F459179

General Info

Members Datasets Scaffolds Average Seq Length
524 299 1048 219

Family's Representative Sequence

Representative Sequence 3300046519|Ga0495632_0058997|Ga0495632_0058997_737_1480
Length 239
Sequence MRIVLVGPPGAGKGTQAAFLAKNLGIPHISTGDLFRANISQGTELGKQAKAYMDAGKLVPDEVTIGMAKDRMEQPDAANGFLLDGFPRNVSQAEALDEMLKAEGMKLDAVLDLEVPEDEVVKRIAGRRICRNDSSHVFHVTYKQPKSEGVCDVCQGELYQRDDDSEEYASRGLPHSDRADHRLLRRSGPGRDDLGARQGGRGHEQGRRQVVVTLPSAAAPSGVPRPLFAAEPPPLSRAW

Samples

Sample ID Description Type Environment
1 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
12 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
13 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
14 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
15 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
16 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
17 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
18 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
19 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
24 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
33 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
34 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
35 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
36 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
37 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
38 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
39 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
40 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
41 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
42 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
43 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
44 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
45 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
46 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
47 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
48 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
49 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
50 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
51 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
52 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
53 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
54 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
55 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
56 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
57 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
58 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
59 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
60 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
61 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
62 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
63 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
64 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
65 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
66 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
67 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
68 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
71 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
72 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
73 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
74 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
75 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
76 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
77 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
80 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
81 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
82 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
83 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
84 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
85 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
89 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
90 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
94 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
95 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
103 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
104 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
107 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
110 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
111 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
117 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
118 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
119 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
120 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
121 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
122 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
123 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
124 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
130 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
131 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
132 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
136 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
137 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
138 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
139 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
145 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
159 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
167 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
168 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
194 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
207 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
208 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
209 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
210 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
211 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
212 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
213 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
216 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
217 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
218 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
219 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
220 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
221 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
222 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
223 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
224 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
225 2643221548 Streptomyces sp. Root55 Isolate Unclassified
226 2643221578 Streptomyces sp. Root63 Isolate Unclassified
227 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
228 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
229 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
230 2643221647 Streptomyces sp. Root369 Isolate Unclassified
231 2643221670 Streptomyces sp. Root431 Isolate Unclassified
232 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
233 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
234 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
235 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
236 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
237 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
238 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
239 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
240 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
241 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
242 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
243 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
244 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
245 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
246 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
247 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
248 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
249 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
250 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
251 2862574272 Streptomyces sp. AcE210 Isolate Nodule
252 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
253 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
254 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
255 2867369537 Streptomyces sp. Z26 Isolate Unclassified
256 2867428634 Streptomyces sp. RP5T Isolate Unclassified
257 2867475112 Streptomyces sp. TM32 Isolate Unclassified
258 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
259 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
260 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
261 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
262 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
263 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
264 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
265 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
266 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
267 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
268 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
269 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
270 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
271 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
272 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
273 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
274 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
275 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
276 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
277 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
278 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
279 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
280 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
281 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
282 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
283 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
284 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
285 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
286 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
287 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
288 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
289 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
290 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
291 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
292 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
293 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
294 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
295 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
296 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
297 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
298 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
299 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.63
Metatranscriptomes 1.72
Isolates 15.65

