F459174

General Info

Members Datasets Scaffolds Average Seq Length
524 245 524 359

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0100630|Ga0495629_0100630_105_1379
Length 424
Sequence MSAAAAVMNALYCLIVDDEPRLRQVLTHVMRRDGFRCIEAADGYEALEQLRRYPVSLVLTDLRMPGMDGMELLRHVRAFHSDIAVVMITAVPDVQAAVNCLSTGAMDYLTKPFHLEEVRARVAQAMDRRRLILENRDYQERLKDRVAAQASRLEQMFFAGVQALAEALELKDPYTRGHSVRVSQYSSILARALHLDDDAVRQIELGGHVHDIGKIGVREAVLNKTEKLTDEEYEHIMIHPLVGWRILAPLLGDAPIALNIVRSHHERIDGQGIPDGLSGQAIPLEARIVAVADAIDAMTSGRPYRGNELSLEDALVELRQNAGSQFDERVVAAVEEAVRCGDLYLMPRNTGQFVMVCRRRFRRRGGDAVASALSVATRHFXXXRRTRLQGDPSDWRLRSSHLPLVVSFRAQRHRSARCADCRGA

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
164 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
177 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
178 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
189 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
190 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
198 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
199 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
200 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
201 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
204 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
205 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
206 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
209 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
213 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
214 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
215 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
216 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
217 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
218 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
219 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
241 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
242 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
243 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.91
Rhizosphere 98.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10092301 3300005295 Unclassified 3791
2 Ga0070658_10001483 3300005327 Bacteria 19915
3 Ga0070676_10042873 3300005328 Bacteria 2629
4 Ga0070676_10102670 3300005328 Bacteria 1769
5 Ga0070683_100001197 3300005329 Bacteria 19738
6 Ga0070683_100026676 3300005329 Bacteria 5205
7 Ga0070683_100033866 3300005329 Bacteria 4662
8 Ga0070683_100049685 3300005329 Bacteria 3880
9 Ga0070683_100100284 3300005329 Bacteria 2726
10 Ga0070683_100109671 3300005329 Bacteria 2603
11 Ga0070683_100128253 3300005329 Bacteria 2399
12 Ga0070690_100105005 3300005330 Bacteria 1877
13 Ga0070670_100001690 3300005331 Bacteria 17937
14 Ga0070670_100175930 3300005331 Bacteria 1857
15 Ga0068869_100006554 3300005334 Bacteria 7383
16 Ga0068869_100333923 3300005334 Bacteria 1232
17 Ga0070666_10190707 3300005335 Unclassified 1440
18 Ga0070680_100001664 3300005336 Bacteria 16262
19 Ga0070680_100002636 3300005336 Bacteria 13294
20 Ga0070680_100018440 3300005336 Bacteria 5513
21 Ga0070680_100029579 3300005336 Bacteria 4399
22 Ga0070680_100049831 3300005336 Bacteria 3415
23 Ga0070680_100124753 3300005336 Bacteria 2151
24 Ga0070680_100139430 3300005336 Bacteria 2033
25 Ga0070680_100192134 3300005336 Bacteria 1720
26 Ga0070660_100054163 3300005339 Bacteria 3096
27 Ga0070660_100091095 3300005339 Bacteria 2405
28 Ga0070660_100108771 3300005339 Bacteria 2204
29 Ga0070689_100128978 3300005340 Unclassified 2027
30 Ga0070687_100024037 3300005343 Bacteria 2903
31 Ga0070687_100069337 3300005343 Bacteria 1888
32 Ga0070661_100002651 3300005344 Bacteria 12236
33 Ga0070661_100020906 3300005344 Bacteria 4671
34 Ga0070692_10002754 3300005345 Bacteria 6918
35 Ga0070668_100019433 3300005347 Bacteria 5113
36 Ga0070668_100024411 3300005347 Bacteria 4581
37 Ga0070668_100046693 3300005347 Bacteria 3327
38 Ga0070669_100004597 3300005353 Bacteria 9964
39 Ga0070669_100141216 3300005353 Bacteria 1857
40 Ga0070669_100254161 3300005353 Bacteria 1400
41 Ga0070675_100001303 3300005354 Bacteria 18230
42 Ga0070675_100004851 3300005354 Bacteria 10263
43 Ga0070671_100010754 3300005355 Bacteria 7345
44 Ga0070671_100061277 3300005355 Bacteria 3133
45 Ga0070671_100072157 3300005355 Bacteria 2883
46 Ga0070674_100014636 3300005356 Bacteria 4880
47 Ga0070673_100178888 3300005364 Bacteria 1815
48 Ga0070688_100008049 3300005365 Bacteria 5706
49 Ga0070659_100005266 3300005366 Bacteria 9282
50 Ga0070659_100078772 3300005366 Bacteria 2629
51 Ga0070667_100081347 3300005367 Bacteria 2772
52 Ga0070667_100256759 3300005367 Bacteria 1564
53 Ga0070667_100309469 3300005367 Bacteria 1424
54 Ga0070709_10020880 3300005434 Bacteria 3809
55 Ga0070714_100016126 3300005435 Bacteria 6025
56 Ga0070714_100022232 3300005435 Bacteria 5198
57 Ga0070714_100035830 3300005435 Bacteria 4159
58 Ga0070713_100000274 3300005436 Bacteria 33771
59 Ga0070713_100062954 3300005436 Bacteria 3108
60 Ga0070710_10059049 3300005437 Bacteria 2177
61 Ga0070711_100051785 3300005439 Bacteria 2822
62 Ga0070708_100000045 3300005445 Bacteria 81076
63 Ga0070662_100054079 3300005457 Bacteria 2909
64 Ga0070662_100067162 3300005457 Bacteria 2633
65 Ga0070662_100082564 3300005457 Bacteria 2397
66 Ga0070662_100086544 3300005457 Bacteria 2344
67 Ga0070681_10000537 3300005458 Bacteria 31196
68 Ga0070681_10008034 3300005458 Bacteria 10333
69 Ga0070681_10013030 3300005458 Bacteria 8257
70 Ga0070681_10013515 3300005458 Bacteria 8117
71 Ga0070681_10029456 3300005458 Bacteria 5513
72 Ga0070681_10207396 3300005458 Bacteria 1876
73 Ga0068867_100035337 3300005459 Bacteria 3624
74 Ga0068867_100083776 3300005459 Bacteria 2407
75 Ga0070685_10017695 3300005466 Bacteria 3819
76 Ga0070685_10089744 3300005466 Bacteria 1858
77 Ga0070706_100029357 3300005467 Bacteria 5067
78 Ga0070706_100128581 3300005467 Bacteria 2363
79 Ga0070707_100029417 3300005468 Bacteria 5230
80 Ga0070698_100146751 3300005471 Bacteria 2308
81 Ga0070698_100205329 3300005471 Bacteria 1905
82 Ga0070699_100375959 3300005518 Bacteria 1282
83 Ga0070679_100000940 3300005530 Bacteria 25317
84 Ga0070679_100002624 3300005530 Bacteria 16355
85 Ga0070679_100013713 3300005530 Bacteria 7764
86 Ga0070679_100016000 3300005530 Bacteria 7224
87 Ga0070679_100049944 3300005530 Bacteria 4166
88 Ga0070679_100058934 3300005530 Bacteria 3827
89 Ga0070679_100171118 3300005530 Bacteria 2145
90 Ga0070684_100008121 3300005535 Bacteria 8192
91 Ga0070684_100016538 3300005535 Bacteria 6030
92 Ga0070684_100022918 3300005535 Bacteria 5215
93 Ga0070684_100026145 3300005535 Bacteria 4914
94 Ga0070684_100045645 3300005535 Bacteria 3794
95 Ga0070684_100056307 3300005535 Bacteria 3431
96 Ga0070684_100069933 3300005535 Bacteria 3087
97 Ga0070684_100094815 3300005535 Bacteria 2659
98 Ga0070684_100116562 3300005535 Bacteria 2399
99 Ga0070684_100245940 3300005535 Bacteria 1635
100 Ga0070684_100380168 3300005535 Bacteria 1301
101 Ga0070672_100016872 3300005543 Bacteria 5239
102 Ga0070672_100080441 3300005543 Bacteria 2611
103 Ga0070696_100005390 3300005546 Bacteria 8531
104 Ga0070696_100015929 3300005546 Bacteria 5055
105 Ga0070665_100204588 3300005548 Bacteria 1975
106 Ga0070665_100264590 3300005548 Unclassified 1721
107 Ga0068855_100013870 3300005563 Bacteria 9718
108 Ga0068855_100207602 3300005563 Bacteria 2203
109 Ga0068855_100441238 3300005563 Bacteria 1422
110 Ga0070664_100013127 3300005564 Bacteria 6743
111 Ga0070664_100092758 3300005564 Bacteria 2615
112 Ga0070664_100135355 3300005564 Bacteria 2166
113 Ga0070664_100163564 3300005564 Bacteria 1970
114 Ga0070664_100175397 3300005564 Bacteria 1903
115 Ga0068857_100008501 3300005577 Bacteria 8875
