F459174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 524 | 245 | 524 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300046459|Ga0495629_0100630|Ga0495629_0100630_105_1379 |
| Length | 424 |
| Sequence | MSAAAAVMNALYCLIVDDEPRLRQVLTHVMRRDGFRCIEAADGYEALEQLRRYPVSLVLTDLRMPGMDGMELLRHVRAFHSDIAVVMITAVPDVQAAVNCLSTGAMDYLTKPFHLEEVRARVAQAMDRRRLILENRDYQERLKDRVAAQASRLEQMFFAGVQALAEALELKDPYTRGHSVRVSQYSSILARALHLDDDAVRQIELGGHVHDIGKIGVREAVLNKTEKLTDEEYEHIMIHPLVGWRILAPLLGDAPIALNIVRSHHERIDGQGIPDGLSGQAIPLEARIVAVADAIDAMTSGRPYRGNELSLEDALVELRQNAGSQFDERVVAAVEEAVRCGDLYLMPRNTGQFVMVCRRRFRRRGGDAVASALSVATRHFXXXRRTRLQGDPSDWRLRSSHLPLVVSFRAQRHRSARCADCRGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 151 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 152 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 156 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 164 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 171 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 177 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 178 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 179 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 180 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 181 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 222 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.81 |
| Metatranscriptomes | 0.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.91 |
| Rhizosphere | 98.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10092301 | 3300005295 | Unclassified | 3791 |
| 2 | Ga0070658_10001483 | 3300005327 | Bacteria | 19915 |
| 3 | Ga0070676_10042873 | 3300005328 | Bacteria | 2629 |
| 4 | Ga0070676_10102670 | 3300005328 | Bacteria | 1769 |
| 5 | Ga0070683_100001197 | 3300005329 | Bacteria | 19738 |
| 6 | Ga0070683_100026676 | 3300005329 | Bacteria | 5205 |
| 7 | Ga0070683_100033866 | 3300005329 | Bacteria | 4662 |
| 8 | Ga0070683_100049685 | 3300005329 | Bacteria | 3880 |
| 9 | Ga0070683_100100284 | 3300005329 | Bacteria | 2726 |
| 10 | Ga0070683_100109671 | 3300005329 | Bacteria | 2603 |
| 11 | Ga0070683_100128253 | 3300005329 | Bacteria | 2399 |
| 12 | Ga0070690_100105005 | 3300005330 | Bacteria | 1877 |
| 13 | Ga0070670_100001690 | 3300005331 | Bacteria | 17937 |
| 14 | Ga0070670_100175930 | 3300005331 | Bacteria | 1857 |
| 15 | Ga0068869_100006554 | 3300005334 | Bacteria | 7383 |
| 16 | Ga0068869_100333923 | 3300005334 | Bacteria | 1232 |
| 17 | Ga0070666_10190707 | 3300005335 | Unclassified | 1440 |
| 18 | Ga0070680_100001664 | 3300005336 | Bacteria | 16262 |
| 19 | Ga0070680_100002636 | 3300005336 | Bacteria | 13294 |
| 20 | Ga0070680_100018440 | 3300005336 | Bacteria | 5513 |
| 21 | Ga0070680_100029579 | 3300005336 | Bacteria | 4399 |
| 22 | Ga0070680_100049831 | 3300005336 | Bacteria | 3415 |
| 23 | Ga0070680_100124753 | 3300005336 | Bacteria | 2151 |
| 24 | Ga0070680_100139430 | 3300005336 | Bacteria | 2033 |
| 25 | Ga0070680_100192134 | 3300005336 | Bacteria | 1720 |
| 26 | Ga0070660_100054163 | 3300005339 | Bacteria | 3096 |
| 27 | Ga0070660_100091095 | 3300005339 | Bacteria | 2405 |
| 28 | Ga0070660_100108771 | 3300005339 | Bacteria | 2204 |
| 29 | Ga0070689_100128978 | 3300005340 | Unclassified | 2027 |
| 30 | Ga0070687_100024037 | 3300005343 | Bacteria | 2903 |
| 31 | Ga0070687_100069337 | 3300005343 | Bacteria | 1888 |
| 32 | Ga0070661_100002651 | 3300005344 | Bacteria | 12236 |
| 33 | Ga0070661_100020906 | 3300005344 | Bacteria | 4671 |
| 34 | Ga0070692_10002754 | 3300005345 | Bacteria | 6918 |