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.63
Nodule 0.76
Rhizoplane 0.76
Rhizosphere 84.73
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495632_0058997 3300046519 Bacteria 1868
2 JGI24737J22298_10004109 3300001990 Bacteria 5084
3 JGI24735J21928_10029796 3300002067 Bacteria 1623
4 JGI24738J21930_10011433 3300002075 Bacteria 1953
5 JGI25153J46596_10072144 3300003215 Bacteria 889
6 rootH1_10018293 3300003316 Bacteria 2944
7 rootH1_10054406 3300003316 Bacteria 1466
8 rootH1_10113510 3300003323 Bacteria 2265
9 JGI25160J50197_1032276 3300003354 Bacteria 1333
10 JGI25160J50197_1042908 3300003354 Bacteria 1024
11 Ga0006562J51391_1022660 3300003578 Bacteria 970
12 Ga0058860_12179337 3300004801 Bacteria 1261
13 Ga0075365_10229743 3300006038 Bacteria 1302
14 Ga0075363_100165816 3300006048 Bacteria 1252
15 Ga0075370_10349148 3300006353 Bacteria 884
16 Ga0099826_10041536 3300006948 Bacteria 3189
17 Ga0105250_10215220 3300009092 Bacteria 813
18 Ga0105243_10913906 3300009148 Bacteria 874
19 Ga0105241_10773479 3300009174 Bacteria 882
20 Ga0105238_11305384 3300009551 Bacteria 752
21 Ga0105246_10023059 3300011119 Bacteria 4024
22 Ga0157369_10334359 3300013105 Bacteria 1573
23 Ga0157374_10707475 3300013296 Bacteria 1021
24 Ga0157372_10227157 3300013307 Bacteria 2164
25 Ga0206351_10398844 3300020077 Bacteria 1196
26 Ga0256743_129797 3300023436 Bacteria 2611
27 Ga0209758_1000870 3300025297 Bacteria 41550
28 Ga0207426_1003235 3300025302 Bacteria 9137
29 Ga0207647_10006322 3300025904 Bacteria 8617
30 Ga0207654_10459006 3300025911 Bacteria 894
31 Ga0207639_10014035 3300026041 Bacteria 5623
32 Ga0207639_10707696 3300026041 Bacteria 935
33 Ga0207674_10319928 3300026116 Bacteria 1501
34 Ga0209371_1014677 3300027312 Bacteria 2137
35 Ga0307517_10006905 3300028786 Bacteria 16700
36 Ga0307515_10076124 3300028794 Bacteria 4459
37 Ga0307515_10108638 3300028794 Bacteria 3266
38 Ga0268256_1018552 3300030500 Bacteria 1926
39 Ga0307512_10090650 3300030522 Bacteria 2131
40 Ga0307513_10036983 3300031456 Bacteria 5437
41 Ga0307513_10078217 3300031456 Bacteria 3421
42 Ga0307508_10103669 3300031616 Bacteria 2441
43 Ga0307514_10009619 3300031649 Bacteria 8113
44 Ga0307514_10349569 3300031649 Bacteria 789
45 Ga0307516_10034474 3300031730 Bacteria 5085
46 Ga0307516_10107965 3300031730 Bacteria 2591
47 Ga0307413_10426248 3300031824 Bacteria 1046
48 Ga0307410_10057636 3300031852 Bacteria 2646
49 Ga0307412_10781343 3300031911 Bacteria 827
50 Ga0307412_10794974 3300031911 Bacteria 821
51 Ga0307411_10165485 3300032005 Bacteria 1662
52 Ga0307507_10024930 3300033179 Bacteria 6500
53 Ga0307510_10042378 3300033180 Bacteria 4961
54 Ga0307510_10154620 3300033180 Bacteria 1903
55 Ga0395898_0030243 3300037466 Bacteria 5420
56 Ga0439436_0003559 3300041404 Bacteria 4735
57 Ga0439436_0013476 3300041404 Bacteria 2471
58 Ga0439439_0001835 3300041406 Bacteria 4359
59 Ga0439439_0015369 3300041406 Bacteria 1869
60 Ga0451800_0162024 3300041459 Bacteria 984
61 Ga0451804_0220465 3300041463 Bacteria 1396
62 Ga0451833_1403121 3300041491 Bacteria 1706
63 Ga0451853_2070190 3300041512 Bacteria 4361
64 Ga0439433_0002570 3300041999 Bacteria 3854
65 Ga0439442_002602 3300042002 Bacteria 3542
66 Ga0439442_033658 3300042002 Bacteria 1071
67 Ga0439448_0020727 3300042005 Bacteria 2037
68 Ga0439455_0001031 3300042012 Bacteria 4400
69 Ga0439457_002785 3300042014 Bacteria 4890
70 Ga0439457_005171 3300042014 Bacteria 3311
71 Ga0439462_0005811 3300042015 Bacteria 3052
72 Ga0450894_000404 3300042131 Bacteria 7408
73 Ga0450898_000295 3300042134 Bacteria 5603
74 Ga0450899_003480 3300042135 Bacteria 1691
75 Ga0450900_023439 3300042136 Bacteria 871
76 Ga0450902_011809 3300042137 Bacteria 1392
77 Ga0450903_000013 3300042138 Bacteria 34246
78 Ga0450903_011594 3300042138 Bacteria 1417
79 Ga0450906_000538 3300042145 Bacteria 7975
80 Ga0439458_0000117 3300042157 Bacteria 16127
81 Ga0450901_003668 3300042533 Bacteria 1601
82 Ga0466969_0009425 3300044656 Bacteria 5175
83 Ga0466972_0017153 3300044658 Bacteria 3621
84 Ga0466972_0019782 3300044658 Bacteria 3366
85 Ga0466972_0303527 3300044658 Bacteria 746
86 Ga0466965_0011265 3300044683 Bacteria 4187
87 Ga0466966_0004478 3300044684 Bacteria 9214
88 Ga0466966_0017774 3300044684 Bacteria 4695
89 Ga0466961_0007268 3300044693 Bacteria 7046
90 Ga0466961_0008645 3300044693 Bacteria 6490
91 Ga0466961_0063664 3300044693 Bacteria 2343
92 Ga0466963_0010885 3300044694 Bacteria 5522
93 Ga0466963_0167131 3300044694 Bacteria 1532
94 Ga0466963_0529966 3300044694 Bacteria 832
95 Ga0466964_0007868 3300044706 Bacteria 3992
96 Ga0466971_0009738 3300044719 Bacteria 4193
97 Ga0466968_0216315 3300044735 Bacteria 901
98 Ga0466970_0011748 3300044765 Bacteria 4467
99 Ga0466970_0070677 3300044765 Bacteria 1877
100 Ga0466970_0316552 3300044765 Bacteria 882
101 Ga0466957_0015619 3300044842 Bacteria 4435
102 Ga0466957_0099498 3300044842 Bacteria 1831
103 Ga0466960_0005759 3300044901 Bacteria 4931
104 Ga0466959_0004638 3300045049 Bacteria 9244
105 Ga0466959_0019574 3300045049 Bacteria 4978
106 Ga0466959_0030746 3300045049 Bacteria 3975
107 Ga0466958_0000701 3300045836 Bacteria 14601
108 Ga0466967_0057145 3300045976 Bacteria 3443
109 Ga0466967_0070437 3300045976 Bacteria 3128
110 Ga0495617_023374 3300046452 Bacteria 2088
111 Ga0495627_025215 3300046453 Bacteria 1930
112 Ga0495592_0002384 3300046454 Bacteria 13242
113 Ga0495592_0011378 3300046454 Bacteria 6730
114 Ga0495592_0074076 3300046454 Bacteria 2473
115 Ga0495592_0083541 3300046454 Bacteria 2305
116 Ga0495603_0009222 3300046455 Bacteria 5963
117 Ga0495603_0040397 3300046455 Bacteria 2792
118 Ga0495603_0042881 3300046455 Bacteria 2703
119 Ga0495603_0050949 3300046455 Bacteria 2461
120 Ga0495603_0137561 3300046455 Bacteria 1421
121 Ga0495603_0236923 3300046455 Bacteria 1051
122 Ga0495590_0054372 3300046457 Bacteria 1398
123 Ga0495629_0029336 3300046459 Bacteria 3902
124 Ga0495629_0032517 3300046459 Bacteria 3692