116 Ga0068857_100013444 3300005577 Bacteria 7131
117 Ga0068857_100040907 3300005577 Bacteria 4109
118 Ga0068857_100121082 3300005577 Bacteria 2356
119 Ga0068854_100031306 3300005578 Bacteria 3696
120 Ga0068854_100291151 3300005578 Bacteria 1318
121 Ga0068856_100008186 3300005614 Bacteria 10194
122 Ga0068856_100034774 3300005614 Bacteria 4937
123 Ga0068856_100176153 3300005614 Bacteria 2151
124 Ga0068856_100200303 3300005614 Bacteria 2011
125 Ga0068852_100041149 3300005616 Bacteria 3903
126 Ga0068852_100056074 3300005616 Bacteria 3403
127 Ga0068852_100063876 3300005616 Bacteria 3207
128 Ga0068859_100020877 3300005617 Bacteria 6573
129 Ga0068859_100056249 3300005617 Bacteria 3958
130 Ga0068864_100008979 3300005618 Bacteria 8243
131 Ga0068864_100090837 3300005618 Bacteria 2693
132 Ga0068866_10013526 3300005718 Bacteria 3584
133 Ga0068861_100012315 3300005719 Bacteria 5965
134 Ga0068851_10019465 3300005834 Bacteria 3280
135 Ga0068870_10010164 3300005840 Bacteria 4309
136 Ga0068870_10012345 3300005840 Bacteria 3990
137 Ga0068870_10012484 3300005840 Bacteria 3972
138 Ga0068870_10063097 3300005840 Bacteria 1997
139 Ga0068870_10163537 3300005840 Bacteria 1322
140 Ga0068863_100040124 3300005841 Bacteria 4451
141 Ga0068863_100305094 3300005841 Bacteria 1545
142 Ga0068858_100107302 3300005842 Bacteria 2606
143 Ga0068858_100451767 3300005842 Bacteria 1238
144 Ga0068860_100069019 3300005843 Bacteria 3359
145 Ga0068862_100000513 3300005844 Bacteria 41174
146 Ga0068862_100105087 3300005844 Unclassified 2475
147 Ga0081539_10000174 3300005985 Bacteria 151265
148 Ga0070717_10003227 3300006028 Bacteria 11644
149 Ga0070717_10165301 3300006028 Bacteria 1922
150 Ga0070712_100000729 3300006175 Bacteria 19393
151 Ga0068871_100043477 3300006358 Bacteria 3608
152 Ga0075430_100004889 3300006846 Bacteria 11276
153 Ga0075430_100015467 3300006846 Bacteria 6495
154 Ga0075430_100021793 3300006846 Bacteria 5446
155 Ga0075430_100053013 3300006846 Bacteria 3415
156 Ga0075430_100244046 3300006846 Bacteria 1488
157 Ga0075431_100001756 3300006847 Bacteria 20399
158 Ga0075431_100013780 3300006847 Bacteria 8165
159 Ga0075431_100073766 3300006847 Bacteria 3521
160 Ga0075434_100048454 3300006871 Bacteria 4216
161 Ga0075429_100012636 3300006880 Bacteria 7322
162 Ga0068865_100072567 3300006881 Bacteria 2445
163 Ga0075436_100002168 3300006914 Bacteria 13526
164 Ga0097620_100020878 3300006931 Bacteria 6573
165 Ga0097620_100056249 3300006931 Bacteria 3958
166 Ga0105240_10001786 3300009093 Bacteria 36277
167 Ga0105240_10018268 3300009093 Bacteria 9426
168 Ga0105240_10527918 3300009093 Bacteria 1309
169 Ga0111539_10037513 3300009094 Bacteria 5850
170 Ga0111539_10048767 3300009094 Bacteria 5054
171 Ga0105245_10095260 3300009098 Bacteria 2746
172 Ga0105245_10478892 3300009098 Bacteria 1258
173 Ga0114129_10177230 3300009147 Bacteria 2903
174 Ga0114129_10738944 3300009147 Bacteria 1261
175 Ga0105243_10179084 3300009148 Bacteria 1842
176 Ga0105241_10003130 3300009174 Bacteria 12313
177 Ga0105242_10007016 3300009176 Bacteria 8697
178 Ga0105242_10035562 3300009176 Bacteria 3993
179 Ga0105248_10010770 3300009177 Bacteria 10095
180 Ga0105248_10068953 3300009177 Bacteria 3970
181 Ga0105248_10071471 3300009177 Bacteria 3898
182 Ga0105248_10135631 3300009177 Bacteria 2776
183 Ga0105248_10151299 3300009177 Bacteria 2618
184 Ga0105237_10004438 3300009545 Bacteria 16252
185 Ga0105237_10115057 3300009545 Bacteria 2683
186 Ga0105238_10042389 3300009551 Bacteria 4609
187 Ga0105249_10000251 3300009553 Bacteria 59080
188 Ga0105249_10044399 3300009553 Bacteria 4041
189 Ga0105246_10002700 3300011119 Bacteria 10741
190 Ga0157373_10016174 3300013100 Bacteria 5445
191 Ga0157373_10070660 3300013100 Bacteria 2467
192 Ga0157371_10007718 3300013102 Bacteria 8651
193 Ga0157371_10011433 3300013102 Bacteria 6839
194 Ga0157371_10189813 3300013102 Bacteria 1471
195 Ga0157370_10007065 3300013104 Bacteria 12262
196 Ga0157370_10014177 3300013104 Bacteria 8171
197 Ga0157370_10025875 3300013104 Bacteria 5803
198 Ga0157370_10161439 3300013104 Bacteria 2085
199 Ga0157369_10004783 3300013105 Bacteria 15917
200 Ga0157369_10015607 3300013105 Bacteria 8560
201 Ga0157369_10028114 3300013105 Bacteria 6225
202 Ga0157369_10073946 3300013105 Bacteria 3655
203 Ga0157369_10109713 3300013105 Bacteria 2933
204 Ga0157369_10110302 3300013105 Bacteria 2925
205 Ga0157369_10154196 3300013105 Bacteria 2427
206 Ga0157374_10024820 3300013296 Bacteria 5376
207 Ga0157374_10239765 3300013296 Bacteria 1783
208 Ga0157378_10075869 3300013297 Bacteria 3028
209 Ga0157378_10107328 3300013297 Bacteria 2555
210 Ga0163162_10187794 3300013306 Bacteria 2194
211 Ga0157372_10003638 3300013307 Bacteria 16590
212 Ga0157372_10005371 3300013307 Bacteria 13618
213 Ga0157372_10011940 3300013307 Bacteria 9255
214 Ga0157372_10014215 3300013307 Bacteria 8507
215 Ga0157372_10025243 3300013307 Bacteria 6460
216 Ga0157372_10028700 3300013307 Bacteria 6074
217 Ga0157372_10094480 3300013307 Bacteria 3405
218 Ga0157372_10109733 3300013307 Bacteria 3160
219 Ga0157372_10131041 3300013307 Bacteria 2885
220 Ga0157372_10177663 3300013307 Bacteria 2464
221 Ga0157375_10023763 3300013308 Bacteria 5663
222 Ga0157375_10073656 3300013308 Bacteria 3435
223 Ga0157375_10182494 3300013308 Bacteria 2251
224 Ga0157375_10500040 3300013308 Bacteria 1380
225 Ga0157375_10631634 3300013308 Bacteria 1228
226 Ga0163163_10002771 3300014325 Bacteria 14797
227 Ga0163163_10040544 3300014325 Bacteria 4547
228 Ga0163163_10371975 3300014325 Bacteria 1486
229 Ga0157380_10023530 3300014326 Bacteria 4648
230 Ga0157377_10000361 3300014745 Bacteria 20302
231 Ga0157379_10001669 3300014968 Bacteria 18349
232 Ga0157376_10007918 3300014969 Bacteria 7625
233 Ga0157376_10110333 3300014969 Bacteria 2420
234 Ga0157376_10248369 3300014969 Bacteria 1661
235 Ga0182007_10059774 3300015262 Bacteria 1249
236 Ga0163161_10034811 3300017792 Bacteria 3603
237 Ga0206356_11147558 3300020070 Bacteria 3033
238 Ga0207682_10027922 3300025893 Bacteria 2249
239 Ga0207688_10107937 3300025901 Bacteria 1613
240 Ga0207680_10182171 3300025903 Bacteria 1421
241 Ga0207699_10037618 3300025906 Bacteria 2768
242 Ga0207699_10041085 3300025906 Bacteria 2669
243 Ga0207645_10048955 3300025907 Bacteria 2699
244 Ga0207645_10062675 3300025907 Bacteria 2376
245 Ga0207645_10071034 3300025907 Bacteria 2228
246 Ga0207643_10002389 3300025908 Bacteria 10186
247 Ga0207643_10003121 3300025908 Bacteria 8913
248 Ga0207643_10038298 3300025908 Unclassified 2693
249 Ga0207643_10140316 3300025908 Bacteria 1443
250 Ga0207705_10006635 3300025909 Bacteria 8566
251 Ga0207705_10029168 3300025909 Bacteria 3933
252 Ga0207705_10070941 3300025909 Bacteria 2525
253 Ga0207684_10036904 3300025910 Bacteria 4148
254 Ga0207684_10089310 3300025910 Bacteria 2626
255 Ga0207707_10001274 3300025912 Bacteria 23506
256 Ga0207707_10003913 3300025912 Bacteria 13215
257 Ga0207707_10004622 3300025912 Bacteria 12092
258 Ga0207707_10015537 3300025912 Bacteria 6630
259 Ga0207707_10019956 3300025912 Bacteria 5849
260 Ga0207707_10024036 3300025912 Bacteria 5328
261 Ga0207707_10032322 3300025912 Bacteria 4579
262 Ga0207707_10034709 3300025912 Bacteria 4413
263 Ga0207707_10036663 3300025912 Bacteria 4286
264 Ga0207707_10042475 3300025912 Bacteria 3967
265 Ga0207695_10004134 3300025913 Bacteria 19930
266 Ga0207695_10017490 3300025913 Bacteria 8341
267 Ga0207695_10022295 3300025913 Bacteria 7196
268 Ga0207695_10296659 3300025913 Bacteria 1508
269 Ga0207695_10309910 3300025913 Bacteria 1469
270 Ga0207695_10369543 3300025913 Bacteria 1320
271 Ga0207671_10042557 3300025914 Bacteria 3361