| 35 | Ga0070668_100019433 | 3300005347 | Bacteria | 5113 |
| 36 | Ga0070668_100024411 | 3300005347 | Bacteria | 4581 |
| 37 | Ga0070668_100046693 | 3300005347 | Bacteria | 3327 |
| 38 | Ga0070669_100004597 | 3300005353 | Bacteria | 9964 |
| 39 | Ga0070669_100141216 | 3300005353 | Bacteria | 1857 |
| 40 | Ga0070669_100254161 | 3300005353 | Bacteria | 1400 |
| 41 | Ga0070675_100001303 | 3300005354 | Bacteria | 18230 |
| 42 | Ga0070675_100004851 | 3300005354 | Bacteria | 10263 |
| 43 | Ga0070671_100010754 | 3300005355 | Bacteria | 7345 |
| 44 | Ga0070671_100061277 | 3300005355 | Bacteria | 3133 |
| 45 | Ga0070671_100072157 | 3300005355 | Bacteria | 2883 |
| 46 | Ga0070674_100014636 | 3300005356 | Bacteria | 4880 |
| 47 | Ga0070673_100178888 | 3300005364 | Bacteria | 1815 |
| 48 | Ga0070688_100008049 | 3300005365 | Bacteria | 5706 |
| 49 | Ga0070659_100005266 | 3300005366 | Bacteria | 9282 |
| 50 | Ga0070659_100078772 | 3300005366 | Bacteria | 2629 |
| 51 | Ga0070667_100081347 | 3300005367 | Bacteria | 2772 |
| 52 | Ga0070667_100256759 | 3300005367 | Bacteria | 1564 |
| 53 | Ga0070667_100309469 | 3300005367 | Bacteria | 1424 |
| 54 | Ga0070709_10020880 | 3300005434 | Bacteria | 3809 |
| 55 | Ga0070714_100016126 | 3300005435 | Bacteria | 6025 |
| 56 | Ga0070714_100022232 | 3300005435 | Bacteria | 5198 |
| 57 | Ga0070714_100035830 | 3300005435 | Bacteria | 4159 |
| 58 | Ga0070713_100000274 | 3300005436 | Bacteria | 33771 |
| 59 | Ga0070713_100062954 | 3300005436 | Bacteria | 3108 |
| 60 | Ga0070710_10059049 | 3300005437 | Bacteria | 2177 |
| 61 | Ga0070711_100051785 | 3300005439 | Bacteria | 2822 |
| 62 | Ga0070708_100000045 | 3300005445 | Bacteria | 81076 |
| 63 | Ga0070662_100054079 | 3300005457 | Bacteria | 2909 |
| 64 | Ga0070662_100067162 | 3300005457 | Bacteria | 2633 |
| 65 | Ga0070662_100082564 | 3300005457 | Bacteria | 2397 |
| 66 | Ga0070662_100086544 | 3300005457 | Bacteria | 2344 |
| 67 | Ga0070681_10000537 | 3300005458 | Bacteria | 31196 |
| 68 | Ga0070681_10008034 | 3300005458 | Bacteria | 10333 |
| 69 | Ga0070681_10013030 | 3300005458 | Bacteria | 8257 |
| 70 | Ga0070681_10013515 | 3300005458 | Bacteria | 8117 |
| 71 | Ga0070681_10029456 | 3300005458 | Bacteria | 5513 |
| 72 | Ga0070681_10207396 | 3300005458 | Bacteria | 1876 |
| 73 | Ga0068867_100035337 | 3300005459 | Bacteria | 3624 |
| 74 | Ga0068867_100083776 | 3300005459 | Bacteria | 2407 |
| 75 | Ga0070685_10017695 | 3300005466 | Bacteria | 3819 |
| 76 | Ga0070685_10089744 | 3300005466 | Bacteria | 1858 |
| 77 | Ga0070706_100029357 | 3300005467 | Bacteria | 5067 |
| 78 | Ga0070706_100128581 | 3300005467 | Bacteria | 2363 |
| 79 | Ga0070707_100029417 | 3300005468 | Bacteria | 5230 |
| 80 | Ga0070698_100146751 | 3300005471 | Bacteria | 2308 |
| 81 | Ga0070698_100205329 | 3300005471 | Bacteria | 1905 |
| 82 | Ga0070699_100375959 | 3300005518 | Bacteria | 1282 |
| 83 | Ga0070679_100000940 | 3300005530 | Bacteria | 25317 |
| 84 | Ga0070679_100002624 | 3300005530 | Bacteria | 16355 |
| 85 | Ga0070679_100013713 | 3300005530 | Bacteria | 7764 |
| 86 | Ga0070679_100016000 | 3300005530 | Bacteria | 7224 |
| 87 | Ga0070679_100049944 | 3300005530 | Bacteria | 4166 |
| 88 | Ga0070679_100058934 | 3300005530 | Bacteria | 3827 |
| 89 | Ga0070679_100171118 | 3300005530 | Bacteria | 2145 |
| 90 | Ga0070684_100008121 | 3300005535 | Bacteria | 8192 |
| 91 | Ga0070684_100016538 | 3300005535 | Bacteria | 6030 |
| 92 | Ga0070684_100022918 | 3300005535 | Bacteria | 5215 |