125 Ga0495629_0057415 3300046459 Bacteria 2722
126 Ga0495629_0058565 3300046459 Bacteria 2694
127 Ga0495629_0070624 3300046459 Bacteria 2436
128 Ga0495629_0075811 3300046459 Bacteria 2348
129 Ga0495629_0094874 3300046459 Bacteria 2082
130 Ga0495629_0100761 3300046459 Bacteria 2015
131 Ga0495641_0018821 3300046461 Bacteria 3553
132 Ga0495651_0002063 3300046462 Bacteria 15529
133 Ga0495651_0011730 3300046462 Bacteria 6733
134 Ga0495651_0041403 3300046462 Bacteria 3578
135 Ga0495653_0023969 3300046463 Bacteria 4923
136 Ga0495653_0089569 3300046463 Bacteria 2254
137 Ga0495580_0133188 3300046472 Bacteria 1723
138 Ga0495580_0160717 3300046472 Bacteria 1555
139 Ga0495605_0006181 3300046474 Bacteria 6906
140 Ga0495662_0002247 3300046476 Bacteria 9741
141 Ga0495662_0005288 3300046476 Bacteria 6466
142 Ga0495662_0030862 3300046476 Bacteria 2587
143 Ga0495662_0272844 3300046476 Bacteria 832
144 Ga0495664_0002322 3300046477 Bacteria 10191
145 Ga0495664_0004119 3300046477 Bacteria 7937
146 Ga0495664_0061576 3300046477 Bacteria 2234
147 Ga0495585_0036008 3300046492 Bacteria 2795
148 Ga0495585_0057159 3300046492 Bacteria 2153
149 Ga0495585_0065122 3300046492 Bacteria 1997
150 Ga0495585_0314276 3300046492 Bacteria 767
151 Ga0495594_0017991 3300046499 Bacteria 3741
152 Ga0495594_0058980 3300046499 Bacteria 2122
153 Ga0495594_0073158 3300046499 Bacteria 1907
154 Ga0495594_0283218 3300046499 Bacteria 944
155 Ga0495596_0035486 3300046500 Bacteria 1977
156 Ga0495607_0029609 3300046501 Bacteria 3368
157 Ga0495607_0035424 3300046501 Bacteria 3019
158 Ga0495583_0010924 3300046506 Bacteria 5246
159 Ga0495583_0022365 3300046506 Bacteria 3226
160 Ga0495583_0165080 3300046506 Bacteria 912
161 Ga0495606_0036606 3300046507 Bacteria 3340
162 Ga0495608_0014048 3300046511 Bacteria 5557
163 Ga0495610_0140589 3300046512 Bacteria 1039
164 Ga0495616_0014358 3300046513 Bacteria 4435
165 Ga0495618_0038400 3300046514 Bacteria 3009
166 Ga0495618_0040164 3300046514 Bacteria 2943
167 Ga0495618_0046667 3300046514 Bacteria 2734
168 Ga0495620_0007819 3300046515 Bacteria 5775
169 Ga0495620_0036008 3300046515 Bacteria 2218
170 Ga0495628_0007000 3300046516 Bacteria 9781
171 Ga0495628_0031188 3300046516 Bacteria 4312
172 Ga0495628_0077075 3300046516 Bacteria 2593
173 Ga0495630_0015711 3300046517 Bacteria 5530
174 Ga0495630_0106997 3300046517 Bacteria 2118
175 Ga0495630_0400657 3300046517 Bacteria 1051
176 Ga0495631_0008580 3300046518 Bacteria 5145
177 Ga0495637_0030106 3300046520 Bacteria 2409
178 Ga0495648_0029929 3300046524 Bacteria 3607
179 Ga0495648_0038359 3300046524 Bacteria 3065
180 Ga0495666_0000307 3300046526 Bacteria 21312
181 Ga0495666_0040565 3300046526 Bacteria 2256
182 Ga0495666_0174829 3300046526 Bacteria 993
183 Ga0495666_0255584 3300046526 Bacteria 798
184 Ga0495642_0029350 3300046528 Bacteria 2195
185 Ga0495652_0028567 3300046529 Bacteria 4906
186 Ga0495652_0030154 3300046529 Bacteria 4759
187 Ga0495652_0064589 3300046529 Bacteria 3078
188 Ga0495654_0017683 3300046530 Bacteria 3743
189 Ga0495665_0112758 3300046531 Bacteria 1426
190 Ga0495665_0116707 3300046531 Bacteria 1398
191 Ga0495640_0026148 3300046533 Bacteria 4221
192 Ga0495640_0027443 3300046533 Bacteria 4106
193 Ga0495640_0036590 3300046533 Bacteria 3467
194 Ga0495640_0050032 3300046533 Bacteria 2880
195 Ga0495640_0051319 3300046533 Bacteria 2835
196 Ga0495586_0005234 3300046535 Bacteria 6942
197 Ga0495587_0000793 3300046536 Bacteria 21073
198 Ga0495587_0131617 3300046536 Bacteria 1429
199 Ga0495587_0416229 3300046536 Bacteria 746
200 Ga0495609_0035658 3300046538 Bacteria 2250
201 Ga0495609_0131365 3300046538 Bacteria 1072
202 Ga0495597_0014053 3300046542 Bacteria 3819
203 Ga0495597_0017330 3300046542 Bacteria 3392
204 Ga0495645_0002261 3300046543 Bacteria 13098
205 Ga0495645_0007022 3300046543 Bacteria 7830
206 Ga0495645_0249545 3300046543 Bacteria 1180
207 Ga0495622_0016815 3300046557 Bacteria 3407
208 Ga0495622_0017744 3300046557 Bacteria 3313
209 Ga0495622_0019063 3300046557 Bacteria 3195
210 Ga0495633_0013817 3300046558 Bacteria 4238
211 Ga0495667_0034555 3300046559 Bacteria 3380
212 Ga0495667_0094992 3300046559 Bacteria 1930
213 Ga0495667_0405763 3300046559 Bacteria 858
214 Ga0495667_0456510 3300046559 Bacteria 802
215 Ga0495668_0084474 3300046616 Bacteria 1740
216 Ga0495634_0005875 3300046642 Bacteria 9378
217 Ga0495634_0022428 3300046642 Bacteria 4448
218 Ga0495634_0130764 3300046642 Bacteria 1600
219 Ga0495611_0045515 3300046648 Bacteria 1965
220 Ga0495625_0052003 3300046660 Bacteria 2934
221 Ga0495625_0062420 3300046660 Bacteria 2633
222 Ga0495625_0098525 3300046660 Bacteria 2011
223 Ga0495625_0104005 3300046660 Bacteria 1947
224 Ga0495625_0188082 3300046660 Bacteria 1369
225 Ga0495635_0015642 3300046663 Bacteria 5299
226 Ga0495635_0052805 3300046663 Bacteria 2799
227 Ga0495635_0274927 3300046663 Bacteria 1132
228 Ga0495661_0141119 3300046665 Bacteria 1310
229 Ga0495588_0018880 3300046674 Bacteria 3369
230 Ga0495588_0021821 3300046674 Bacteria 3159
231 Ga0495588_0030467 3300046674 Bacteria 2712
232 Ga0495657_0014293 3300046675 Bacteria 5830
233 Ga0495657_0020921 3300046675 Bacteria 4701
234 Ga0495657_0024880 3300046675 Bacteria 4256
235 Ga0495657_0041644 3300046675 Bacteria 3141
236 Ga0495657_0349334 3300046675 Bacteria 875
237 Ga0495657_0394922 3300046675 Bacteria 814
238 Ga0495599_0071364 3300046678 Bacteria 2167
239 Ga0495623_0054576 3300046679 Bacteria 2520
240 Ga0495623_0118729 3300046679 Bacteria 1594
241 Ga0495623_0160928 3300046679 Bacteria 1319
242 Ga0495646_0009635 3300046680 Bacteria 6132
243 Ga0495646_0049303 3300046680 Bacteria 2556
244 Ga0495646_0067020 3300046680 Bacteria 2122
245 Ga0495658_0166236 3300046683 Bacteria 1363
246 Ga0495613_0007867 3300046689 Bacteria 7926
247 Ga0495613_0028454 3300046689 Bacteria 4156
248 Ga0495613_0042330 3300046689 Bacteria 3370
249 Ga0495613_0118323 3300046689 Bacteria 1904
250 Ga0495613_0241942 3300046689 Bacteria 1261