272 Ga0207671_10106249 3300025914 Bacteria 2131
273 Ga0207693_10009781 3300025915 Bacteria 7807
274 Ga0207693_10124994 3300025915 Bacteria 2021
275 Ga0207660_10003457 3300025917 Bacteria 10302
276 Ga0207660_10005979 3300025917 Bacteria 7902
277 Ga0207660_10026731 3300025917 Bacteria 3932
278 Ga0207660_10027935 3300025917 Bacteria 3856
279 Ga0207660_10028418 3300025917 Bacteria 3825
280 Ga0207660_10034422 3300025917 Bacteria 3512
281 Ga0207660_10039964 3300025917 Bacteria 3281
282 Ga0207660_10162998 3300025917 Bacteria 1721
283 Ga0207660_10277457 3300025917 Bacteria 1329
284 Ga0207662_10002218 3300025918 Bacteria 9686
285 Ga0207662_10010164 3300025918 Bacteria 5188
286 Ga0207657_10030969 3300025919 Bacteria 4850
287 Ga0207657_10031470 3300025919 Bacteria 4805
288 Ga0207657_10059737 3300025919 Bacteria 3274
289 Ga0207657_10116369 3300025919 Bacteria 2203
290 Ga0207652_10000636 3300025921 Bacteria 34690
291 Ga0207652_10002058 3300025921 Bacteria 17320
292 Ga0207652_10003798 3300025921 Bacteria 12383
293 Ga0207652_10010341 3300025921 Bacteria 7516
294 Ga0207652_10033953 3300025921 Bacteria 4297
295 Ga0207652_10035111 3300025921 Bacteria 4230
296 Ga0207652_10112280 3300025921 Bacteria 2418
297 Ga0207652_10141794 3300025921 Bacteria 2149
298 Ga0207652_10177064 3300025921 Bacteria 1915
299 Ga0207646_10035542 3300025922 Bacteria 4500
300 Ga0207681_10001166 3300025923 Bacteria 16947
301 Ga0207681_10032103 3300025923 Bacteria 3436
302 Ga0207681_10077594 3300025923 Bacteria 2336
303 Ga0207694_10127219 3300025924 Bacteria 2040
304 Ga0207650_10020901 3300025925 Bacteria 4624
305 Ga0207650_10200054 3300025925 Bacteria 1600
306 Ga0207659_10006490 3300025926 Bacteria 7168
307 Ga0207659_10054273 3300025926 Bacteria 2862
308 Ga0207659_10100729 3300025926 Bacteria 2177
309 Ga0207687_10002512 3300025927 Bacteria 12443
310 Ga0207700_10001579 3300025928 Bacteria 12936
311 Ga0207700_10063341 3300025928 Bacteria 2812
312 Ga0207664_10033723 3300025929 Bacteria 3936
313 Ga0207664_10040806 3300025929 Bacteria 3612
314 Ga0207644_10046697 3300025931 Bacteria 3087
315 Ga0207690_10003410 3300025932 Bacteria 9488
316 Ga0207706_10006192 3300025933 Bacteria 11114
317 Ga0207706_10122547 3300025933 Bacteria 2287
318 Ga0207706_10216576 3300025933 Bacteria 1677
319 Ga0207706_10257060 3300025933 Bacteria 1525
320 Ga0207709_10108714 3300025935 Bacteria 1849
321 Ga0207669_10013126 3300025937 Bacteria 4103
322 Ga0207704_10019217 3300025938 Bacteria 3584
323 Ga0207691_10016638 3300025940 Bacteria 6983
324 Ga0207691_10018984 3300025940 Bacteria 6512
325 Ga0207691_10026902 3300025940 Bacteria 5397
326 Ga0207691_10030149 3300025940 Bacteria 5070
327 Ga0207711_10021340 3300025941 Bacteria 5411
328 Ga0207711_10235955 3300025941 Bacteria 1676
329 Ga0207689_10003321 3300025942 Bacteria 14722
330 Ga0207689_10044160 3300025942 Bacteria 3684
331 Ga0207661_10002251 3300025944 Bacteria 13303
332 Ga0207661_10011779 3300025944 Bacteria 6350
333 Ga0207661_10028981 3300025944 Bacteria 4247
334 Ga0207661_10034946 3300025944 Bacteria 3913
335 Ga0207661_10037775 3300025944 Bacteria 3779
336 Ga0207661_10053505 3300025944 Bacteria 3230
337 Ga0207661_10100013 3300025944 Bacteria 2433
338 Ga0207661_10166175 3300025944 Bacteria 1918
339 Ga0207661_10203919 3300025944 Bacteria 1740
340 Ga0207661_10231465 3300025944 Bacteria 1636
341 Ga0207661_10307475 3300025944 Bacteria 1422
342 Ga0207679_10009151 3300025945 Bacteria 6333
343 Ga0207679_10044518 3300025945 Bacteria 3203
344 Ga0207679_10129184 3300025945 Bacteria 2024
345 Ga0207712_10001263 3300025961 Bacteria 17420
346 Ga0207712_10004110 3300025961 Bacteria 9189
347 Ga0207668_10019443 3300025972 Bacteria 4294
348 Ga0207668_10027847 3300025972 Bacteria 3686
349 Ga0207668_10055322 3300025972 Bacteria 2758
350 Ga0207658_10050495 3300025986 Bacteria 3061
351 Ga0207639_10221437 3300026041 Bacteria 1634
352 Ga0207708_10122013 3300026075 Bacteria 2031
353 Ga0207702_10006369 3300026078 Bacteria 10188
354 Ga0207702_10082598 3300026078 Bacteria 2794
355 Ga0207641_10129055 3300026088 Bacteria 2267
356 Ga0207641_10234572 3300026088 Bacteria 1707
357 Ga0207648_10003275 3300026089 Bacteria 17030
358 Ga0207648_10037599 3300026089 Bacteria 4265
359 Ga0207676_10032435 3300026095 Bacteria 3936
360 Ga0207674_10000120 3300026116 Bacteria 91883
361 Ga0207674_10022748 3300026116 Bacteria 6726
362 Ga0207674_10084352 3300026116 Bacteria 3175
363 Ga0207674_10131472 3300026116 Bacteria 2466
364 Ga0207698_10004081 3300026142 Bacteria 8866
365 Ga0207698_10046074 3300026142 Bacteria 3290
366 Ga0207698_10048475 3300026142 Bacteria 3225
367 Ga0207428_10037258 3300027907 Bacteria 3958
368 Ga0268265_10001595 3300028380 Bacteria 18725
369 Ga0268265_10029086 3300028380 Bacteria 3963
370 Ga0268264_10187788 3300028381 Unclassified 1881
371 Ga0307408_100007743 3300031548 Bacteria 7105
372 Ga0307408_100041290 3300031548 Bacteria 3270
373 Ga0307405_10005306 3300031731 Bacteria 6200
374 Ga0307405_10006690 3300031731 Bacteria 5693
375 Ga0307410_10100626 3300031852 Bacteria 2071
376 Ga0307406_10021245 3300031901 Bacteria 3837
377 Ga0307407_10006838 3300031903 Bacteria 5113
378 Ga0307407_10019916 3300031903 Bacteria 3424
379 Ga0307412_10137685 3300031911 Bacteria 1783
380 Ga0307409_100002209 3300031995 Bacteria 10056
381 Ga0307409_100023682 3300031995 Bacteria 4262
382 Ga0307409_100065563 3300031995 Bacteria 2858
383 Ga0307416_100018746 3300032002 Bacteria 4886
384 Ga0307416_100026641 3300032002 Bacteria 4263
385 Ga0307416_100038762 3300032002 Bacteria 3679
386 Ga0307416_100195182 3300032002 Bacteria 1914
387 Ga0307416_100224637 3300032002 Bacteria 1804
388 Ga0307414_10005718 3300032004 Bacteria 6870
389 Ga0307414_10038033 3300032004 Bacteria 3227
390 Ga0307411_10159814 3300032005 Bacteria 1686
391 Ga0307411_10420757 3300032005 Bacteria 1110
392 Ga0307415_100001449 3300032126 Bacteria 11366
393 Ga0373926_0000847 3300035083 Bacteria 8715
394 Ga0373934_0000268 3300035086 Bacteria 18711
395 Ga0373923_0004528 3300035111 Bacteria 4622
396 Ga0373923_0052600 3300035111 Bacteria 1711
397 Ga0373953_0006058 3300035117 Bacteria 3964
398 Ga0373953_0023500 3300035117 Bacteria 2334
399 Ga0373954_0012964 3300035118 Bacteria 3712
400 Ga0373956_0001288 3300035119 Bacteria 10379
401 Ga0373946_0019839 3300035171 Bacteria 2593
402 Ga0373955_0009843 3300035172 Bacteria 4496
403 Ga0373955_0022976 3300035172 Bacteria 3171
404 Ga0373955_0028183 3300035172 Bacteria 2910
405 Ga0373935_0000326 3300035692 Bacteria 23943
406 Ga0373927_0005297 3300035695 Bacteria 8910
407 Ga0373933_0000033 3300035724 Bacteria 84415
408 Ga0373933_0052222 3300035724 Bacteria 2445
409 Ga0373947_0001264 3300035725 Bacteria 15571
410 Ga0373937_0000158 3300036401 Bacteria 65505
411 Ga0373937_0001025 3300036401 Bacteria 23637
412 Ga0373937_0086795 3300036401 Bacteria 2895
413 Ga0373925_0000986 3300037068 Bacteria 25937
414 Ga0395898_0157387 3300037466 Bacteria 2173
415 Ga0395905_0012027 3300037471 Bacteria 8346
416 Ga0395905_0025986 3300037471 Bacteria 5521
417 Ga0395901_0012275 3300038443 Bacteria 8694
418 Ga0450896_004842 3300042133 Bacteria 1831
419 Ga0451577_0000005 3300042876 Bacteria 712599
420 Ga0466969_0108285 3300044656 Bacteria 1303
421 Ga0466966_0129945 3300044684 Bacteria 1543
422 Ga0466959_0017315 3300045049 Bacteria 5281
423 Ga0466967_0025650 3300045976 Bacteria 4864
424 Ga0466967_0235142 3300045976 Bacteria 1746
425 Ga0495603_0016958 3300046455 Bacteria 4407
426 Ga0495629_0003679 3300046459 Bacteria 11589
427 Ga0495629_0045502 3300046459 Bacteria 3079
428 Ga0495629_0100630 3300046459 Bacteria 2017
429 Ga0495651_0000572 3300046462 Bacteria 28583