| 93 | Ga0070684_100026145 | 3300005535 | Bacteria | 4914 |
| 94 | Ga0070684_100045645 | 3300005535 | Bacteria | 3794 |
| 95 | Ga0070684_100056307 | 3300005535 | Bacteria | 3431 |
| 96 | Ga0070684_100069933 | 3300005535 | Bacteria | 3087 |
| 97 | Ga0070684_100094815 | 3300005535 | Bacteria | 2659 |
| 98 | Ga0070684_100116562 | 3300005535 | Bacteria | 2399 |
| 99 | Ga0070684_100245940 | 3300005535 | Bacteria | 1635 |
| 100 | Ga0070684_100380168 | 3300005535 | Bacteria | 1301 |
| 101 | Ga0070672_100016872 | 3300005543 | Bacteria | 5239 |
| 102 | Ga0070672_100080441 | 3300005543 | Bacteria | 2611 |
| 103 | Ga0070696_100005390 | 3300005546 | Bacteria | 8531 |
| 104 | Ga0070696_100015929 | 3300005546 | Bacteria | 5055 |
| 105 | Ga0070665_100204588 | 3300005548 | Bacteria | 1975 |
| 106 | Ga0070665_100264590 | 3300005548 | Unclassified | 1721 |
| 107 | Ga0068855_100013870 | 3300005563 | Bacteria | 9718 |
| 108 | Ga0068855_100207602 | 3300005563 | Bacteria | 2203 |
| 109 | Ga0068855_100441238 | 3300005563 | Bacteria | 1422 |
| 110 | Ga0070664_100013127 | 3300005564 | Bacteria | 6743 |
| 111 | Ga0070664_100092758 | 3300005564 | Bacteria | 2615 |
| 112 | Ga0070664_100135355 | 3300005564 | Bacteria | 2166 |
| 113 | Ga0070664_100163564 | 3300005564 | Bacteria | 1970 |
| 114 | Ga0070664_100175397 | 3300005564 | Bacteria | 1903 |
| 115 | Ga0068857_100008501 | 3300005577 | Bacteria | 8875 |
| 116 | Ga0068857_100013444 | 3300005577 | Bacteria | 7131 |
| 117 | Ga0068857_100040907 | 3300005577 | Bacteria | 4109 |
| 118 | Ga0068857_100121082 | 3300005577 | Bacteria | 2356 |
| 119 | Ga0068854_100031306 | 3300005578 | Bacteria | 3696 |
| 120 | Ga0068854_100291151 | 3300005578 | Bacteria | 1318 |
| 121 | Ga0068856_100008186 | 3300005614 | Bacteria | 10194 |
| 122 | Ga0068856_100034774 | 3300005614 | Bacteria | 4937 |
| 123 | Ga0068856_100176153 | 3300005614 | Bacteria | 2151 |
| 124 | Ga0068856_100200303 | 3300005614 | Bacteria | 2011 |
| 125 | Ga0068852_100041149 | 3300005616 | Bacteria | 3903 |
| 126 | Ga0068852_100056074 | 3300005616 | Bacteria | 3403 |
| 127 | Ga0068852_100063876 | 3300005616 | Bacteria | 3207 |
| 128 | Ga0068859_100020877 | 3300005617 | Bacteria | 6573 |
| 129 | Ga0068859_100056249 | 3300005617 | Bacteria | 3958 |
| 130 | Ga0068864_100008979 | 3300005618 | Bacteria | 8243 |
| 131 | Ga0068864_100090837 | 3300005618 | Bacteria | 2693 |
| 132 | Ga0068866_10013526 | 3300005718 | Bacteria | 3584 |
| 133 | Ga0068861_100012315 | 3300005719 | Bacteria | 5965 |
| 134 | Ga0068851_10019465 | 3300005834 | Bacteria | 3280 |
| 135 | Ga0068870_10010164 | 3300005840 | Bacteria | 4309 |
| 136 | Ga0068870_10012345 | 3300005840 | Bacteria | 3990 |
| 137 | Ga0068870_10012484 | 3300005840 | Bacteria | 3972 |
| 138 | Ga0068870_10063097 | 3300005840 | Bacteria | 1997 |
| 139 | Ga0068870_10163537 | 3300005840 | Bacteria | 1322 |
| 140 | Ga0068863_100040124 | 3300005841 | Bacteria | 4451 |
| 141 | Ga0068863_100305094 | 3300005841 | Bacteria | 1545 |
| 142 | Ga0068858_100107302 | 3300005842 | Bacteria | 2606 |
| 143 | Ga0068858_100451767 | 3300005842 | Bacteria | 1238 |
| 144 | Ga0068860_100069019 | 3300005843 | Bacteria | 3359 |
| 145 | Ga0068862_100000513 | 3300005844 | Bacteria | 41174 |
| 146 | Ga0068862_100105087 | 3300005844 | Unclassified | 2475 |
| 147 | Ga0081539_10000174 | 3300005985 | Bacteria | 151265 |
| 148 | Ga0070717_10003227 | 3300006028 | Bacteria | 11644 |
| 149 | Ga0070717_10165301 | 3300006028 | Bacteria | 1922 |
| 150 | Ga0070712_100000729 | 3300006175 | Bacteria | 19393 |