251 Ga0495613_0408732 3300046689 Bacteria 925
252 Ga0495624_0072181 3300046690 Bacteria 2147
253 Ga0495670_0054352 3300046691 Bacteria 2006
254 Ga0495670_0108297 3300046691 Bacteria 1436
255 Ga0495649_0037515 3300046694 Bacteria 2660
256 Ga0495649_0084384 3300046694 Bacteria 1696
257 Ga0495649_0104303 3300046694 Bacteria 1505
258 Ga0495589_0033651 3300046794 Bacteria 2572
259 Ga0495589_0072234 3300046794 Bacteria 1685
260 Ga0495589_0088199 3300046794 Bacteria 1506
261 Ga0495589_0130057 3300046794 Bacteria 1209
262 Ga0495600_0022516 3300046809 Bacteria 4046
263 Ga0495600_0065600 3300046809 Bacteria 2373
264 Ga0495600_0105036 3300046809 Bacteria 1840
265 Ga0495600_0602014 3300046809 Bacteria 668
266 Ga0495660_0014928 3300046810 Bacteria 4493
267 Ga0495660_0036701 3300046810 Bacteria 2732
268 Ga0495581_0015509 3300047315 Bacteria 4423
269 Ga0495581_0045604 3300047315 Bacteria 2534
270 Ga0495581_0053544 3300047315 Bacteria 2330
271 Ga0495581_0078891 3300047315 Bacteria 1905
272 Ga0495581_0253089 3300047315 Bacteria 1030
273 Ga0495604_0000113 3300047317 Bacteria 68389
274 Ga0495604_0013519 3300047317 Bacteria 6506
275 Ga0495604_0015097 3300047317 Bacteria 6162
276 Ga0495604_0047616 3300047317 Bacteria 3338
277 Ga0495604_0358131 3300047317 Bacteria 968
278 Ga0495636_0006176 3300047318 Bacteria 4704
279 Ga0495636_0015355 3300047318 Bacteria 3052
280 Ga0495636_0016772 3300047318 Bacteria 2928
281 Ga0495636_0227047 3300047318 Bacteria 858
282 Ga0495674_0018748 3300047319 Bacteria 6440
283 Ga0495674_0051417 3300047319 Bacteria 3633
284 Ga0495674_0111122 3300047319 Bacteria 2323
285 Ga0495676_0016427 3300047321 Bacteria 6570
286 Ga0495676_0054654 3300047321 Bacteria 3172
287 Ga0495676_0061002 3300047321 Bacteria 2952
288 Ga0495676_0063682 3300047321 Bacteria 2872
289 Ga0495676_0111929 3300047321 Bacteria 2001
290 Ga0495676_0396433 3300047321 Bacteria 916
291 Ga0495680_0058259 3300047322 Bacteria 2985
292 Ga0495683_0018872 3300047323 Bacteria 3560
293 Ga0495687_025874 3300047443 Bacteria 2767
294 Ga0495687_028288 3300047443 Bacteria 2610
295 Ga0495687_095717 3300047443 Bacteria 1125
296 Ga0495675_0014235 3300047444 Bacteria 5029
297 Ga0495675_0017801 3300047444 Bacteria 4504
298 Ga0495675_0043062 3300047444 Bacteria 2876
299 Ga0495675_0082856 3300047444 Bacteria 2019
300 Ga0495675_0095727 3300047444 Bacteria 1861
301 Ga0495685_003592 3300047447 Bacteria 4959
302 Ga0495685_019528 3300047447 Bacteria 2329
303 Ga0495685_044721 3300047447 Bacteria 1509
304 Ga0495681_0011573 3300047470 Bacteria 5243
305 Ga0495681_0017276 3300047470 Bacteria 4013
306 Ga0495684_0004072 3300047471 Bacteria 11412
307 Ga0495684_0268917 3300047471 Bacteria 1234
308 Ga0495686_0014525 3300047472 Bacteria 5416
309 Ga0495686_0134375 3300047472 Bacteria 1464
310 Ga0495593_0005852 3300047673 Bacteria 7246
311 Ga0495593_0050234 3300047673 Bacteria 2210
312 Ga0495593_0111502 3300047673 Bacteria 1396
313 Ga0495602_0014250 3300048088 Bacteria 8077
314 Ga0495602_0257507 3300048088 Bacteria 1296
315 Ga0495602_0281729 3300048088 Bacteria 1224
316 Ga0495614_0003249 3300048089 Bacteria 7257
317 Ga0495626_0039902 3300048091 Bacteria 2219
318 Ga0496109_0326354 3300048912 Bacteria 1449
319 Ga0496111_0431727 3300048914 Bacteria 973
320 Ga0501306_005522 3300049127 Bacteria 1453
321 Ga0501310_011957 3300049130 Bacteria 989
322 Ga0495678_004495 3300049459 Bacteria 8047
323 Ga0495682_0027906 3300049460 Bacteria 2093
324 Ga0501316_008946 3300049532 Bacteria 1115
325 Ga0501323_000121 3300049539 Bacteria 4378
326 Ga0501323_000233 3300049539 Bacteria 3668
327 Ga0501031_0010894 3300049568 Bacteria 5922
328 Ga0501031_0027893 3300049568 Bacteria 3680
329 Ga0501031_0176201 3300049568 Bacteria 1397
330 Ga0501032_0001347 3300049569 Bacteria 19514
331 Ga0501032_0021244 3300049569 Bacteria 4514
332 Ga0501032_0129306 3300049569 Bacteria 1667
333 Ga0501032_0138487 3300049569 Bacteria 1603
334 Ga0501032_0197230 3300049569 Bacteria 1314
335 Ga0501033_0024719 3300049570 Bacteria 4529
336 Ga0501033_0054784 3300049570 Bacteria 2949
337 Ga0501033_0105519 3300049570 Bacteria 2053
338 Ga0501033_0432570 3300049570 Bacteria 915
339 Ga0501033_0471361 3300049570 Bacteria 870
340 Ga0501034_0011858 3300049571 Bacteria 9022
341 Ga0501034_0016801 3300049571 Bacteria 7503
342 Ga0501034_0017192 3300049571 Bacteria 7420
343 Ga0501034_0017758 3300049571 Bacteria 7296
344 Ga0501034_0093372 3300049571 Bacteria 3005
345 Ga0501034_0155652 3300049571 Bacteria 2259
346 Ga0501034_0409849 3300049571 Bacteria 1277
347 Ga0501036_0005851 3300049572 Bacteria 9958
348 Ga0501036_0012989 3300049572 Bacteria 6914
349 Ga0501036_0027241 3300049572 Bacteria 4828
350 Ga0501036_0031130 3300049572 Bacteria 4508
351 Ga0501036_0034382 3300049572 Bacteria 4286
352 Ga0501036_0083112 3300049572 Bacteria 2706
353 Ga0501036_0194501 3300049572 Bacteria 1706
354 Ga0501037_0018253 3300049573 Bacteria 5169
355 Ga0501037_0026857 3300049573 Bacteria 4252
356 Ga0501037_0066677 3300049573 Bacteria 2621
357 Ga0501037_0181872 3300049573 Bacteria 1491
358 Ga0501038_0008698 3300049574 Bacteria 9320
359 Ga0501038_0017122 3300049574 Bacteria 6554
360 Ga0501038_0065656 3300049574 Bacteria 3091
361 Ga0501038_0110087 3300049574 Bacteria 2282
362 Ga0501038_0188528 3300049574 Bacteria 1660
363 Ga0501038_0207257 3300049574 Bacteria 1570
364 Ga0501039_0003016 3300049575 Bacteria 12590
365 Ga0501039_0015102 3300049575 Bacteria 5908
366 Ga0501039_0087842 3300049575 Bacteria 2422
367 Ga0501039_0115987 3300049575 Bacteria 2096
368 Ga0501039_0460581 3300049575 Bacteria 998
369 Ga0501041_0009850 3300049577 Bacteria 5627
370 Ga0501042_0028341 3300049578 Bacteria 3944
371 Ga0501042_0058093 3300049578 Bacteria 2760
372 Ga0501043_0005651 3300049579 Bacteria 10076
373 Ga0501043_0019747 3300049579 Bacteria 5291
374 Ga0501043_0088457 3300049579 Bacteria 2434
375 Ga0501043_0128036 3300049579 Bacteria 1990
376 Ga0501043_0593941 3300049579 Bacteria 818
377 Ga0501046_0002011 3300049580 Bacteria 19297
378 Ga0501046_0424272 3300049580 Bacteria 958
379 Ga0501047_0000005 3300049581 Bacteria 456524
380 Ga0501047_0004445 3300049581 Bacteria 13204
381 Ga0501047_0016143 3300049581 Bacteria 7123
382 Ga0501047_0060637 3300049581 Bacteria 3650
383 Ga0501047_0159022 3300049581 Bacteria 2131
384 Ga0501047_0167629 3300049581 Bacteria 2066
385 Ga0501047_0202335 3300049581 Bacteria 1847
386 Ga0501048_0001026 3300049582 Bacteria 20878
387 Ga0501048_0062412 3300049582 Bacteria 2637
388 Ga0501067_0000592 3300049583 Bacteria 19503
389 Ga0501068_0001668 3300049584 Bacteria 11862
390 Ga0501068_0053733 3300049584 Bacteria 2440
391 Ga0501069_0003831 3300049585 Bacteria 7749
392 Ga0501069_0210476 3300049585 Bacteria 1129
393 Ga0501070_0004123 3300049586 Bacteria 12503
394 Ga0501070_0018196 3300049586 Bacteria 5893
395 Ga0501070_0184424 3300049586 Bacteria 1716
396 Ga0501071_0096619 3300049587 Bacteria 2174
397 Ga0501072_0001152 3300049588 Bacteria 19660
398 Ga0501073_0018375 3300049589 Bacteria 5053
399 Ga0501074_0005219 3300049590 Bacteria 9340
400 Ga0501074_0011734 3300049590 Bacteria 6369
401 Ga0501076_0051723 3300049592 Bacteria 3252
402 Ga0501077_0018618 3300049593 Bacteria 4391
403 Ga0501079_0010132 3300049741 Bacteria 7155
404 Ga0501080_0004649 3300049742 Bacteria 12241
405 Ga0501080_0027465 3300049742 Bacteria 5292
406 Ga0501083_0004200 3300049744 Bacteria 10143
407 Ga0501035_0013724 3300049822 Bacteria 7476
408 Ga0501035_0035773 3300049822 Bacteria 4505
409 Ga0501035_0047360 3300049822 Bacteria 3859
410 Ga0501035_0047481 3300049822 Bacteria 3853
411 Ga0501035_0157274 3300049822 Bacteria 1969
412 Ga0501035_0178200 3300049822 Bacteria 1832
413 Ga0501044_0013601 3300049823 Bacteria 8795
414 Ga0501044_0033609 3300049823 Bacteria 5387
415 Ga0501044_0064165 3300049823 Bacteria 3750
416 Ga0501044_0108803 3300049823 Bacteria 2781
417 Ga0501044_0171677 3300049823 Bacteria 2139
418 Ga0501044_0287205 3300049823 Bacteria 1577
419 Ga0501045_0027627 3300049824 Bacteria 4090
420 Ga0501045_0120940 3300049824 Bacteria 1944
421 Ga0501045_0213718 3300049824 Bacteria 1436
422 Ga0501045_0581963 3300049824 Bacteria 829
423 nmdc:mga0yw44_152057_c1 3300050492 Bacteria 1510
424 nmdc:mga07m45_73232_c1 3300050496 Bacteria 1950
425 Ga0495601_0019194 3300053077 Bacteria 4167
426 Ga0495601_0402941 3300053077 Bacteria 887
427 Ga0495655_0062079 3300053083 Bacteria 1022
428 Ga0495619_0016029 3300053085 Bacteria 4744
429 Ga0500644_0003766 3300053088 Bacteria 3769
430 Ga0500640_002718 3300053095 Bacteria 5936
431 Ga0500560_005692 3300053107 Bacteria 2782
432 Ga0500614_035564 3300053123 Bacteria 1242
433 Ga0500652_158106 3300053131 Bacteria 938
434 Ga0500573_0107050 3300053140 Bacteria 1569
435 Ga0500586_033896 3300053145 Bacteria 1700
436 Ga0500624_001345 3300053157 Bacteria 4158
437 Ga0500634_0082509 3300053161 Bacteria 1652
438 Ga0501084_0001550 3300054114 Bacteria 18271
439 Ga0501082_0017138 3300060353 Bacteria 6240
440 Ga0466962_0001641 3300061719 Bacteria 10484
441 Ga0466962_0004946 3300061719 Bacteria 6409
442 Ga0530510_0072528 3300061734 Bacteria 2499
443 2547411363 2547132111 Bacteria 8013147
444 2554256764 2554235005 Bacteria 6457341
445 2585295929 2582581312 Bacteria 7308206
446 2585306343 2582581313 Bacteria 10042643
447 2585319618 2582581314 Bacteria 11452267
448 2616696765 2616644814 Bacteria 11555299
449 2616901909 2616644941 Bacteria 8510691
450 2643764741 2643221548 Bacteria 8053412
451 2643902953 2643221578 Bacteria 9213798
452 2643941977 2643221587 Bacteria 7586415
453 2644014434 2643221601 Bacteria 7493239
454 2644175871 2643221631 Bacteria 8168043
455 2644261576 2643221647 Bacteria 10741251
456 2644389600 2643221670 Bacteria 6497041
457 2644404537 2643221673 Bacteria 9196637
458 2644429060 2643221677 Bacteria 7584031
459 2644462126 2643221682 Bacteria 6743283
460 2768644080 2767802112 Bacteria 6465194
461 2785341849 2784746763 Bacteria 9783172
462 2785370794 2784746768 Bacteria 10036182
463 2786671978 2786546132 Bacteria 10419719
464 2804845522 2802429296 Bacteria 7227771
465 2808912944 2808606375 Bacteria 9466072
466 2811845081 2808606982 Bacteria 7791042
467 2812356683 2811994879 Bacteria 9313447
468 2819695207 2818991463 Bacteria 7948711
469 2819742277 2818991472 Bacteria 10089953
470 2852643127 2852635781 Bacteria 8251373
471 2862185301 2862178590 Bacteria 8583590
472 2862287027 2862281513 Bacteria 9621493
473 2862292098 2862290372 Bacteria 7471434
474 2862391292 2862382967 Bacteria 10317375
475 2862516761 2862507626 Bacteria 9425308
476 2862578157 2862574272 Bacteria 10567477
477 2862709715 2862705112 Bacteria 6563286
478 2863411536 2863404153 Bacteria 9672205
479 2867349877 2867346516 Bacteria 7608576
480 2867373242 2867369537 Bacteria 6501581
481 2867429967 2867428634 Bacteria 9590268
482 2867481080 2867475112 Bacteria 6909112
483 2873154677 2873151551 Bacteria 8625867
484 2875396059 2875391855 Bacteria 7600475
485 2877679784 2877676314 Bacteria 9512378
486 2912718432 2912715099 Bacteria 9460473
487 2912730758 2912723979 Bacteria 8557534
488 2918505850 2918501144 Bacteria 8668083
489 2935395230 2935390628 Bacteria 7043367
490 2946048572 2946045630 Bacteria 8527308
491 2946069188 2946064051 Bacteria 8957905
492 2947227746 2947224130 Bacteria 9938529
493 2954003145 2954002825 Bacteria 9173742
494 2954384714 2954380949 Bacteria 10050426
495 2954678250 2954673503 Bacteria 9685905
496 2954685907 2954682443 Bacteria 9862841
497 2954695558 2954691527 Bacteria 10720516
498 2954710752 2954701450 Bacteria 10834262
499 2954714981 2954711539 Bacteria 10867210
500 2954724923 2954721474 Bacteria 10456478
501 2954736895 2954731030 Bacteria 10243860
502 2954743849 2954740390 Bacteria 10229294
503 2954755743 2954749733 Bacteria 10366972
504 2954762802 2954759201 Bacteria 9358192
505 2966601426 2966598605 Bacteria 7676064
506 2990044855 2990044586 Bacteria 6603797
507 2990062334 2990059506 Bacteria 9321252
508 2990092184 2990088156 Bacteria 6657676
509 2995468497 2995463766 Bacteria 8577691
510 2997458239 2997451912 Bacteria 8492419
511 3006326200 3006321560 Bacteria 8247479
512 3006398684 3006393351 Bacteria 6615579
513 3006490567 3006486233 Bacteria 8157040
514 3006498850 3006493962 Bacteria 8825450
515 8008490516 8008485437 Bacteria 7198341
516 8008566577 8008558824 Bacteria 10610750
517 8008577784 8008574985 Bacteria 7815457
518 8025417224 8025413630 Bacteria 7014048
519 8025486066 8025478263 Bacteria 8209203
520 8025529818 8025524527 Bacteria 7197316
521 8048413814 8048406513 Bacteria 8936924
522 8054160810 8054160619 Bacteria 7783213
523 8056447884 8056447290 Bacteria 7680491
524 8056673117 8056667051 Bacteria 6953971
525 Ga0495632_0058997
526 JGI24737J22298_10004109
527 JGI24735J21928_10029796
528 JGI24738J21930_10011433
529 JGI25153J46596_10072144
530 rootH1_10018293
531 rootH1_10054406
532 rootH1_10113510
533 JGI25160J50197_1032276
534 JGI25160J50197_1042908
535 Ga0006562J51391_1022660
536 Ga0058860_12179337
537 Ga0075365_10229743
538 Ga0075363_100165816
539 Ga0075370_10349148
540 Ga0099826_10041536
541 Ga0105250_10215220
542 Ga0105243_10913906
543 Ga0105241_10773479
544 Ga0105238_11305384
545 Ga0105246_10023059
546 Ga0157369_10334359
547 Ga0157374_10707475
548 Ga0157372_10227157
549 Ga0206351_10398844
550 Ga0256743_129797
551 Ga0209758_1000870
552 Ga0207426_1003235
553 Ga0207647_10006322
554 Ga0207654_10459006
555 Ga0207639_10014035
556 Ga0207639_10707696
557 Ga0207674_10319928
558 Ga0209371_1014677
559 Ga0307517_10006905
560 Ga0307515_10076124
561 Ga0307515_10108638
562 Ga0268256_1018552
563 Ga0307512_10090650
564 Ga0307513_10036983
565 Ga0307513_10078217
566 Ga0307508_10103669
567 Ga0307514_10009619
568 Ga0307514_10349569
569 Ga0307516_10034474
570 Ga0307516_10107965
571 Ga0307413_10426248
572 Ga0307410_10057636
573 Ga0307412_10781343
574 Ga0307412_10794974
575 Ga0307411_10165485
576 Ga0307507_10024930
577 Ga0307510_10042378
578 Ga0307510_10154620
579 Ga0395898_0030243
580 Ga0439436_0003559
581 Ga0439436_0013476
582 Ga0439439_0001835
583 Ga0439439_0015369
584 Ga0451800_0162024
585 Ga0451804_0220465
586 Ga0451833_1403121
587 Ga0451853_2070190
588 Ga0439433_0002570
589 Ga0439442_002602
590 Ga0439442_033658
591 Ga0439448_0020727
592 Ga0439455_0001031
593 Ga0439457_002785
594 Ga0439457_005171
595 Ga0439462_0005811
596 Ga0450894_000404
597 Ga0450898_000295
598 Ga0450899_003480
599 Ga0450900_023439
600 Ga0450902_011809
601 Ga0450903_000013
602 Ga0450903_011594
603 Ga0450906_000538
604 Ga0439458_0000117
605 Ga0450901_003668
606 Ga0466969_0009425
607 Ga0466972_0017153
608 Ga0466972_0019782
609 Ga0466972_0303527
610 Ga0466965_0011265
611 Ga0466966_0004478
612 Ga0466966_0017774
613 Ga0466961_0007268
614 Ga0466961_0008645
615 Ga0466961_0063664
616 Ga0466963_0010885
617 Ga0466963_0167131
618 Ga0466963_0529966
619 Ga0466964_0007868
620 Ga0466971_0009738
621 Ga0466968_0216315
622 Ga0466970_0011748
623 Ga0466970_0070677
624 Ga0466970_0316552
625 Ga0466957_0015619
626 Ga0466957_0099498
627 Ga0466960_0005759
628 Ga0466959_0004638
629 Ga0466959_0019574
630 Ga0466959_0030746
631 Ga0466958_0000701
632 Ga0466967_0057145
633 Ga0466967_0070437
634 Ga0495617_023374
635 Ga0495627_025215
636 Ga0495592_0002384
637 Ga0495592_0011378
638 Ga0495592_0074076
639 Ga0495592_0083541
640 Ga0495603_0009222
641 Ga0495603_0040397
642 Ga0495603_0042881
643 Ga0495603_0050949
644 Ga0495603_0137561
645 Ga0495603_0236923
646 Ga0495590_0054372
647 Ga0495629_0029336
648 Ga0495629_0032517
649 Ga0495629_0057415
650 Ga0495629_0058565
651 Ga0495629_0070624
652 Ga0495629_0075811
653 Ga0495629_0094874
654 Ga0495629_0100761
655 Ga0495641_0018821
656 Ga0495651_0002063
657 Ga0495651_0011730
658 Ga0495651_0041403
659 Ga0495653_0023969
660 Ga0495653_0089569
661 Ga0495580_0133188
662 Ga0495580_0160717
663 Ga0495605_0006181
664 Ga0495662_0002247
665 Ga0495662_0005288
666 Ga0495662_0030862
667 Ga0495662_0272844
668 Ga0495664_0002322
669 Ga0495664_0004119
670 Ga0495664_0061576
671 Ga0495585_0036008
672 Ga0495585_0057159
673 Ga0495585_0065122
674 Ga0495585_0314276
675 Ga0495594_0017991
676 Ga0495594_0058980
677 Ga0495594_0073158
678 Ga0495594_0283218
679 Ga0495596_0035486
680 Ga0495607_0029609
681 Ga0495607_0035424
682 Ga0495583_0010924
683 Ga0495583_0022365
684 Ga0495583_0165080
685 Ga0495606_0036606
686 Ga0495608_0014048
687 Ga0495610_0140589
688 Ga0495616_0014358
689 Ga0495618_0038400
690 Ga0495618_0040164
691 Ga0495618_0046667
692 Ga0495620_0007819
693 Ga0495620_0036008
694 Ga0495628_0007000
695 Ga0495628_0031188
696 Ga0495628_0077075
697 Ga0495630_0015711
698 Ga0495630_0106997
699 Ga0495630_0400657
700 Ga0495631_0008580
701 Ga0495637_0030106
702 Ga0495648_0029929
703 Ga0495648_0038359
704 Ga0495666_0000307
705 Ga0495666_0040565
706 Ga0495666_0174829
707 Ga0495666_0255584
708 Ga0495642_0029350
709 Ga0495652_0028567
710 Ga0495652_0030154
711 Ga0495652_0064589
712 Ga0495654_0017683
713 Ga0495665_0112758
714 Ga0495665_0116707
715 Ga0495640_0026148
716 Ga0495640_0027443
717 Ga0495640_0036590
718 Ga0495640_0050032
719 Ga0495640_0051319
720 Ga0495586_0005234
721 Ga0495587_0000793
722 Ga0495587_0131617
723 Ga0495587_0416229
724 Ga0495609_0035658
725 Ga0495609_0131365
726 Ga0495597_0014053
727 Ga0495597_0017330
728 Ga0495645_0002261
729 Ga0495645_0007022
730 Ga0495645_0249545
731 Ga0495622_0016815
732 Ga0495622_0017744
733 Ga0495622_0019063
734 Ga0495633_0013817
735 Ga0495667_0034555
736 Ga0495667_0094992
737 Ga0495667_0405763
738 Ga0495667_0456510
739 Ga0495668_0084474
740 Ga0495634_0005875
741 Ga0495634_0022428
742 Ga0495634_0130764
743 Ga0495611_0045515
744 Ga0495625_0052003
745 Ga0495625_0062420
746 Ga0495625_0098525
747 Ga0495625_0104005
748 Ga0495625_0188082
749 Ga0495635_0015642
750 Ga0495635_0052805
751 Ga0495635_0274927
752 Ga0495661_0141119
753 Ga0495588_0018880
754 Ga0495588_0021821
755 Ga0495588_0030467
756 Ga0495657_0014293
757 Ga0495657_0020921
758 Ga0495657_0024880
759 Ga0495657_0041644
760 Ga0495657_0349334
761 Ga0495657_0394922
762 Ga0495599_0071364
763 Ga0495623_0054576
764 Ga0495623_0118729
765 Ga0495623_0160928
766 Ga0495646_0009635
767 Ga0495646_0049303
768 Ga0495646_0067020
769 Ga0495658_0166236
770 Ga0495613_0007867
771 Ga0495613_0028454
772 Ga0495613_0042330
773 Ga0495613_0118323
774 Ga0495613_0241942
775 Ga0495613_0408732
776 Ga0495624_0072181
777 Ga0495670_0054352
778 Ga0495670_0108297
779 Ga0495649_0037515
780 Ga0495649_0084384
781 Ga0495649_0104303
782 Ga0495589_0033651
783 Ga0495589_0072234
784 Ga0495589_0088199
785 Ga0495589_0130057
786 Ga0495600_0022516
787 Ga0495600_0065600
788 Ga0495600_0105036
789 Ga0495600_0602014
790 Ga0495660_0014928
791 Ga0495660_0036701
792 Ga0495581_0015509
793 Ga0495581_0045604
794 Ga0495581_0053544
795 Ga0495581_0078891
796 Ga0495581_0253089
797 Ga0495604_0000113
798 Ga0495604_0013519
799 Ga0495604_0015097
800 Ga0495604_0047616
801 Ga0495604_0358131
802 Ga0495636_0006176
803 Ga0495636_0015355
804 Ga0495636_0016772
805 Ga0495636_0227047
806 Ga0495674_0018748
807 Ga0495674_0051417
808 Ga0495674_0111122
809 Ga0495676_0016427
810 Ga0495676_0054654
811 Ga0495676_0061002
812 Ga0495676_0063682
813 Ga0495676_0111929
814 Ga0495676_0396433
815 Ga0495680_0058259
816 Ga0495683_0018872
817 Ga0495687_025874
818 Ga0495687_028288
819 Ga0495687_095717
820 Ga0495675_0014235
821 Ga0495675_0017801
822 Ga0495675_0043062
823 Ga0495675_0082856
824 Ga0495675_0095727
825 Ga0495685_003592
826 Ga0495685_019528
827 Ga0495685_044721
828 Ga0495681_0011573
829 Ga0495681_0017276
830 Ga0495684_0004072
831 Ga0495684_0268917
832 Ga0495686_0014525
833 Ga0495686_0134375
834 Ga0495593_0005852
835 Ga0495593_0050234
836 Ga0495593_0111502
837 Ga0495602_0014250
838 Ga0495602_0257507
839 Ga0495602_0281729
840 Ga0495614_0003249
841 Ga0495626_0039902
842 Ga0496109_0326354
843 Ga0496111_0431727
844 Ga0501306_005522
845 Ga0501310_011957
846 Ga0495678_004495
847 Ga0495682_0027906
848 Ga0501316_008946
849 Ga0501323_000121
850 Ga0501323_000233
851 Ga0501031_0010894
852 Ga0501031_0027893
853 Ga0501031_0176201
854 Ga0501032_0001347
855 Ga0501032_0021244
856 Ga0501032_0129306
857 Ga0501032_0138487
858 Ga0501032_0197230
859 Ga0501033_0024719
860 Ga0501033_0054784
861 Ga0501033_0105519
862 Ga0501033_0432570
863 Ga0501033_0471361
864 Ga0501034_0011858
865 Ga0501034_0016801
866 Ga0501034_0017192
867 Ga0501034_0017758
868 Ga0501034_0093372
869 Ga0501034_0155652
870 Ga0501034_0409849
871 Ga0501036_0005851
872 Ga0501036_0012989
873 Ga0501036_0027241
874 Ga0501036_0031130
875 Ga0501036_0034382
876 Ga0501036_0083112
877 Ga0501036_0194501
878 Ga0501037_0018253
879 Ga0501037_0026857
880 Ga0501037_0066677
881 Ga0501037_0181872
882 Ga0501038_0008698
883 Ga0501038_0017122
884 Ga0501038_0065656
885 Ga0501038_0110087
886 Ga0501038_0188528
887 Ga0501038_0207257
888 Ga0501039_0003016
889 Ga0501039_0015102
890 Ga0501039_0087842
891 Ga0501039_0115987
892 Ga0501039_0460581
893 Ga0501041_0009850
894 Ga0501042_0028341
895 Ga0501042_0058093
896 Ga0501043_0005651
897 Ga0501043_0019747
898 Ga0501043_0088457
899 Ga0501043_0128036
900 Ga0501043_0593941
901 Ga0501046_0002011
902 Ga0501046_0424272
903 Ga0501047_0000005
904 Ga0501047_0004445
905 Ga0501047_0016143
906 Ga0501047_0060637
907 Ga0501047_0159022
908 Ga0501047_0167629
909 Ga0501047_0202335
910 Ga0501048_0001026
911 Ga0501048_0062412
912 Ga0501067_0000592
913 Ga0501068_0001668
914 Ga0501068_0053733
915 Ga0501069_0003831
916 Ga0501069_0210476
917 Ga0501070_0004123
918 Ga0501070_0018196
919 Ga0501070_0184424
920 Ga0501071_0096619
921 Ga0501072_0001152
922 Ga0501073_0018375
923 Ga0501074_0005219
924 Ga0501074_0011734
925 Ga0501076_0051723
926 Ga0501077_0018618
927 Ga0501079_0010132
928 Ga0501080_0004649
929 Ga0501080_0027465
930 Ga0501083_0004200
931 Ga0501035_0013724
932 Ga0501035_0035773
933 Ga0501035_0047360
934 Ga0501035_0047481
935 Ga0501035_0157274
936 Ga0501035_0178200
937 Ga0501044_0013601
938 Ga0501044_0033609
939 Ga0501044_0064165
940 Ga0501044_0108803
941 Ga0501044_0171677
942 Ga0501044_0287205
943 Ga0501045_0027627
944 Ga0501045_0120940
945 Ga0501045_0213718
946 Ga0501045_0581963
947 nmdc:mga0yw44_152057_c1
948 nmdc:mga07m45_73232_c1
949 Ga0495601_0019194
950 Ga0495601_0402941
951 Ga0495655_0062079
952 Ga0495619_0016029
953 Ga0500644_0003766
954 Ga0500640_002718
955 Ga0500560_005692
956 Ga0500614_035564
957 Ga0500652_158106
958 Ga0500573_0107050
959 Ga0500586_033896
960 Ga0500624_001345
961 Ga0500634_0082509
962 Ga0501084_0001550
963 Ga0501082_0017138
964 Ga0466962_0001641
965 Ga0466962_0004946
966 Ga0530510_0072528
967 2547411363
968 2554256764
969 2585295929
970 2585306343
971 2585319618
972 2616696765
973 2616901909
974 2643764741
975 2643902953
976 2643941977
977 2644014434
978 2644175871
979 2644261576
980 2644389600
981 2644404537
982 2644429060
983 2644462126
984 2768644080
985 2785341849
986 2785370794
987 2786671978
988 2804845522
989 2808912944
990 2811845081
991 2812356683
992 2819695207
993 2819742277
994 2852643127
995 2862185301
996 2862287027
997 2862292098
998 2862391292
999 2862516761
1000 2862578157
1001 2862709715
1002 2863411536
1003 2867349877
1004 2867373242
1005 2867429967
1006 2867481080
1007 2873154677
1008 2875396059
1009 2877679784
1010 2912718432
1011 2912730758
1012 2918505850
1013 2935395230
1014 2946048572
1015 2946069188
1016 2947227746
1017 2954003145
1018 2954384714
1019 2954678250
1020 2954685907
1021 2954695558
1022 2954710752
1023 2954714981
1024 2954724923
1025 2954736895
1026 2954743849
1027 2954755743
1028 2954762802
1029 2966601426
1030 2990044855
1031 2990062334
1032 2990092184
1033 2995468497
1034 2997458239
1035 3006326200
1036 3006398684
1037 3006490567
1038 3006498850
1039 8008490516
1040 8008566577
1041 8008577784
1042 8025417224
1043 8025486066
1044 8025529818
1045 8048413814
1046 8054160810
1047 8056447884
1048 8056673117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05191

ADK_lid

Adenylate kinase, active site lid

127

163

0.94

PF13207

AAA_17

AAA domain

6

137

0.93

PF00406

ADK

Adenylate kinase

5

183

0.89

PF13671

AAA_33

AAA domain

3

145

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3adk-assembly1.cif.gz_A refined structure of porcine cytosolic adenylate kinase at 2.1 angstroms resolution 0.8957 2 214
4np6-assembly2.cif.gz_D crystal structure of adenylate kinase from vibrio cholerae o1 biovar eltor 0.8823 1 213
4pzl-assembly2.cif.gz_D the crystal structure of adenylate kinase from francisella tularensis subsp. tularensis schu s4 0.8808 1 214
4np6-assembly2.cif.gz_D crystal structure of adenylate kinase from vibrio cholerae o1 biovar eltor 0.8707 1 213
6rze-assembly1.cif.gz_A crystal structure of e. coli adenylate kinase r119a mutant 0.8691 1 213
ID Description Score Start End Superfamily
af_Q4D4A2_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8826 1 214 3.40.50.300
af_Q4D4A2_1_210_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8748 1 214 3.40.50.300
af_Q96MA6_268_474_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8701 2 208 3.40.50.300
3umfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8627 3 217 3.40.50.300
af_A4I9I1_1_215_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8608 1 215 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A499UYH4-F1-model_v4 Adenylate kinase (AK) (EC 2.7.4.3) (ATP-AMP transphosphorylase) (ATP:AMP phosphotransferase) (Adenylate monophosphate kinase) 0.9886 1 116 GO:0004017
GO:0005524
GO:0005737
GO:0044209
AF-A0A3D3RZ18-F1-model_v4 deleted 0.9881 1 112
AF-A0A432JHQ1-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9845 1 116 GO:0004017
GO:0005524
GO:0005737
AF-A0A7V6P966-F1-model_v4 Adenylate kinase (EC 2.7.4.3) 0.9783 1 123 GO:0004017
GO:0005524
GO:0005737
AF-A0A659YND5-F1-model_v4 deleted 0.9764 1 124

Map