430 Ga0495651_0004202 3300046462 Bacteria 11032
431 Ga0495651_0035342 3300046462 Bacteria 3891
432 Ga0495653_0000173 3300046463 Bacteria 53365
433 Ga0495653_0014450 3300046463 Bacteria 6442
434 Ga0495580_0006012 3300046472 Bacteria 9936
435 Ga0495580_0038935 3300046472 Bacteria 3402
436 Ga0495582_0008481 3300046473 Bacteria 5670
437 Ga0495662_0040127 3300046476 Bacteria 2261
438 Ga0495664_0013973 3300046477 Bacteria 4549
439 Ga0495594_0012106 3300046499 Bacteria 4491
440 Ga0495594_0043959 3300046499 Bacteria 2450
441 Ga0495594_0139221 3300046499 Bacteria 1376
442 Ga0495608_0000418 3300046511 Bacteria 29615
443 Ga0495618_0069736 3300046514 Bacteria 2235
444 Ga0495628_0000467 3300046516 Bacteria 37087
445 Ga0495628_0091911 3300046516 Bacteria 2348
446 Ga0495630_0001246 3300046517 Bacteria 17578
447 Ga0495630_0079628 3300046517 Bacteria 2471
448 Ga0495652_0000658 3300046529 Bacteria 40060
449 Ga0495652_0002827 3300046529 Bacteria 17480
450 Ga0495665_0000327 3300046531 Bacteria 24173
451 Ga0495587_0000247 3300046536 Bacteria 39646
452 Ga0495587_0003466 3300046536 Bacteria 10506
453 Ga0495587_0010322 3300046536 Bacteria 5951
454 Ga0495645_0000210 3300046543 Bacteria 41882
455 Ga0495645_0005284 3300046543 Bacteria 8846
456 Ga0495645_0022315 3300046543 Bacteria 4578
457 Ga0495645_0051695 3300046543 Bacteria 2989
458 Ga0495667_0004730 3300046559 Bacteria 9204
459 Ga0495634_0057120 3300046642 Bacteria 2606
460 Ga0495635_0000157 3300046663 Bacteria 41636
461 Ga0495635_0068088 3300046663 Bacteria 2442
462 Ga0495588_0001152 3300046674 Bacteria 11358
463 Ga0495657_0008627 3300046675 Bacteria 7779
464 Ga0495599_0000858 3300046678 Bacteria 16995
465 Ga0495599_0014299 3300046678 Bacteria 4915
466 Ga0495599_0030779 3300046678 Bacteria 3369
467 Ga0495623_0000014 3300046679 Bacteria 119814
468 Ga0495623_0001143 3300046679 Bacteria 17950
469 Ga0495646_0040531 3300046680 Bacteria 2867
470 Ga0495658_0000573 3300046683 Bacteria 20062
471 Ga0495613_0124651 3300046689 Bacteria 1848
472 Ga0495600_0000105 3300046809 Bacteria 46401
473 Ga0495581_0000150 3300047315 Bacteria 30837
474 Ga0495581_0023496 3300047315 Bacteria 3572
475 Ga0495604_0002679 3300047317 Bacteria 14280
476 Ga0495604_0208938 3300047317 Bacteria 1350
477 Ga0495674_0005036 3300047319 Bacteria 12709
478 Ga0495672_0003097 3300047320 Bacteria 14528
479 Ga0495680_0001244 3300047322 Bacteria 27949
480 Ga0495675_0021362 3300047444 Bacteria 4121
481 Ga0495675_0043803 3300047444 Bacteria 2851
482 Ga0495675_0083758 3300047444 Unclassified 2007
483 Ga0495684_0003598 3300047471 Bacteria 12086
484 Ga0495593_0000112 3300047673 Bacteria 38250
485 Ga0495602_0003519 3300048088 Bacteria 16197
486 Ga0495602_0034625 3300048088 Bacteria 4722
487 Ga0495602_0146808 3300048088 Bacteria 1859
488 Ga0495614_0000021 3300048089 Bacteria 45062
489 Ga0496105_0113580 3300048908 Bacteria 2235
490 Ga0496106_0137953 3300048909 Bacteria 1917
491 Ga0496108_0082404 3300048911 Bacteria 2728
492 Ga0496109_0007143 3300048912 Bacteria 9436
493 Ga0496112_0025310 3300048915 Bacteria 5698
494 Ga0496112_0050523 3300048915 Bacteria 4078
495 Ga0496112_0158895 3300048915 Bacteria 2227
496 Ga0496113_0017414 3300048916 Bacteria 4987
497 Ga0496114_0118358 3300048917 Bacteria 2276
498 Ga0496115_0003186 3300048918 Bacteria 11790
499 Ga0501031_0036006 3300049568 Bacteria 3228
500 Ga0501033_0006024 3300049570 Bacteria 9512
501 Ga0501034_0281481 3300049571 Bacteria 1602
502 Ga0501034_0315844 3300049571 Bacteria 1496
503 Ga0501036_0168888 3300049572 Bacteria 1843
504 Ga0501038_0032379 3300049574 Bacteria 4613
505 Ga0501038_0300825 3300049574 Bacteria 1259
506 Ga0501047_0067420 3300049581 Bacteria 3449
507 Ga0501080_0178552 3300049742 Bacteria 1955
508 Ga0501035_0203895 3300049822 Bacteria 1695
509 Ga0501035_0221324 3300049822 Bacteria 1616
510 Ga0501045_0009542 3300049824 Bacteria 6790
511 nmdc:mga05p37_116123_c1 3300050507 Bacteria 3289
512 nmdc:mga0qj67_149950_c1 3300050509 Bacteria 1892
513 nmdc:mga0qj67_27546_c1 3300050509 Bacteria 4406
514 nmdc:mga0qj67_303753_c1 3300050509 Bacteria 1293
515 nmdc:mga0qj67_3307_c1 3300050509 Bacteria 11613
516 nmdc:mga0qj67_42956_c1 3300050509 Bacteria 3560
517 nmdc:mga06r32_36854_c1 3300050510 Bacteria 4625
518 nmdc:mga06r32_57724_c1 3300050510 Bacteria 3729
519 nmdc:mga08y16_47765_c1 3300050511 Bacteria 4480
520 nmdc:mga0rr50_98846_c1 3300050513 Bacteria 2288
521 nmdc:mga08x19_6841_c1 3300050514 Bacteria 6773
522 Ga0495612_0004210 3300053078 Bacteria 5966
523 Ga0495619_0003661 3300053085 Bacteria 9906
524 Ga0501084_0183129 3300054114 Bacteria 1768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035171 Ga0373946_0019839 Ga0373946_0019839_1534_2574 320
2 3300005530 Ga0070679_100013713 Ga0070679_1000137132 329
3 3300025921 Ga0207652_10010341 Ga0207652_100103416 329
4 3300044684 Ga0466966_0129945 Ga0466966_0129945_152_1174 330
5 3300025921 Ga0207652_10002058 Ga0207652_1000205812 334
6 3300009093 Ga0105240_10001786 Ga0105240_100017863 335
7 3300013104 Ga0157370_10025875 Ga0157370_100258752 335
8 3300013307 Ga0157372_10131041 Ga0157372_101310412 335
9 3300013308 Ga0157375_10023763 Ga0157375_100237633 335
10 3300042876 Ga0451577_0000005 Ga0451577_0000005_64868_65893 335
11 3300045976 Ga0466967_0235142 Ga0466967_0235142_364_1449 335
12 3300009093 Ga0105240_10527918 Ga0105240_105279181 336
13 3300009545 Ga0105237_10004438 Ga0105237_100044382 336
14 3300014969 Ga0157376_10110333 Ga0157376_101103332 336
15 3300025913 Ga0207695_10369543 Ga0207695_103695431 336
16 3300025914 Ga0207671_10106249 Ga0207671_101062492 336
17 3300005535 Ga0070684_100008121 Ga0070684_1000081215 338
18 3300005578 Ga0068854_100031306 Ga0068854_1000313062 338
19 3300005327 Ga0070658_10001483 Ga0070658_100014834 339
20 3300025909 Ga0207705_10029168 Ga0207705_100291684 339
21 3300025917 Ga0207660_10034422 Ga0207660_100344222 339
22 3300025919 Ga0207657_10031470 Ga0207657_100314704 339
23 3300025944 Ga0207661_10231465 Ga0207661_102314651 339
24 3300026041 Ga0207639_10221437 Ga0207639_102214372 339
25 3300005336 Ga0070680_100192134 Ga0070680_1001921341 340
26 3300025912 Ga0207707_10032322 Ga0207707_100323224 341
27 3300025917 Ga0207660_10005979 Ga0207660_100059794 341
28 3300005344 Ga0070661_100020906 Ga0070661_1000209064 342
29 3300005546 Ga0070696_100015929 Ga0070696_1000159294 342
30 3300013104 Ga0157370_10161439 Ga0157370_101614392 342
31 3300013105 Ga0157369_10073946 Ga0157369_100739464 342
32 3300025913 Ga0207695_10004134 Ga0207695_1000413416 342
33 3300025919 Ga0207657_10116369 Ga0207657_101163692 342
34 3300005434 Ga0070709_10020880 Ga0070709_100208803 343
35 3300005439 Ga0070711_100051785 Ga0070711_1000517853 343
36 3300005445 Ga0070708_100000045 Ga0070708_10000004533 343
37 3300005467 Ga0070706_100029357 Ga0070706_1000293574 343
38 3300005468 Ga0070707_100029417 Ga0070707_1000294173 343
39 3300005563 Ga0068855_100207602 Ga0068855_1002076021 343
40 3300005578 Ga0068854_100291151 Ga0068854_1002911512 343
41 3300025910 Ga0207684_10089310 Ga0207684_100893102 343
42 3300025912 Ga0207707_10024036 Ga0207707_100240361 343
43 3300025913 Ga0207695_10022295 Ga0207695_100222953 343
44 3300025917 Ga0207660_10027935 Ga0207660_100279352 343
45 3300025922 Ga0207646_10035542 Ga0207646_100355422 343
46 3300026078 Ga0207702_10082598 Ga0207702_100825982 343
47 3300050514 nmdc:mga08x19_6841_c1 nmdc:mga08x19_6841_c1_2048_3139 343
48 3300005329 Ga0070683_100001197 Ga0070683_10000119710 344
49 3300005329 Ga0070683_100026676 Ga0070683_1000266761 344
50 3300005330 Ga0070690_100105005 Ga0070690_1001050052 344
51 3300005335 Ga0070666_10190707 Ga0070666_101907072 344
52 3300005336 Ga0070680_100001664 Ga0070680_1000016643 344
53 3300005336 Ga0070680_100029579 Ga0070680_1000295792 344
54 3300005336 Ga0070680_100124753 Ga0070680_1001247532 344
55 3300005340 Ga0070689_100128978 Ga0070689_1001289782 344
56 3300005343 Ga0070687_100024037 Ga0070687_1000240372 344
57 3300005364 Ga0070673_100178888 Ga0070673_1001788881 344
58 3300005365 Ga0070688_100008049 Ga0070688_1000080492 344
59 3300005458 Ga0070681_10000537 Ga0070681_100005375 344
60 3300005458 Ga0070681_10013515 Ga0070681_100135153 344
61 3300005466 Ga0070685_10017695 Ga0070685_100176953 344
62 3300005530 Ga0070679_100016000 Ga0070679_1000160004 344
63 3300005530 Ga0070679_100058934 Ga0070679_1000589343 344
64 3300005535 Ga0070684_100016538 Ga0070684_1000165386 344
65 3300005535 Ga0070684_100056307 Ga0070684_1000563072 344
66 3300005535 Ga0070684_100069933 Ga0070684_1000699332 344
67 3300005543 Ga0070672_100080441 Ga0070672_1000804412 344
68 3300005563 Ga0068855_100013870 Ga0068855_1000138709 344
69 3300005564 Ga0070664_100163564 Ga0070664_1001635642 344
70 3300005577 Ga0068857_100121082 Ga0068857_1001210822 344
71 3300005616 Ga0068852_100063876 Ga0068852_1000638761 344
72 3300005617 Ga0068859_100056249 Ga0068859_1000562494 344
73 3300005840 Ga0068870_10012345 Ga0068870_100123453 344
74 3300006931 Ga0097620_100056249 Ga0097620_1000562494 344
75 3300009177 Ga0105248_10068953 Ga0105248_100689532 344
76 3300009553 Ga0105249_10044399 Ga0105249_100443992 344
77 3300013104 Ga0157370_10007065 Ga0157370_100070658 344
78 3300013105 Ga0157369_10154196 Ga0157369_101541962 344
79 3300013307 Ga0157372_10011940 Ga0157372_100119407 344
80 3300013308 Ga0157375_10182494 Ga0157375_101824942 344
81 3300025901 Ga0207688_10107937 Ga0207688_101079372 344
82 3300025907 Ga0207645_10062675 Ga0207645_100626752 344
83 3300025912 Ga0207707_10004622 Ga0207707_100046226 344
84 3300025913 Ga0207695_10017490 Ga0207695_100174905 344
85 3300025913 Ga0207695_10296659 Ga0207695_102966592 344
86 3300025917 Ga0207660_10003457 Ga0207660_1000345711 344
87 3300025917 Ga0207660_10026731 Ga0207660_100267314 344
88 3300025917 Ga0207660_10277457 Ga0207660_102774571 344
89 3300025918 Ga0207662_10010164 Ga0207662_100101642 344
90 3300025921 Ga0207652_10000636 Ga0207652_100006362 344
91 3300025926 Ga0207659_10100729 Ga0207659_101007291 344
92 3300025940 Ga0207691_10026902 Ga0207691_100269022 344
93 3300025942 Ga0207689_10044160 Ga0207689_100441603 344
94 3300025944 Ga0207661_10002251 Ga0207661_100022511 344
95 3300025944 Ga0207661_10011779 Ga0207661_100117794 344
96 3300025944 Ga0207661_10037775 Ga0207661_100377753 344
97 3300025944 Ga0207661_10053505 Ga0207661_100535052 344
98 3300025972 Ga0207668_10055322 Ga0207668_100553222 344
99 3300026116 Ga0207674_10084352 Ga0207674_100843523 344
100 3300026142 Ga0207698_10046074 Ga0207698_100460742 344
101 3300028380 Ga0268265_10029086 Ga0268265_100290863 344
102 3300028381 Ga0268264_10187788 Ga0268264_101877882 344
103 3300035172 Ga0373955_0028183 Ga0373955_0028183_1635_2702 344
104 3300036401 Ga0373937_0001025 Ga0373937_0001025_6079_7146 344
105 3300045976 Ga0466967_0025650 Ga0466967_0025650_365_1435 344
106 3300046462 Ga0495651_0035342 Ga0495651_0035342_2612_3679 344
107 3300046499 Ga0495594_0012106 Ga0495594_0012106_1716_2783 344
108 3300046499 Ga0495594_0043959 Ga0495594_0043959_1367_2434 344
109 3300046536 Ga0495587_0010322 Ga0495587_0010322_947_2014 344
110 3300046543 Ga0495645_0005284 Ga0495645_0005284_1870_2937 344
111 3300046678 Ga0495599_0014299 Ga0495599_0014299_524_1591 344
112 3300046679 Ga0495623_0001143 Ga0495623_0001143_14516_15583 344
113 3300047444 Ga0495675_0083758 Ga0495675_0083758_611_1678 344
114 3300049571 Ga0501034_0315844 Ga0501034_0315844_134_1219 344
115 3300049822 Ga0501035_0203895 Ga0501035_0203895_511_1596 344
116 3300050509 nmdc:mga0qj67_149950_c1 nmdc:mga0qj67_149950_c1_399_1442 344
117 3300005329 Ga0070683_100100284 Ga0070683_1001002842 345
118 3300005336 Ga0070680_100139430 Ga0070680_1001394302 345
119 3300005339 Ga0070660_100091095 Ga0070660_1000910952 345
120 3300005339 Ga0070660_100108771 Ga0070660_1001087712 345
121 3300005366 Ga0070659_100078772 Ga0070659_1000787722 345
122 3300005435 Ga0070714_100035830 Ga0070714_1000358303 345
123 3300005530 Ga0070679_100171118 Ga0070679_1001711182 345
124 3300005535 Ga0070684_100022918 Ga0070684_1000229181 345
125 3300005564 Ga0070664_100175397 Ga0070664_1001753971 345
126 3300005616 Ga0068852_100041149 Ga0068852_1000411492 345
127 3300009098 Ga0105245_10095260 Ga0105245_100952602 345
128 3300009176 Ga0105242_10007016 Ga0105242_100070167 345
129 3300009177 Ga0105248_10135631 Ga0105248_101356312 345
130 3300013105 Ga0157369_10028114 Ga0157369_100281143 345
131 3300013105 Ga0157369_10110302 Ga0157369_101103023 345
132 3300013307 Ga0157372_10003638 Ga0157372_100036382 345
133 3300013307 Ga0157372_10094480 Ga0157372_100944803 345
134 3300013307 Ga0157372_10109733 Ga0157372_101097332 345
135 3300013308 Ga0157375_10631634 Ga0157375_106316341 345
136 3300025909 Ga0207705_10006635 Ga0207705_100066352 345
137 3300025919 Ga0207657_10030969 Ga0207657_100309693 345
138 3300025921 Ga0207652_10112280 Ga0207652_101122802 345
139 3300025921 Ga0207652_10141794 Ga0207652_101417942 345
140 3300025929 Ga0207664_10040806 Ga0207664_100408063 345
141 3300025944 Ga0207661_10028981 Ga0207661_100289812 345
142 3300025944 Ga0207661_10166175 Ga0207661_101661752 345
143 3300025945 Ga0207679_10129184 Ga0207679_101291842 345
144 3300031995 Ga0307409_100065563 Ga0307409_1000655633 345
145 3300032002 Ga0307416_100026641 Ga0307416_1000266412 345
146 3300032004 Ga0307414_10038033 Ga0307414_100380332 345
147 3300046476 Ga0495662_0040127 Ga0495662_0040127_527_1600 345
148 3300047317 Ga0495604_0208938 Ga0495604_0208938_162_1235 345
149 3300047320 Ga0495672_0003097 Ga0495672_0003097_6529_7599 345
150 3300047444 Ga0495675_0043803 Ga0495675_0043803_969_2042 345
151 3300048911 Ga0496108_0082404 Ga0496108_0082404_854_1924 345
152 3300048912 Ga0496109_0007143 Ga0496109_0007143_5635_6705 345
153 3300048915 Ga0496112_0025310 Ga0496112_0025310_3838_4908 345
154 3300049568 Ga0501031_0036006 Ga0501031_0036006_1291_2379 345
155 3300049574 Ga0501038_0032379 Ga0501038_0032379_917_1984 345
156 3300049742 Ga0501080_0178552 Ga0501080_0178552_425_1486 345
157 3300049822 Ga0501035_0221324 Ga0501035_0221324_515_1582 345
158 3300049824 Ga0501045_0009542 Ga0501045_0009542_2326_3414 345
159 3300054114 Ga0501084_0183129 Ga0501084_0183129_286_1374 345
160 3300005329 Ga0070683_100128253 Ga0070683_1001282532 346
161 3300005331 Ga0070670_100001690 Ga0070670_10000169011 346
162 3300005334 Ga0068869_100006554 Ga0068869_1000065546 346
163 3300005336 Ga0070680_100002636 Ga0070680_10000263611 346
164 3300005339 Ga0070660_100054163 Ga0070660_1000541632 346
165 3300005344 Ga0070661_100002651 Ga0070661_10000265113 346
166 3300005345 Ga0070692_10002754 Ga0070692_100027543 346
167 3300005354 Ga0070675_100001303 Ga0070675_1000013035 346
168 3300005355 Ga0070671_100061277 Ga0070671_1000612772 346
169 3300005366 Ga0070659_100005266 Ga0070659_1000052668 346
170 3300005435 Ga0070714_100016126 Ga0070714_1000161266 346
171 3300005435 Ga0070714_100022232 Ga0070714_1000222323 346
172 3300005436 Ga0070713_100000274 Ga0070713_10000027411 346
173 3300005437 Ga0070710_10059049 Ga0070710_100590491 346
174 3300005457 Ga0070662_100054079 Ga0070662_1000540792 346
175 3300005458 Ga0070681_10029456 Ga0070681_100294562 346
176 3300005530 Ga0070679_100002624 Ga0070679_1000026246 346
177 3300005530 Ga0070679_100049944 Ga0070679_1000499442 346
178 3300005535 Ga0070684_100094815 Ga0070684_1000948152 346
179 3300005535 Ga0070684_100116562 Ga0070684_1001165622 346
180 3300005563 Ga0068855_100441238 Ga0068855_1004412382 346
181 3300005564 Ga0070664_100092758 Ga0070664_1000927582 346
182 3300005577 Ga0068857_100008501 Ga0068857_1000085013 346
183 3300005614 Ga0068856_100008186 Ga0068856_1000081862 346
184 3300005617 Ga0068859_100020877 Ga0068859_1000208774 346
185 3300005618 Ga0068864_100008979 Ga0068864_1000089798 346
186 3300005840 Ga0068870_10063097 Ga0068870_100630972 346
187 3300005841 Ga0068863_100040124 Ga0068863_1000401242 346
188 3300005842 Ga0068858_100451767 Ga0068858_1004517671 346
189 3300006028 Ga0070717_10003227 Ga0070717_100032279 346
190 3300006028 Ga0070717_10165301 Ga0070717_101653011 346
191 3300006175 Ga0070712_100000729 Ga0070712_1000007292 346
192 3300006358 Ga0068871_100043477 Ga0068871_1000434771 346
193 3300006931 Ga0097620_100020878 Ga0097620_1000208783 346
194 3300009174 Ga0105241_10003130 Ga0105241_100031304 346
195 3300009177 Ga0105248_10010770 Ga0105248_100107705 346
196 3300011119 Ga0105246_10002700 Ga0105246_1000270010 346
197 3300013100 Ga0157373_10016174 Ga0157373_100161742 346
198 3300013102 Ga0157371_10007718 Ga0157371_100077188 346
199 3300013296 Ga0157374_10024820 Ga0157374_100248202 346
200 3300013297 Ga0157378_10107328 Ga0157378_101073282 346
201 3300013307 Ga0157372_10005371 Ga0157372_100053713 346
202 3300013307 Ga0157372_10177663 Ga0157372_101776632 346
203 3300014325 Ga0163163_10040544 Ga0163163_100405444 346
204 3300014745 Ga0157377_10000361 Ga0157377_1000036115 346
205 3300025906 Ga0207699_10041085 Ga0207699_100410852 346
206 3300025908 Ga0207643_10038298 Ga0207643_100382982 346
207 3300025912 Ga0207707_10003913 Ga0207707_100039135 346
208 3300025912 Ga0207707_10019956 Ga0207707_100199565 346
209 3300025912 Ga0207707_10034709 Ga0207707_100347091 346
210 3300025915 Ga0207693_10009781 Ga0207693_100097814 346
211 3300025917 Ga0207660_10039964 Ga0207660_100399642 346
212 3300025917 Ga0207660_10162998 Ga0207660_101629981 346
213 3300025919 Ga0207657_10059737 Ga0207657_100597372 346
214 3300025921 Ga0207652_10033953 Ga0207652_100339531 346
215 3300025921 Ga0207652_10177064 Ga0207652_101770641 346
216 3300025926 Ga0207659_10006490 Ga0207659_100064902 346
217 3300025927 Ga0207687_10002512 Ga0207687_100025129 346
218 3300025928 Ga0207700_10001579 Ga0207700_100015795 346
219 3300025929 Ga0207664_10033723 Ga0207664_100337233 346
220 3300025931 Ga0207644_10046697 Ga0207644_100466972 346
221 3300025932 Ga0207690_10003410 Ga0207690_100034105 346
222 3300025933 Ga0207706_10006192 Ga0207706_1000619211 346
223 3300025941 Ga0207711_10021340 Ga0207711_100213405 346
224 3300025942 Ga0207689_10003321 Ga0207689_100033213 346
225 3300025945 Ga0207679_10009151 Ga0207679_100091516 346
226 3300026116 Ga0207674_10000120 Ga0207674_1000012064 346
227 3300026142 Ga0207698_10004081 Ga0207698_100040813 346
228 3300031731 Ga0307405_10005306 Ga0307405_100053064 346
229 3300031901 Ga0307406_10021245 Ga0307406_100212453 346
230 3300031903 Ga0307407_10006838 Ga0307407_100068384 346
231 3300031911 Ga0307412_10137685 Ga0307412_101376852 346
232 3300031995 Ga0307409_100002209 Ga0307409_1000022092 346
233 3300032002 Ga0307416_100195182 Ga0307416_1001951821 346
234 3300032005 Ga0307411_10159814 Ga0307411_101598141 346
235 3300032126 Ga0307415_100001449 Ga0307415_1000014494 346
236 3300037466 Ga0395898_0157387 Ga0395898_0157387_257_1372 346
237 3300037471 Ga0395905_0012027 Ga0395905_0012027_6421_7536 346
238 3300037471 Ga0395905_0025986 Ga0395905_0025986_1246_2331 346
239 3300038443 Ga0395901_0012275 Ga0395901_0012275_4456_5571 346
240 3300046459 Ga0495629_0003679 Ga0495629_0003679_3909_4982 346
241 3300046473 Ga0495582_0008481 Ga0495582_0008481_2233_3306 346
242 3300047315 Ga0495581_0023496 Ga0495581_0023496_1373_2446 346
243 3300005329 Ga0070683_100049685 Ga0070683_1000496852 347
244 3300005614 Ga0068856_100200303 Ga0068856_1002003032 347
245 3300006871 Ga0075434_100048454 Ga0075434_1000484543 347
246 3300025906 Ga0207699_10037618 Ga0207699_100376182 347
247 3300025944 Ga0207661_10034946 Ga0207661_100349462 347
248 3300026078 Ga0207702_10006369 Ga0207702_100063692 347
249 3300035083 Ga0373926_0000847 Ga0373926_0000847_64_1191 347
250 3300035086 Ga0373934_0000268 Ga0373934_0000268_14647_15744 347
251 3300035111 Ga0373923_0004528 Ga0373923_0004528_57_1154 347
252 3300035111 Ga0373923_0052600 Ga0373923_0052600_539_1618 347
253 3300035117 Ga0373953_0006058 Ga0373953_0006058_203_1300 347
254 3300035117 Ga0373953_0023500 Ga0373953_0023500_648_1727 347
255 3300035118 Ga0373954_0012964 Ga0373954_0012964_1157_2236 347
256 3300035119 Ga0373956_0001288 Ga0373956_0001288_8972_10069 347
257 3300035172 Ga0373955_0009843 Ga0373955_0009843_516_1613 347
258 3300035172 Ga0373955_0022976 Ga0373955_0022976_1542_2621 347
259 3300035692 Ga0373935_0000326 Ga0373935_0000326_15634_16761 347
260 3300035695 Ga0373927_0005297 Ga0373927_0005297_3491_4618 347
261 3300035724 Ga0373933_0000033 Ga0373933_0000033_47430_48527 347
262 3300035724 Ga0373933_0052222 Ga0373933_0052222_636_1715 347
263 3300035725 Ga0373947_0001264 Ga0373947_0001264_282_1409 347
264 3300036401 Ga0373937_0000158 Ga0373937_0000158_52166_53263 347
265 3300036401 Ga0373937_0086795 Ga0373937_0086795_1236_2315 347
266 3300037068 Ga0373925_0000986 Ga0373925_0000986_15258_16385 347
267 3300044656 Ga0466969_0108285 Ga0466969_0108285_153_1280 347
268 3300045049 Ga0466959_0017315 Ga0466959_0017315_2296_3423 347
269 3300046455 Ga0495603_0016958 Ga0495603_0016958_154_1281 347
270 3300046459 Ga0495629_0100630 Ga0495629_0100630_105_1379 347
271 3300046462 Ga0495651_0000572 Ga0495651_0000572_24628_25725 347
272 3300046462 Ga0495651_0004202 Ga0495651_0004202_2300_3379 347
273 3300046463 Ga0495653_0000173 Ga0495653_0000173_50790_51887 347
274 3300046463 Ga0495653_0014450 Ga0495653_0014450_4267_5346 347
275 3300046472 Ga0495580_0006012 Ga0495580_0006012_849_1976 347
276 3300046477 Ga0495664_0013973 Ga0495664_0013973_223_1302 347
277 3300046511 Ga0495608_0000418 Ga0495608_0000418_2897_3994 347
278 3300046514 Ga0495618_0069736 Ga0495618_0069736_1097_2194 347
279 3300046516 Ga0495628_0000467 Ga0495628_0000467_3222_4319 347
280 3300046516 Ga0495628_0091911 Ga0495628_0091911_1100_2179 347
281 3300046517 Ga0495630_0001246 Ga0495630_0001246_7697_8824 347
282 3300046517 Ga0495630_0079628 Ga0495630_0079628_189_1286 347
283 3300046529 Ga0495652_0000658 Ga0495652_0000658_36092_37189 347
284 3300046529 Ga0495652_0002827 Ga0495652_0002827_8751_9830 347
285 3300046531 Ga0495665_0000327 Ga0495665_0000327_15350_16477 347
286 3300046536 Ga0495587_0000247 Ga0495587_0000247_1199_2296 347
287 3300046536 Ga0495587_0003466 Ga0495587_0003466_6109_7188 347
288 3300046543 Ga0495645_0000210 Ga0495645_0000210_26874_27971 347
289 3300046543 Ga0495645_0022315 Ga0495645_0022315_284_1363 347
290 3300046543 Ga0495645_0051695 Ga0495645_0051695_698_1777 347
291 3300046642 Ga0495634_0057120 Ga0495634_0057120_561_1658 347
292 3300046663 Ga0495635_0000157 Ga0495635_0000157_4057_5154 347
293 3300046663 Ga0495635_0068088 Ga0495635_0068088_137_1216 347
294 3300046674 Ga0495588_0001152 Ga0495588_0001152_3145_4272 347
295 3300046675 Ga0495657_0008627 Ga0495657_0008627_3739_4836 347
296 3300046678 Ga0495599_0000858 Ga0495599_0000858_2863_3960 347
297 3300046678 Ga0495599_0030779 Ga0495599_0030779_1166_2245 347
298 3300046679 Ga0495623_0000014 Ga0495623_0000014_34589_35686 347
299 3300046680 Ga0495646_0040531 Ga0495646_0040531_361_1440 347
300 3300046683 Ga0495658_0000573 Ga0495658_0000573_13656_14783 347
301 3300046689 Ga0495613_0124651 Ga0495613_0124651_669_1766 347
302 3300046809 Ga0495600_0000105 Ga0495600_0000105_2876_3973 347
303 3300047315 Ga0495581_0000150 Ga0495581_0000150_14163_15290 347
304 3300047317 Ga0495604_0002679 Ga0495604_0002679_3642_4721 347
305 3300047319 Ga0495674_0005036 Ga0495674_0005036_2866_3963 347
306 3300047322 Ga0495680_0001244 Ga0495680_0001244_2484_3581 347
307 3300047444 Ga0495675_0021362 Ga0495675_0021362_2942_4021 347
308 3300047471 Ga0495684_0003598 Ga0495684_0003598_5504_6583 347
309 3300047673 Ga0495593_0000112 Ga0495593_0000112_33729_34856 347
310 3300048088 Ga0495602_0003519 Ga0495602_0003519_12267_13364 347
311 3300048088 Ga0495602_0034625 Ga0495602_0034625_698_1777 347
312 3300048089 Ga0495614_0000021 Ga0495614_0000021_12213_13340 347
313 3300053078 Ga0495612_0004210 Ga0495612_0004210_1000_2097 347
314 3300053085 Ga0495619_0003661 Ga0495619_0003661_6977_8074 347
315 3300005328 Ga0070676_10042873 Ga0070676_100428732 348
316 3300005328 Ga0070676_10102670 Ga0070676_101026702 348
317 3300005329 Ga0070683_100033866 Ga0070683_1000338663 348
318 3300005329 Ga0070683_100109671 Ga0070683_1001096712 348
319 3300005334 Ga0068869_100333923 Ga0068869_1003339231 348
320 3300005343 Ga0070687_100069337 Ga0070687_1000693372 348
321 3300005347 Ga0070668_100019433 Ga0070668_1000194334 348
322 3300005353 Ga0070669_100141216 Ga0070669_1001412162 348
323 3300005355 Ga0070671_100010754 Ga0070671_1000107541 348
324 3300005356 Ga0070674_100014636 Ga0070674_1000146363 348
325 3300005367 Ga0070667_100081347 Ga0070667_1000813472 348
326 3300005367 Ga0070667_100256759 Ga0070667_1002567592 348
327 3300005367 Ga0070667_100309469 Ga0070667_1003094691 348
328 3300005457 Ga0070662_100067162 Ga0070662_1000671622 348
329 3300005459 Ga0068867_100035337 Ga0068867_1000353373 348
330 3300005466 Ga0070685_10089744 Ga0070685_100897441 348
331 3300005518 Ga0070699_100375959 Ga0070699_1003759591 348
332 3300005535 Ga0070684_100026145 Ga0070684_1000261451 348
333 3300005535 Ga0070684_100245940 Ga0070684_1002459402 348
334 3300005535 Ga0070684_100380168 Ga0070684_1003801681 348
335 3300005564 Ga0070664_100013127 Ga0070664_1000131275 348
336 3300005564 Ga0070664_100135355 Ga0070664_1001353552 348
337 3300005577 Ga0068857_100040907 Ga0068857_1000409073 348
338 3300005618 Ga0068864_100090837 Ga0068864_1000908371 348
339 3300005840 Ga0068870_10010164 Ga0068870_100101643 348
340 3300005842 Ga0068858_100107302 Ga0068858_1001073022 348
341 3300005843 Ga0068860_100069019 Ga0068860_1000690192 348
342 3300006846 Ga0075430_100004889 Ga0075430_1000048897 348
343 3300006847 Ga0075431_100073766 Ga0075431_1000737662 348
344 3300006881 Ga0068865_100072567 Ga0068865_1000725672 348
345 3300009098 Ga0105245_10478892 Ga0105245_104788921 348
346 3300009177 Ga0105248_10071471 Ga0105248_100714713 348
347 3300009177 Ga0105248_10151299 Ga0105248_101512992 348
348 3300013102 Ga0157371_10189813 Ga0157371_101898131 348
349 3300013308 Ga0157375_10073656 Ga0157375_100736562 348
350 3300014325 Ga0163163_10371975 Ga0163163_103719751 348
351 3300015262 Ga0182007_10059774 Ga0182007_100597741 348
352 3300017792 Ga0163161_10034811 Ga0163161_100348112 348
353 3300025893 Ga0207682_10027922 Ga0207682_100279222 348
354 3300025907 Ga0207645_10048955 Ga0207645_100489552 348
355 3300025907 Ga0207645_10071034 Ga0207645_100710342 348
356 3300025908 Ga0207643_10003121 Ga0207643_100031215 348
357 3300025909 Ga0207705_10070941 Ga0207705_100709412 348
358 3300025923 Ga0207681_10032103 Ga0207681_100321033 348
359 3300025923 Ga0207681_10077594 Ga0207681_100775942 348
360 3300025933 Ga0207706_10122547 Ga0207706_101225472 348
361 3300025938 Ga0207704_10019217 Ga0207704_100192171 348
362 3300025940 Ga0207691_10016638 Ga0207691_100166383 348
363 3300025940 Ga0207691_10030149 Ga0207691_100301492 348
364 3300025941 Ga0207711_10235955 Ga0207711_102359552 348
365 3300025944 Ga0207661_10100013 Ga0207661_101000132 348
366 3300025944 Ga0207661_10203919 Ga0207661_102039192 348
367 3300025944 Ga0207661_10307475 Ga0207661_103074752 348
368 3300025945 Ga0207679_10044518 Ga0207679_100445182 348
369 3300025972 Ga0207668_10027847 Ga0207668_100278472 348
370 3300025986 Ga0207658_10050495 Ga0207658_100504952 348
371 3300026088 Ga0207641_10234572 Ga0207641_102345721 348
372 3300026089 Ga0207648_10037599 Ga0207648_100375992 348
373 3300026095 Ga0207676_10032435 Ga0207676_100324351 348
374 3300026116 Ga0207674_10022748 Ga0207674_100227482 348
375 3300026116 Ga0207674_10131472 Ga0207674_101314721 348
376 3300032002 Ga0307416_100224637 Ga0307416_1002246372 348
377 3300048908 Ga0496105_0113580 Ga0496105_0113580_867_1934 348
378 3300048909 Ga0496106_0137953 Ga0496106_0137953_41_1108 348
379 3300048915 Ga0496112_0050523 Ga0496112_0050523_1601_2668 348
380 3300048916 Ga0496113_0017414 Ga0496113_0017414_103_1170 348
381 3300049570 Ga0501033_0006024 Ga0501033_0006024_4701_5783 348
382 3300049571 Ga0501034_0281481 Ga0501034_0281481_473_1555 348
383 3300049572 Ga0501036_0168888 Ga0501036_0168888_90_1172 348
384 3300049574 Ga0501038_0300825 Ga0501038_0300825_17_1099 348
385 3300049581 Ga0501047_0067420 Ga0501047_0067420_1865_2947 348
386 3300050509 nmdc:mga0qj67_303753_c1 nmdc:mga0qj67_303753_c1_130_1248 348
387 3300005331 Ga0070670_100175930 Ga0070670_1001759302 349
388 3300005336 Ga0070680_100049831 Ga0070680_1000498312 349
389 3300005347 Ga0070668_100024411 Ga0070668_1000244112 349
390 3300005353 Ga0070669_100004597 Ga0070669_1000045972 349
391 3300005353 Ga0070669_100254161 Ga0070669_1002541612 349
392 3300005354 Ga0070675_100004851 Ga0070675_1000048513 349
393 3300005355 Ga0070671_100072157 Ga0070671_1000721571 349
394 3300005457 Ga0070662_100082564 Ga0070662_1000825642 349
395 3300005457 Ga0070662_100086544 Ga0070662_1000865442 349
396 3300005458 Ga0070681_10008034 Ga0070681_100080344 349
397 3300005459 Ga0068867_100083776 Ga0068867_1000837762 349
398 3300005467 Ga0070706_100128581 Ga0070706_1001285812 349
399 3300005471 Ga0070698_100146751 Ga0070698_1001467512 349
400 3300005471 Ga0070698_100205329 Ga0070698_1002053292 349
401 3300005535 Ga0070684_100045645 Ga0070684_1000456453 349
402 3300005543 Ga0070672_100016872 Ga0070672_1000168722 349
403 3300005548 Ga0070665_100204588 Ga0070665_1002045882 349
404 3300005577 Ga0068857_100013444 Ga0068857_1000134444 349
405 3300005614 Ga0068856_100176153 Ga0068856_1001761532 349
406 3300005718 Ga0068866_10013526 Ga0068866_100135261 349
407 3300005719 Ga0068861_100012315 Ga0068861_1000123155 349
408 3300005834 Ga0068851_10019465 Ga0068851_100194652 349
409 3300005840 Ga0068870_10012484 Ga0068870_100124843 349
410 3300005840 Ga0068870_10163537 Ga0068870_101635372 349
411 3300005841 Ga0068863_100305094 Ga0068863_1003050942 349
412 3300005844 Ga0068862_100000513 Ga0068862_10000051326 349
413 3300006846 Ga0075430_100015467 Ga0075430_1000154673 349
414 3300006846 Ga0075430_100021793 Ga0075430_1000217933 349
415 3300006846 Ga0075430_100244046 Ga0075430_1002440462 349
416 3300006847 Ga0075431_100001756 Ga0075431_1000017564 349
417 3300006847 Ga0075431_100013780 Ga0075431_1000137802 349
418 3300006880 Ga0075429_100012636 Ga0075429_1000126363 349
419 3300009094 Ga0111539_10037513 Ga0111539_100375133 349
420 3300009147 Ga0114129_10177230 Ga0114129_101772302 349
421 3300009148 Ga0105243_10179084 Ga0105243_101790842 349
422 3300009176 Ga0105242_10035562 Ga0105242_100355624 349
423 3300009545 Ga0105237_10115057 Ga0105237_101150572 349
424 3300009551 Ga0105238_10042389 Ga0105238_100423892 349
425 3300009553 Ga0105249_10000251 Ga0105249_1000025113 349
426 3300013102 Ga0157371_10011433 Ga0157371_100114336 349
427 3300013105 Ga0157369_10109713 Ga0157369_101097133 349
428 3300013296 Ga0157374_10239765 Ga0157374_102397652 349
429 3300013297 Ga0157378_10075869 Ga0157378_100758691 349
430 3300013306 Ga0163162_10187794 Ga0163162_101877942 349
431 3300013307 Ga0157372_10025243 Ga0157372_100252432 349
432 3300013307 Ga0157372_10028700 Ga0157372_100287001 349
433 3300013308 Ga0157375_10500040 Ga0157375_105000401 349
434 3300014325 Ga0163163_10002771 Ga0163163_100027717 349
435 3300014326 Ga0157380_10023530 Ga0157380_100235302 349
436 3300014968 Ga0157379_10001669 Ga0157379_1000166913 349
437 3300014969 Ga0157376_10248369 Ga0157376_102483692 349
438 3300025903 Ga0207680_10182171 Ga0207680_101821712 349
439 3300025908 Ga0207643_10002389 Ga0207643_1000238911 349
440 3300025908 Ga0207643_10140316 Ga0207643_101403162 349
441 3300025910 Ga0207684_10036904 Ga0207684_100369044 349
442 3300025912 Ga0207707_10015537 Ga0207707_100155373 349
443 3300025914 Ga0207671_10042557 Ga0207671_100425572 349
444 3300025915 Ga0207693_10124994 Ga0207693_101249942 349
445 3300025918 Ga0207662_10002218 Ga0207662_100022181 349
446 3300025923 Ga0207681_10001166 Ga0207681_100011668 349
447 3300025924 Ga0207694_10127219 Ga0207694_101272192 349
448 3300025925 Ga0207650_10020901 Ga0207650_100209012 349
449 3300025925 Ga0207650_10200054 Ga0207650_102000541 349
450 3300025926 Ga0207659_10054273 Ga0207659_100542732 349
451 3300025933 Ga0207706_10216576 Ga0207706_102165761 349
452 3300025933 Ga0207706_10257060 Ga0207706_102570602 349
453 3300025935 Ga0207709_10108714 Ga0207709_101087142 349
454 3300025937 Ga0207669_10013126 Ga0207669_100131264 349
455 3300025940 Ga0207691_10018984 Ga0207691_100189843 349
456 3300025961 Ga0207712_10004110 Ga0207712_100041104 349
457 3300025972 Ga0207668_10019443 Ga0207668_100194432 349
458 3300026075 Ga0207708_10122013 Ga0207708_101220132 349
459 3300026088 Ga0207641_10129055 Ga0207641_101290552 349
460 3300026089 Ga0207648_10003275 Ga0207648_1000327512 349
461 3300027907 Ga0207428_10037258 Ga0207428_100372582 349
462 3300028380 Ga0268265_10001595 Ga0268265_100015959 349
463 3300031548 Ga0307408_100041290 Ga0307408_1000412902 349
464 3300031852 Ga0307410_10100626 Ga0307410_101006262 349
465 3300032002 Ga0307416_100018746 Ga0307416_1000187463 349
466 3300032005 Ga0307411_10420757 Ga0307411_104207571 349
467 3300042133 Ga0450896_004842 Ga0450896_004842_619_1677 349
468 3300046459 Ga0495629_0045502 Ga0495629_0045502_1739_2824 349
469 3300046472 Ga0495580_0038935 Ga0495580_0038935_1856_2941 349
470 3300046499 Ga0495594_0139221 Ga0495594_0139221_228_1313 349
471 3300046559 Ga0495667_0004730 Ga0495667_0004730_2161_3246 349
472 3300048088 Ga0495602_0146808 Ga0495602_0146808_281_1366 349
473 3300048915 Ga0496112_0158895 Ga0496112_0158895_937_1995 349
474 3300048917 Ga0496114_0118358 Ga0496114_0118358_123_1235 349
475 3300048918 Ga0496115_0003186 Ga0496115_0003186_9569_10681 349
476 3300050507 nmdc:mga05p37_116123_c1 nmdc:mga05p37_116123_c1_1503_2561 349
477 3300050509 nmdc:mga0qj67_27546_c1 nmdc:mga0qj67_27546_c1_1783_2844 349
478 3300050509 nmdc:mga0qj67_3307_c1 nmdc:mga0qj67_3307_c1_8021_9079 349
479 3300050509 nmdc:mga0qj67_42956_c1 nmdc:mga0qj67_42956_c1_283_1404 349
480 3300050510 nmdc:mga06r32_36854_c1 nmdc:mga06r32_36854_c1_3374_4435 349
481 3300050510 nmdc:mga06r32_57724_c1 nmdc:mga06r32_57724_c1_1765_2886 349
482 3300050513 nmdc:mga0rr50_98846_c1 nmdc:mga0rr50_98846_c1_297_1355 349
483 3300013105 Ga0157369_10015607 Ga0157369_100156075 352
484 3300031548 Ga0307408_100007743 Ga0307408_1000077435 352
485 3300031731 Ga0307405_10006690 Ga0307405_100066903 352
486 3300031903 Ga0307407_10019916 Ga0307407_100199162 352
487 3300031995 Ga0307409_100023682 Ga0307409_1000236823 352
488 3300032002 Ga0307416_100038762 Ga0307416_1000387622 352
489 3300032004 Ga0307414_10005718 Ga0307414_100057182 352
490 3300005546 Ga0070696_100005390 Ga0070696_1000053905 353
491 3300005436 Ga0070713_100062954 Ga0070713_1000629542 354
492 3300005985 Ga0081539_10000174 Ga0081539_10000174130 354
493 3300009147 Ga0114129_10738944 Ga0114129_107389441 354
494 3300025928 Ga0207700_10063341 Ga0207700_100633412 354
495 3300005336 Ga0070680_100018440 Ga0070680_1000184402 357
496 3300005458 Ga0070681_10013030 Ga0070681_100130307 357
497 3300005530 Ga0070679_100000940 Ga0070679_10000094019 357
498 3300025912 Ga0207707_10001274 Ga0207707_1000127420 357
499 3300025917 Ga0207660_10028418 Ga0207660_100284184 357
500 3300025921 Ga0207652_10003798 Ga0207652_1000379811 357
501 3300005347 Ga0070668_100046693 Ga0070668_1000466932 358
502 3300005458 Ga0070681_10207396 Ga0070681_102073962 358
503 3300005548 Ga0070665_100264590 Ga0070665_1002645901 358
504 3300005614 Ga0068856_100034774 Ga0068856_1000347743 358
505 3300005616 Ga0068852_100056074 Ga0068852_1000560742 358
506 3300006914 Ga0075436_100002168 Ga0075436_1000021681 358
507 3300009093 Ga0105240_10018268 Ga0105240_100182684 358
508 3300013100 Ga0157373_10070660 Ga0157373_100706601 358
509 3300013104 Ga0157370_10014177 Ga0157370_100141775 358
510 3300013105 Ga0157369_10004783 Ga0157369_100047835 358
511 3300013307 Ga0157372_10014215 Ga0157372_100142155 358
512 3300014969 Ga0157376_10007918 Ga0157376_100079183 358
513 3300020070 Ga0206356_11147558 Ga0206356_111475582 358
514 3300025912 Ga0207707_10036663 Ga0207707_100366633 358
515 3300025912 Ga0207707_10042475 Ga0207707_100424752 358
516 3300025913 Ga0207695_10309910 Ga0207695_103099101 358
517 3300025921 Ga0207652_10035111 Ga0207652_100351112 358
518 3300025961 Ga0207712_10001263 Ga0207712_1000126310 358
519 3300026142 Ga0207698_10048475 Ga0207698_100484752 358
520 3300005295 Ga0065707_10092301 Ga0065707_100923013 359
521 3300005844 Ga0068862_100105087 Ga0068862_1001050871 359
522 3300006846 Ga0075430_100053013 Ga0075430_1000530134 359
523 3300009094 Ga0111539_10048767 Ga0111539_100487673 359
524 3300050511 nmdc:mga08y16_47765_c1 nmdc:mga08y16_47765_c1_1883_2962 359

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

13

123

0.98

PF13487

HD_5

HD domain

162

330

0.96

PF01966

HD

HD domain

175

298

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9564 20 137
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9562 21 137
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9549 21 137
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9545 21 137
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.951 20 137
ID Description Score Start End Superfamily
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9672 19 99 3.40.50.2300
af_O69730_8_88_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9558 19 99 3.40.50.2300
4d6yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9516 22 136 3.40.50.2300
1zy2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9466 20 143 3.40.50.2300
1zy2B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9445 20 143 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A353LGX9-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9699 19 139 GO:0000160
GO:0005524
GO:0006355
GO:0043565
AF-A0A497IEC0-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.9685 18 144 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A7W7Y2B2-F1-model_v4 DNA-binding NtrC family response regulator 0.9635 20 138 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A1G1I1A7-F1-model_v4 Response regulatory domain-containing protein 0.9633 20 138 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A419DN44-F1-model_v4 DNA-binding response regulator 0.9624 20 130 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Feature Viewer

pLDDT pTM Quality
88.34 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map