| 151 | Ga0068871_100043477 | 3300006358 | Bacteria | 3608 |
| 152 | Ga0075430_100004889 | 3300006846 | Bacteria | 11276 |
| 153 | Ga0075430_100015467 | 3300006846 | Bacteria | 6495 |
| 154 | Ga0075430_100021793 | 3300006846 | Bacteria | 5446 |
| 155 | Ga0075430_100053013 | 3300006846 | Bacteria | 3415 |
| 156 | Ga0075430_100244046 | 3300006846 | Bacteria | 1488 |
| 157 | Ga0075431_100001756 | 3300006847 | Bacteria | 20399 |
| 158 | Ga0075431_100013780 | 3300006847 | Bacteria | 8165 |
| 159 | Ga0075431_100073766 | 3300006847 | Bacteria | 3521 |
| 160 | Ga0075434_100048454 | 3300006871 | Bacteria | 4216 |
| 161 | Ga0075429_100012636 | 3300006880 | Bacteria | 7322 |
| 162 | Ga0068865_100072567 | 3300006881 | Bacteria | 2445 |
| 163 | Ga0075436_100002168 | 3300006914 | Bacteria | 13526 |
| 164 | Ga0097620_100020878 | 3300006931 | Bacteria | 6573 |
| 165 | Ga0097620_100056249 | 3300006931 | Bacteria | 3958 |
| 166 | Ga0105240_10001786 | 3300009093 | Bacteria | 36277 |
| 167 | Ga0105240_10018268 | 3300009093 | Bacteria | 9426 |
| 168 | Ga0105240_10527918 | 3300009093 | Bacteria | 1309 |
| 169 | Ga0111539_10037513 | 3300009094 | Bacteria | 5850 |
| 170 | Ga0111539_10048767 | 3300009094 | Bacteria | 5054 |
| 171 | Ga0105245_10095260 | 3300009098 | Bacteria | 2746 |
| 172 | Ga0105245_10478892 | 3300009098 | Bacteria | 1258 |
| 173 | Ga0114129_10177230 | 3300009147 | Bacteria | 2903 |
| 174 | Ga0114129_10738944 | 3300009147 | Bacteria | 1261 |
| 175 | Ga0105243_10179084 | 3300009148 | Bacteria | 1842 |
| 176 | Ga0105241_10003130 | 3300009174 | Bacteria | 12313 |
| 177 | Ga0105242_10007016 | 3300009176 | Bacteria | 8697 |
| 178 | Ga0105242_10035562 | 3300009176 | Bacteria | 3993 |
| 179 | Ga0105248_10010770 | 3300009177 | Bacteria | 10095 |
| 180 | Ga0105248_10068953 | 3300009177 | Bacteria | 3970 |
| 181 | Ga0105248_10071471 | 3300009177 | Bacteria | 3898 |
| 182 | Ga0105248_10135631 | 3300009177 | Bacteria | 2776 |
| 183 | Ga0105248_10151299 | 3300009177 | Bacteria | 2618 |
| 184 | Ga0105237_10004438 | 3300009545 | Bacteria | 16252 |
| 185 | Ga0105237_10115057 | 3300009545 | Bacteria | 2683 |
| 186 | Ga0105238_10042389 | 3300009551 | Bacteria | 4609 |
| 187 | Ga0105249_10000251 | 3300009553 | Bacteria | 59080 |
| 188 | Ga0105249_10044399 | 3300009553 | Bacteria | 4041 |
| 189 | Ga0105246_10002700 | 3300011119 | Bacteria | 10741 |
| 190 | Ga0157373_10016174 | 3300013100 | Bacteria | 5445 |
| 191 | Ga0157373_10070660 | 3300013100 | Bacteria | 2467 |
| 192 | Ga0157371_10007718 | 3300013102 | Bacteria | 8651 |
| 193 | Ga0157371_10011433 | 3300013102 | Bacteria | 6839 |
| 194 | Ga0157371_10189813 | 3300013102 | Bacteria | 1471 |
| 195 | Ga0157370_10007065 | 3300013104 | Bacteria | 12262 |
| 196 | Ga0157370_10014177 | 3300013104 | Bacteria | 8171 |
| 197 | Ga0157370_10025875 | 3300013104 | Bacteria | 5803 |
| 198 | Ga0157370_10161439 | 3300013104 | Bacteria | 2085 |
| 199 | Ga0157369_10004783 | 3300013105 | Bacteria | 15917 |
| 200 | Ga0157369_10015607 | 3300013105 | Bacteria | 8560 |
| 201 | Ga0157369_10028114 | 3300013105 | Bacteria | 6225 |
| 202 | Ga0157369_10073946 | 3300013105 | Bacteria | 3655 |
| 203 | Ga0157369_10109713 | 3300013105 | Bacteria | 2933 |
| 204 | Ga0157369_10110302 | 3300013105 | Bacteria | 2925 |
| 205 | Ga0157369_10154196 | 3300013105 | Bacteria | 2427 |
| 206 | Ga0157374_10024820 | 3300013296 | Bacteria | 5376 |
| 207 | Ga0157374_10239765 | 3300013296 | Bacteria | 1783 |
| 208 | Ga0157378_10075869 | 3300013297 | Bacteria | 3028 |
| 209 | Ga0157378_10107328 | 3300013297 | Bacteria | 2555 |
| 210 | Ga0163162_10187794 | 3300013306 | Bacteria | 2194 |
| 211 | Ga0157372_10003638 | 3300013307 | Bacteria | 16590 |
| 212 | Ga0157372_10005371 | 3300013307 | Bacteria | 13618 |
| 213 | Ga0157372_10011940 | 3300013307 | Bacteria | 9255 |
| 214 | Ga0157372_10014215 | 3300013307 | Bacteria | 8507 |
| 215 | Ga0157372_10025243 | 3300013307 | Bacteria | 6460 |
| 216 | Ga0157372_10028700 | 3300013307 | Bacteria | 6074 |
| 217 | Ga0157372_10094480 | 3300013307 | Bacteria | 3405 |
| 218 | Ga0157372_10109733 | 3300013307 | Bacteria | 3160 |
| 219 | Ga0157372_10131041 | 3300013307 | Bacteria | 2885 |
| 220 | Ga0157372_10177663 | 3300013307 | Bacteria | 2464 |
| 221 | Ga0157375_10023763 | 3300013308 | Bacteria | 5663 |
| 222 | Ga0157375_10073656 | 3300013308 | Bacteria | 3435 |
| 223 | Ga0157375_10182494 | 3300013308 | Bacteria | 2251 |
| 224 | Ga0157375_10500040 | 3300013308 | Bacteria | 1380 |
| 225 | Ga0157375_10631634 | 3300013308 | Bacteria | 1228 |
| 226 | Ga0163163_10002771 | 3300014325 | Bacteria | 14797 |
| 227 | Ga0163163_10040544 | 3300014325 | Bacteria | 4547 |
| 228 | Ga0163163_10371975 | 3300014325 | Bacteria | 1486 |
| 229 | Ga0157380_10023530 | 3300014326 | Bacteria | 4648 |
| 230 | Ga0157377_10000361 | 3300014745 | Bacteria | 20302 |
| 231 | Ga0157379_10001669 | 3300014968 | Bacteria | 18349 |
| 232 | Ga0157376_10007918 | 3300014969 | Bacteria | 7625 |
| 233 | Ga0157376_10110333 | 3300014969 | Bacteria | 2420 |
| 234 | Ga0157376_10248369 | 3300014969 | Bacteria | 1661 |
| 235 | Ga0182007_10059774 | 3300015262 | Bacteria | 1249 |
| 236 | Ga0163161_10034811 | 3300017792 | Bacteria | 3603 |
| 237 | Ga0206356_11147558 | 3300020070 | Bacteria | 3033 |
| 238 | Ga0207682_10027922 | 3300025893 | Bacteria | 2249 |
| 239 | Ga0207688_10107937 | 3300025901 | Bacteria | 1613 |
| 240 | Ga0207680_10182171 | 3300025903 | Bacteria | 1421 |
| 241 | Ga0207699_10037618 | 3300025906 | Bacteria | 2768 |
| 242 | Ga0207699_10041085 | 3300025906 | Bacteria | 2669 |
| 243 | Ga0207645_10048955 | 3300025907 | Bacteria | 2699 |
| 244 | Ga0207645_10062675 | 3300025907 | Bacteria | 2376 |
| 245 | Ga0207645_10071034 | 3300025907 | Bacteria | 2228 |
| 246 | Ga0207643_10002389 | 3300025908 | Bacteria | 10186 |
| 247 | Ga0207643_10003121 | 3300025908 | Bacteria | 8913 |
| 248 | Ga0207643_10038298 | 3300025908 | Unclassified | 2693 |
| 249 | Ga0207643_10140316 | 3300025908 | Bacteria | 1443 |
| 250 | Ga0207705_10006635 | 3300025909 | Bacteria | 8566 |
| 251 | Ga0207705_10029168 | 3300025909 | Bacteria | 3933 |
| 252 | Ga0207705_10070941 | 3300025909 | Bacteria | 2525 |
| 253 | Ga0207684_10036904 | 3300025910 | Bacteria | 4148 |
| 254 | Ga0207684_10089310 | 3300025910 | Bacteria | 2626 |
| 255 | Ga0207707_10001274 | 3300025912 | Bacteria | 23506 |
| 256 | Ga0207707_10003913 | 3300025912 | Bacteria | 13215 |
| 257 | Ga0207707_10004622 | 3300025912 | Bacteria | 12092 |
| 258 | Ga0207707_10015537 | 3300025912 | Bacteria | 6630 |
| 259 | Ga0207707_10019956 | 3300025912 | Bacteria | 5849 |
| 260 | Ga0207707_10024036 | 3300025912 | Bacteria | 5328 |
| 261 | Ga0207707_10032322 | 3300025912 | Bacteria | 4579 |
| 262 | Ga0207707_10034709 | 3300025912 | Bacteria | 4413 |
| 263 | Ga0207707_10036663 | 3300025912 | Bacteria | 4286 |
| 264 | Ga0207707_10042475 | 3300025912 | Bacteria | 3967 |
| 265 | Ga0207695_10004134 | 3300025913 | Bacteria | 19930 |
| 266 | Ga0207695_10017490 | 3300025913 | Bacteria | 8341 |
| 267 | Ga0207695_10022295 | 3300025913 | Bacteria | 7196 |
| 268 | Ga0207695_10296659 | 3300025913 | Bacteria | 1508 |
| 269 | Ga0207695_10309910 | 3300025913 | Bacteria | 1469 |
| 270 | Ga0207695_10369543 | 3300025913 | Bacteria | 1320 |
| 271 | Ga0207671_10042557 | 3300025914 | Bacteria | 3361 |
| 272 | Ga0207671_10106249 | 3300025914 | Bacteria | 2131 |
| 273 | Ga0207693_10009781 | 3300025915 | Bacteria | 7807 |
| 274 | Ga0207693_10124994 | 3300025915 | Bacteria | 2021 |
| 275 | Ga0207660_10003457 | 3300025917 | Bacteria | 10302 |
| 276 | Ga0207660_10005979 | 3300025917 | Bacteria | 7902 |
| 277 | Ga0207660_10026731 | 3300025917 | Bacteria | 3932 |
| 278 | Ga0207660_10027935 | 3300025917 | Bacteria | 3856 |
| 279 | Ga0207660_10028418 | 3300025917 | Bacteria | 3825 |
| 280 | Ga0207660_10034422 | 3300025917 | Bacteria | 3512 |
| 281 | Ga0207660_10039964 | 3300025917 | Bacteria | 3281 |
| 282 | Ga0207660_10162998 | 3300025917 | Bacteria | 1721 |
| 283 | Ga0207660_10277457 | 3300025917 | Bacteria | 1329 |
| 284 | Ga0207662_10002218 | 3300025918 | Bacteria | 9686 |
| 285 | Ga0207662_10010164 | 3300025918 | Bacteria | 5188 |
| 286 | Ga0207657_10030969 | 3300025919 | Bacteria | 4850 |
| 287 | Ga0207657_10031470 | 3300025919 | Bacteria | 4805 |
| 288 | Ga0207657_10059737 | 3300025919 | Bacteria | 3274 |
| 289 | Ga0207657_10116369 | 3300025919 | Bacteria | 2203 |
| 290 | Ga0207652_10000636 | 3300025921 | Bacteria | 34690 |
| 291 | Ga0207652_10002058 | 3300025921 | Bacteria | 17320 |
| 292 | Ga0207652_10003798 | 3300025921 | Bacteria | 12383 |
| 293 | Ga0207652_10010341 | 3300025921 | Bacteria | 7516 |
| 294 | Ga0207652_10033953 | 3300025921 | Bacteria | 4297 |
| 295 | Ga0207652_10035111 | 3300025921 | Bacteria | 4230 |
| 296 | Ga0207652_10112280 | 3300025921 | Bacteria | 2418 |
| 297 | Ga0207652_10141794 | 3300025921 | Bacteria | 2149 |
| 298 | Ga0207652_10177064 | 3300025921 | Bacteria | 1915 |
| 299 | Ga0207646_10035542 | 3300025922 | Bacteria | 4500 |
| 300 | Ga0207681_10001166 | 3300025923 | Bacteria | 16947 |
| 301 | Ga0207681_10032103 | 3300025923 | Bacteria | 3436 |
| 302 | Ga0207681_10077594 | 3300025923 | Bacteria | 2336 |
| 303 | Ga0207694_10127219 | 3300025924 | Bacteria | 2040 |
| 304 | Ga0207650_10020901 | 3300025925 | Bacteria | 4624 |
| 305 | Ga0207650_10200054 | 3300025925 | Bacteria | 1600 |
| 306 | Ga0207659_10006490 | 3300025926 | Bacteria | 7168 |
| 307 | Ga0207659_10054273 | 3300025926 | Bacteria | 2862 |
| 308 | Ga0207659_10100729 | 3300025926 | Bacteria | 2177 |
| 309 | Ga0207687_10002512 | 3300025927 | Bacteria | 12443 |
| 310 | Ga0207700_10001579 | 3300025928 | Bacteria | 12936 |
| 311 | Ga0207700_10063341 | 3300025928 | Bacteria | 2812 |
| 312 | Ga0207664_10033723 | 3300025929 | Bacteria | 3936 |
| 313 | Ga0207664_10040806 | 3300025929 | Bacteria | 3612 |
| 314 | Ga0207644_10046697 | 3300025931 | Bacteria | 3087 |
| 315 | Ga0207690_10003410 | 3300025932 | Bacteria | 9488 |
| 316 | Ga0207706_10006192 | 3300025933 | Bacteria | 11114 |
| 317 | Ga0207706_10122547 | 3300025933 | Bacteria | 2287 |
| 318 | Ga0207706_10216576 | 3300025933 | Bacteria | 1677 |
| 319 | Ga0207706_10257060 | 3300025933 | Bacteria | 1525 |
| 320 | Ga0207709_10108714 | 3300025935 | Bacteria | 1849 |
| 321 | Ga0207669_10013126 | 3300025937 | Bacteria | 4103 |
| 322 | Ga0207704_10019217 | 3300025938 | Bacteria | 3584 |
| 323 | Ga0207691_10016638 | 3300025940 | Bacteria | 6983 |
| 324 | Ga0207691_10018984 | 3300025940 | Bacteria | 6512 |
| 325 | Ga0207691_10026902 | 3300025940 | Bacteria | 5397 |
| 326 | Ga0207691_10030149 | 3300025940 | Bacteria | 5070 |
| 327 | Ga0207711_10021340 | 3300025941 | Bacteria | 5411 |
| 328 | Ga0207711_10235955 | 3300025941 | Bacteria | 1676 |
| 329 | Ga0207689_10003321 | 3300025942 | Bacteria | 14722 |
| 330 | Ga0207689_10044160 | 3300025942 | Bacteria | 3684 |
| 331 | Ga0207661_10002251 | 3300025944 | Bacteria | 13303 |
| 332 | Ga0207661_10011779 | 3300025944 | Bacteria | 6350 |
| 333 | Ga0207661_10028981 | 3300025944 | Bacteria | 4247 |
| 334 | Ga0207661_10034946 | 3300025944 | Bacteria | 3913 |
| 335 | Ga0207661_10037775 | 3300025944 | Bacteria | 3779 |
| 336 | Ga0207661_10053505 | 3300025944 | Bacteria | 3230 |
| 337 | Ga0207661_10100013 | 3300025944 | Bacteria | 2433 |
| 338 | Ga0207661_10166175 | 3300025944 | Bacteria | 1918 |
| 339 | Ga0207661_10203919 | 3300025944 | Bacteria | 1740 |
| 340 | Ga0207661_10231465 | 3300025944 | Bacteria | 1636 |
| 341 | Ga0207661_10307475 | 3300025944 | Bacteria | 1422 |
| 342 | Ga0207679_10009151 | 3300025945 | Bacteria | 6333 |
| 343 | Ga0207679_10044518 | 3300025945 | Bacteria | 3203 |
| 344 | Ga0207679_10129184 | 3300025945 | Bacteria | 2024 |
| 345 | Ga0207712_10001263 | 3300025961 | Bacteria | 17420 |
| 346 | Ga0207712_10004110 | 3300025961 | Bacteria | 9189 |
| 347 | Ga0207668_10019443 | 3300025972 | Bacteria | 4294 |
| 348 | Ga0207668_10027847 | 3300025972 | Bacteria | 3686 |
| 349 | Ga0207668_10055322 | 3300025972 | Bacteria | 2758 |
| 350 | Ga0207658_10050495 | 3300025986 | Bacteria | 3061 |
| 351 | Ga0207639_10221437 | 3300026041 | Bacteria | 1634 |
| 352 | Ga0207708_10122013 | 3300026075 | Bacteria | 2031 |
| 353 | Ga0207702_10006369 | 3300026078 | Bacteria | 10188 |
| 354 | Ga0207702_10082598 | 3300026078 | Bacteria | 2794 |
| 355 | Ga0207641_10129055 | 3300026088 | Bacteria | 2267 |
| 356 | Ga0207641_10234572 | 3300026088 | Bacteria | 1707 |
| 357 | Ga0207648_10003275 | 3300026089 | Bacteria | 17030 |
| 358 | Ga0207648_10037599 | 3300026089 | Bacteria | 4265 |
| 359 | Ga0207676_10032435 | 3300026095 | Bacteria | 3936 |
| 360 | Ga0207674_10000120 | 3300026116 | Bacteria | 91883 |
| 361 | Ga0207674_10022748 | 3300026116 | Bacteria | 6726 |
| 362 | Ga0207674_10084352 | 3300026116 | Bacteria | 3175 |
| 363 | Ga0207674_10131472 | 3300026116 | Bacteria | 2466 |
| 364 | Ga0207698_10004081 | 3300026142 | Bacteria | 8866 |
| 365 | Ga0207698_10046074 | 3300026142 | Bacteria | 3290 |
| 366 | Ga0207698_10048475 | 3300026142 | Bacteria | 3225 |
| 367 | Ga0207428_10037258 | 3300027907 | Bacteria | 3958 |
| 368 | Ga0268265_10001595 | 3300028380 | Bacteria | 18725 |
| 369 | Ga0268265_10029086 | 3300028380 | Bacteria | 3963 |
| 370 | Ga0268264_10187788 | 3300028381 | Unclassified | 1881 |
| 371 | Ga0307408_100007743 | 3300031548 | Bacteria | 7105 |
| 372 | Ga0307408_100041290 | 3300031548 | Bacteria | 3270 |
| 373 | Ga0307405_10005306 | 3300031731 | Bacteria | 6200 |
| 374 | Ga0307405_10006690 | 3300031731 | Bacteria | 5693 |
| 375 | Ga0307410_10100626 | 3300031852 | Bacteria | 2071 |
| 376 | Ga0307406_10021245 | 3300031901 | Bacteria | 3837 |
| 377 | Ga0307407_10006838 | 3300031903 | Bacteria | 5113 |
| 378 | Ga0307407_10019916 | 3300031903 | Bacteria | 3424 |
| 379 | Ga0307412_10137685 | 3300031911 | Bacteria | 1783 |
| 380 | Ga0307409_100002209 | 3300031995 | Bacteria | 10056 |
| 381 | Ga0307409_100023682 | 3300031995 | Bacteria | 4262 |
| 382 | Ga0307409_100065563 | 3300031995 | Bacteria | 2858 |
| 383 | Ga0307416_100018746 | 3300032002 | Bacteria | 4886 |
| 384 | Ga0307416_100026641 | 3300032002 | Bacteria | 4263 |
| 385 | Ga0307416_100038762 | 3300032002 | Bacteria | 3679 |
| 386 | Ga0307416_100195182 | 3300032002 | Bacteria | 1914 |
| 387 | Ga0307416_100224637 | 3300032002 | Bacteria | 1804 |
| 388 | Ga0307414_10005718 | 3300032004 | Bacteria | 6870 |
| 389 | Ga0307414_10038033 | 3300032004 | Bacteria | 3227 |
| 390 | Ga0307411_10159814 | 3300032005 | Bacteria | 1686 |
| 391 | Ga0307411_10420757 | 3300032005 | Bacteria | 1110 |
| 392 | Ga0307415_100001449 | 3300032126 | Bacteria | 11366 |
| 393 | Ga0373926_0000847 | 3300035083 | Bacteria | 8715 |
| 394 | Ga0373934_0000268 | 3300035086 | Bacteria | 18711 |
| 395 | Ga0373923_0004528 | 3300035111 | Bacteria | 4622 |
| 396 | Ga0373923_0052600 | 3300035111 | Bacteria | 1711 |
| 397 | Ga0373953_0006058 | 3300035117 | Bacteria | 3964 |
| 398 | Ga0373953_0023500 | 3300035117 | Bacteria | 2334 |
| 399 | Ga0373954_0012964 | 3300035118 | Bacteria | 3712 |
| 400 | Ga0373956_0001288 | 3300035119 | Bacteria | 10379 |
| 401 | Ga0373946_0019839 | 3300035171 | Bacteria | 2593 |
| 402 | Ga0373955_0009843 | 3300035172 | Bacteria | 4496 |
| 403 | Ga0373955_0022976 | 3300035172 | Bacteria | 3171 |
| 404 | Ga0373955_0028183 | 3300035172 | Bacteria | 2910 |
| 405 | Ga0373935_0000326 | 3300035692 | Bacteria | 23943 |
| 406 | Ga0373927_0005297 | 3300035695 | Bacteria | 8910 |
| 407 | Ga0373933_0000033 | 3300035724 | Bacteria | 84415 |
| 408 | Ga0373933_0052222 | 3300035724 | Bacteria | 2445 |
| 409 | Ga0373947_0001264 | 3300035725 | Bacteria | 15571 |
| 410 | Ga0373937_0000158 | 3300036401 | Bacteria | 65505 |
| 411 | Ga0373937_0001025 | 3300036401 | Bacteria | 23637 |
| 412 | Ga0373937_0086795 | 3300036401 | Bacteria | 2895 |
| 413 | Ga0373925_0000986 | 3300037068 | Bacteria | 25937 |
| 414 | Ga0395898_0157387 | 3300037466 | Bacteria | 2173 |
| 415 | Ga0395905_0012027 | 3300037471 | Bacteria | 8346 |
| 416 | Ga0395905_0025986 | 3300037471 | Bacteria | 5521 |
| 417 | Ga0395901_0012275 | 3300038443 | Bacteria | 8694 |
| 418 | Ga0450896_004842 | 3300042133 | Bacteria | 1831 |
| 419 | Ga0451577_0000005 | 3300042876 | Bacteria | 712599 |
| 420 | Ga0466969_0108285 | 3300044656 | Bacteria | 1303 |
| 421 | Ga0466966_0129945 | 3300044684 | Bacteria | 1543 |
| 422 | Ga0466959_0017315 | 3300045049 | Bacteria | 5281 |
| 423 | Ga0466967_0025650 | 3300045976 | Bacteria | 4864 |
| 424 | Ga0466967_0235142 | 3300045976 | Bacteria | 1746 |
| 425 | Ga0495603_0016958 | 3300046455 | Bacteria | 4407 |
| 426 | Ga0495629_0003679 | 3300046459 | Bacteria | 11589 |
| 427 | Ga0495629_0045502 | 3300046459 | Bacteria | 3079 |
| 428 | Ga0495629_0100630 | 3300046459 | Bacteria | 2017 |
| 429 | Ga0495651_0000572 | 3300046462 | Bacteria | 28583 |
| 430 | Ga0495651_0004202 | 3300046462 | Bacteria | 11032 |
| 431 | Ga0495651_0035342 | 3300046462 | Bacteria | 3891 |
| 432 | Ga0495653_0000173 | 3300046463 | Bacteria | 53365 |
| 433 | Ga0495653_0014450 | 3300046463 | Bacteria | 6442 |
| 434 | Ga0495580_0006012 | 3300046472 | Bacteria | 9936 |
| 435 | Ga0495580_0038935 | 3300046472 | Bacteria | 3402 |
| 436 | Ga0495582_0008481 | 3300046473 | Bacteria | 5670 |
| 437 | Ga0495662_0040127 | 3300046476 | Bacteria | 2261 |
| 438 | Ga0495664_0013973 | 3300046477 | Bacteria | 4549 |
| 439 | Ga0495594_0012106 | 3300046499 | Bacteria | 4491 |
| 440 | Ga0495594_0043959 | 3300046499 | Bacteria | 2450 |
| 441 | Ga0495594_0139221 | 3300046499 | