ga0070673_100071258
552 Ga0070659_100021169
553 Ga0070659_100021531
554 Ga0070659_100046880
555 Ga0070659_100139839
556 Ga0070659_100141928
557 Ga0070703_10012372
558 Ga0070709_10221067
559 Ga0070713_100062766
560 Ga0070701_10003099
561 Ga0070701_10149860
562 Ga0070708_100173208
563 Ga0070678_100184359
564 Ga0070662_100108124
565 Ga0070662_100172271
566 Ga0070681_10284437
567 Ga0070706_100008962
568 Ga0070706_100037624
569 Ga0070707_100472886
570 Ga0070707_100643136
571 Ga0070698_100002677
572 Ga0070698_100082974
573 Ga0070698_100091912
574 Ga0070698_100100707
575 Ga0070699_100053277
576 Ga0070699_100253071
577 Ga0070679_100022701
578 Ga0070679_100053458
579 Ga0070684_100017664
580 Ga0070684_100086223
581 Ga0070684_100144172
582 Ga0070684_100197616
583 Ga0070697_100133266
584 Ga0068853_100091761
585 Ga0068853_100115757
586 Ga0070672_100260837
587 Ga0070672_100471123
588 Ga0070686_100003170
589 Ga0070686_100151037
590 Ga0070695_100011173
591 Ga0070695_100108129
592 Ga0070696_100073824
593 Ga0070696_100400293
594 Ga0070693_100037864
595 Ga0070693_100055545
596 Ga0070693_100096312
597 Ga0070704_100006358
598 Ga0070704_100010058
599 Ga0070704_100020410
600 Ga0068855_100188830
601 Ga0070664_100024316
602 Ga0070664_100075469
603 Ga0070664_100233117
604 Ga0068857_100052455
605 Ga0068854_100008129
606 Ga0068854_100046439
607 Ga0068856_100028007
608 Ga0068856_100055913
609 Ga0070702_100224945
610 Ga0068852_100051543
611 Ga0068852_100087473
612 Ga0068852_100539646
613 Ga0068859_100009185
614 Ga0068864_100082297
615 Ga0068866_10011519
616 Ga0068866_10260417
617 Ga0068861_100107293
618 Ga0068861_100153494
619 Ga0068851_10034622
620 Ga0068870_10025897
621 Ga0068870_10079691
622 Ga0068870_10149653
623 Ga0068863_100034573
624 Ga0068858_100052254
625 Ga0068860_100126993
626 Ga0068862_100054323
627 Ga0068862_100344462
628 Ga0081455_10055929
629 Ga0081538_10003497
630 Ga0081538_10013125
631 Ga0081539_10003886
632 Ga0075365_10092488
633 Ga0075365_10118528
634 Ga0075432_10012084
635 Ga0070716_100038440
636 Ga0068871_100108646
637 Ga0068871_100470095
638 Ga0075428_100002030
639 Ga0075428_100005321
640 Ga0075428_100024869
641 Ga0075428_100469909
642 Ga0075428_100529933
643 Ga0075430_100001912
644 Ga0075430_100129955
645 Ga0075431_100006727
646 Ga0075431_100012522
647 Ga0075433_10007426
648 Ga0075433_10013039
649 Ga0075433_10027370
650 Ga0075433_10140746
651 Ga0075434_100016975
652 Ga0075434_100148041
653 Ga0075429_100032088
654 Ga0068865_100130678
655 Ga0075436_100005816
656 Ga0075436_100011246
657 Ga0075436_100072008
658 Ga0097620_100009185
659 Ga0075435_100033680
660 Ga0075435_100052460
661 Ga0111539_10000950
662 Ga0111539_10090628
663 Ga0111539_10156179
664 Ga0111539_10461225
665 Ga0105245_10038161
666 Ga0105245_10501607
667 Ga0105247_10058241
668 Ga0114129_10027963
669 Ga0114129_10101734
670 Ga0114129_10122853
671 Ga0114129_10156414
672 Ga0114129_10219678
673 Ga0114129_10374456
674 Ga0114129_10431845
675 Ga0114129_11158449
676 Ga0105243_10184334
677 Ga0105241_10059243
678 Ga0105241_10326054
679 Ga0105242_10016390
680 Ga0105242_10032460
681 Ga0105242_10080959
682 Ga0105238_10149565
683 Ga0105238_10446310
684 Ga0105249_10041126
685 Ga0105249_10109110
686 Ga0105239_10311447
687 Ga0105239_10415159
688 Ga0105239_10664836
689 Ga0105239_10696821
690 Ga0105246_10459901
691 Ga0105246_10493430
692 Ga0157371_10244379
693 Ga0157369_10039629
694 Ga0157374_10146184
695 Ga0157374_10246105
696 Ga0163162_10188825
697 Ga0163162_10299599
698 Ga0157375_10018668
699 Ga0157375_10239825
700 Ga0157375_10519085
701 Ga0157375_10833772
702 Ga0157380_10007221
703 Ga0157377_10000714
704 Ga0157377_10045296
705 Ga0157377_10082133
706 Ga0157377_10302911
707 Ga0157379_10010275
708 Ga0163161_10127530
709 Ga0206353_10934926
710 Ga0206353_11326146
711 Ga0207656_10027111
712 Ga0207656_10027206
713 Ga0207653_10018931
714 Ga0207688_10005838
715 Ga0207688_10031878
716 Ga0207688_10068345
717 Ga0207699_10290748
718 Ga0207643_10012452
719 Ga0207643_10056513
720 Ga0207705_10069273
721 Ga0207684_10180827
722 Ga0207693_10013969
723 Ga0207693_10014334
724 Ga0207693_10017688
725 Ga0207693_10180854
726 Ga0207660_10145411
727 Ga0207662_10140189
728 Ga0207657_10019025
729 Ga0207657_10129542
730 Ga0207657_10336864
731 Ga0207681_10091895
732 Ga0207687_10097158
733 Ga0207700_10144498
734 Ga0207644_10290282
735 Ga0207690_10060154
736 Ga0207690_10124477
737 Ga0207706_10020137
738 Ga0207706_10141693
739 Ga0207709_10003794
740 Ga0207709_10189158
741 Ga0207670_10020742
742 Ga0207669_10323435
743 Ga0207665_10069864
744 Ga0207691_10007137
745 Ga0207691_10013763
746 Ga0207661_10000864
747 Ga0207661_10025519
748 Ga0207679_10033732
749 Ga0207679_10052362
750 Ga0207651_10104751
751 Ga0207712_10146597
752 Ga0207668_10190627
753 Ga0207640_10011277
754 Ga0207677_10121048
755 Ga0207677_10286506
756 Ga0207703_10083695
757 Ga0207639_10019825
758 Ga0207678_10161922
759 Ga0207708_10028336
760 Ga0207702_10046888
761 Ga0207641_10142349
762 Ga0207648_10107197
763 Ga0207648_10127793
764 Ga0207676_10061651
765 Ga0207674_10056471
766 Ga0207674_10116847
767 Ga0207675_100162998
768 Ga0207683_10055899
769 Ga0207683_10062026
770 Ga0207683_10156968
771 Ga0207698_10350871
772 Ga0207698_10509674
773 Ga0207428_10000511
774 Ga0207428_10002836
775 Ga0207428_10010475
776 Ga0207428_10037872
777 Ga0207428_10243709
778 Ga0268266_10050648
779 Ga0268266_10234892
780 Ga0268265_10069119
781 Ga0268264_10572451
782 Ga0373948_0001748
783 Ga0373959_0004113
784 Ga0373938_0000440
785 Ga0373928_0002910
786 Ga0373929_0004587
787 Ga0373952_0002426
788 Ga0373939_0003231
789 Ga0373941_0027825
790 Ga0373962_0001026
791 Ga0373962_0028962
792 Ga0373962_0034916
793 Ga0373931_0065496
794 Ga0395899_0033474
795 Ga0395899_0034249
796 Ga0395899_0047897
797 Ga0395899_0121539
798 Ga0395899_0164187
799 Ga0395900_0008283
800 Ga0395900_0036938
801 Ga0395900_0052751
802 Ga0395900_0068475
803 Ga0395900_0197515
804 Ga0395900_0280974
805 Ga0395900_0573336
806 Ga0395898_0007926
807 Ga0395898_0010273
808 Ga0395898_0018437
809 Ga0395898_0041472
810 Ga0395898_0042994
811 Ga0395898_0089260
812 Ga0395898_0146217
813 Ga0395898_0173372
814 Ga0395898_0178477
815 Ga0395898_0432247
816 Ga0395905_0004929
817 Ga0395905_0010566
818 Ga0395905_0010819
819 Ga0395905_0065257
820 Ga0395905_0197641
821 Ga0395905_0612952
822 Ga0395901_0000370
823 Ga0395901_0000944
824 Ga0395901_0010224
825 Ga0395901_0038377
826 Ga0395901_0041988
827 Ga0395901_0080337
828 Ga0395901_0201137
829 Ga0395901_0210539
830 Ga0451847_0826902
831 Ga0451849_0025055
832 Ga0451851_0432785
833 Ga0451843_1668580
834 Ga0451853_1194868
835 Ga0450909_016386
836 Ga0439460_0067135
837 Ga0495603_0063209
838 Ga0495629_0047499
839 Ga0495582_0183281
840 Ga0495586_0082672
841 Ga0495634_0004864
842 Ga0495659_0016926
843 Ga0495581_0005008
844 Ga0496100_0046867
845 Ga0496100_0272495
846 Ga0496101_0029878
847 Ga0496101_0109754
848 Ga0496101_0112114
849 Ga0496101_0401267
850 Ga0496102_0165884
851 Ga0496102_0280170
852 Ga0496102_0375237
853 Ga0496103_0021081
854 Ga0496103_0047511
855 Ga0496104_0011870
856 Ga0496104_0173866
857 Ga0496105_0022095
858 Ga0496105_0125896
859 Ga0496105_0241542
860 Ga0496106_0108463
861 Ga0496106_0112930
862 Ga0496107_0083295
863 Ga0496107_0093027
864 Ga0496107_0093875
865 Ga0496107_0228715
866 Ga0496108_0000458
867 Ga0496108_0031176
868 Ga0496108_0191019
869 Ga0496109_0001285
870 Ga0496109_0001477
871 Ga0496109_0001523
872 Ga0496109_0036914
873 Ga0496109_0114001
874 Ga0496109_0383954
875 Ga0496110_0002872
876 Ga0496110_0015847
877 Ga0496110_0025434
878 Ga0496110_0055583
879 Ga0496110_0092392
880 Ga0496110_0126379
881 Ga0496111_0000528
882 Ga0496111_0005931
883 Ga0496111_0038503
884 Ga0496111_0042435
885 Ga0496111_0065208
886 Ga0496111_0078231
887 Ga0496111_0110349
888 Ga0496112_0025076
889 Ga0496112_0034492
890 Ga0496112_0036156
891 Ga0496112_0056021
892 Ga0496112_0200868
893 Ga0496112_0250895
894 Ga0496112_0534029
895 Ga0496113_0014295
896 Ga0496113_0021475
897 Ga0496113_0027947
898 Ga0496114_0041928
899 Ga0496114_0142714
900 Ga0496115_0067269
901 Ga0496115_0241791
902 Ga0501031_0000767
903 Ga0501031_0006840
904 Ga0501031_0015910
905 Ga0501032_0068715
906 Ga0501033_0032362
907 Ga0501033_0049832
908 Ga0501033_0071238
909 Ga0501034_0414476
910 Ga0501034_0458226
911 Ga0501036_0003590
912 Ga0501036_0012791
913 Ga0501036_0030120
914 Ga0501037_0071315
915 Ga0501037_0148485
916 Ga0501038_0007188
917 Ga0501038_0018109
918 Ga0501039_0004741
919 Ga0501039_0006217
920 Ga0501039_0028813
921 Ga0501039_0057552
922 Ga0501040_0016639
923 Ga0501040_0021465
924 Ga0501040_0044742
925 Ga0501040_0087109
926 Ga0501040_0207676
927 Ga0501040_0225614
928 Ga0501041_0004529
929 Ga0501041_0006411
930 Ga0501041_0027068
931 Ga0501041_0030288
932 Ga0501041_0391053
933 Ga0501042_0008941
934 Ga0501042_0020952
935 Ga0501042_0049211
936 Ga0501042_0063714
937 Ga0501043_0016865
938 Ga0501046_0003596
939 Ga0501046_0018644
940 Ga0501046_0030675
941 Ga0501046_0198460
942 Ga0501048_0001042
943 Ga0501048_0004133
944 Ga0501048_0028522
945 Ga0501048_0152043
946 Ga0501067_0030185
947 Ga0501067_0114471
948 Ga0501068_0007965
949 Ga0501068_0026575
950 Ga0501068_0035099
951 Ga0501068_0092662
952 Ga0501069_0001831
953 Ga0501069_0054485
954 Ga0501069_0085110
955 Ga0501070_0027054
956 Ga0501070_0047503
957 Ga0501070_0066806
958 Ga0501070_0096957
959 Ga0501071_0006319
960 Ga0501071_0007078
961 Ga0501071_0009961
962 Ga0501071_0023548
963 Ga0501071_0041586
964 Ga0501071_0159470
965 Ga0501071_0167538
966 Ga0501072_0004365
967 Ga0501072_0009246
968 Ga0501072_0019039
969 Ga0501072_0028584
970 Ga0501072_0044937
971 Ga0501073_0019659
972 Ga0501073_0142978
973 Ga0501074_0001875
974 Ga0501074_0011987
975 Ga0501074_0032380
976 Ga0501075_0002637
977 Ga0501075_0004020
978 Ga0501075_0015809
979 Ga0501075_0039723
980 Ga0501075_0074199
981 Ga0501076_0002926
982 Ga0501076_0010698
983 Ga0501076_0019235
984 Ga0501076_0065403
985 Ga0501076_0119602
986 Ga0501076_0128239
987 Ga0501077_0006693
988 Ga0501077_0006794
989 Ga0501077_0010947
990 Ga0501079_0002593
991 Ga0501079_0024525
992 Ga0501079_0099760
993 Ga0501079_0447340
994 Ga0501080_0002220
995 Ga0501080_0008104
996 Ga0501080_0021678
997 Ga0501080_0076912
998 Ga0501080_0396181
999 Ga0501081_0001664
1000 Ga0501081_0008539
1001 Ga0501081_0023987
1002 Ga0501081_0026397
1003 Ga0501081_0121139
1004 Ga0501083_0017950
1005 Ga0501083_0019877
1006 Ga0501083_0027326
1007 Ga0501035_0002880
1008 Ga0501035_0175003
1009 Ga0501044_0039581
1010 Ga0501044_0187122
1011 Ga0501045_0096326
1012 nmdc:mga05p37_24082_c1
1013 nmdc:mga05p37_255719_c1
1014 nmdc:mga05p37_298664_c1
1015 nmdc:mga05p37_335413_c1
1016 nmdc:mga05p37_55234_c1
1017 nmdc:mga05p37_72820_c1
1018 nmdc:mga09592_10398_c1
1019 nmdc:mga09592_127975_c1
1020 nmdc:mga0qj67_7406_c1
1021 nmdc:mga06r32_34659_c1
1022 nmdc:mga08y16_105747_c1
1023 nmdc:mga08y16_215776_c1
1024 nmdc:mga08y16_31345_c1
1025 nmdc:mga08y16_55231_c1
1026 nmdc:mga0n895_15076_c1
1027 nmdc:mga0n895_508895_c1
1028 nmdc:mga0n895_82155_c1
1029 nmdc:mga0rr50_108447_c1
1030 nmdc:mga0rr50_18956_c1
1031 nmdc:mga08x19_15039_c1
1032 nmdc:mga08x19_91274_c1
1033 nmdc:mga0a205_27930_c1
1034 nmdc:mga0a205_325695_c1
1035 nmdc:mga0a205_40048_c1
1036 nmdc:mga0a205_48623_c1
1037 Ga0495655_0058958
1038 Ga0501084_0000917
1039 Ga0501084_0037399
1040 Ga0501082_0009008
1041 Ga0501082_0011455
1042 Ga0501082_0035350
1043 Ga0501082_0055479
1044 Ga0530510_0003469
1045 Ga0530510_0026744
1046 Ga0530510_0035891
1047 Ga0530510_0093486
1048 Ga0530510_0180664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06089

Asparaginase_II

L-asparaginase II

31

314

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7os6-assembly2.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9119 18 306
7os6-assembly1.cif.gz_CCC crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.9074 18 306
7os3-assembly1.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav solved by s-sad (orthorhombic form start) 0.9003 19 305
8col-assembly2.cif.gz_DDD crystal structure of rhizobium etli constitutive l-asparaginase reaiv (orthorombic form r4op-2) 0.8995 17 306
7os6-assembly2.cif.gz_AAA crystal structure of rhizobium etli inducible l-asparaginase reav (monoclinic form mp1) 0.8558 18 306
ID Description Score Start End Superfamily
2i5cC00 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.7135 234 262 2.30.29.30
af_Q811M1_83_201_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6927 236 262 2.30.29.30
af_Q9W0K9_10_129_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6838 236 264 2.30.29.30
af_A0A0G2K1Z2_448_570_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6771 234 266 2.30.29.30
af_O13690_679_808_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.6588 236 264 2.30.29.30
ID Description Score Start End GO Terms
AF-A0A538IKW9-F1-model_v4 Asparaginase 0.9804 17 260
AF-A0A7W0UDV7-F1-model_v4 Asparaginase 0.9671 156 302
AF-A0A538KUX5-F1-model_v4 Asparaginase 0.9662 7 305
AF-A0A7W0ZCK3-F1-model_v4 Asparaginase 0.9662 18 195
AF-A0A382W6A0-F1-model_v4 Asparaginase 0.9605 21 203

Map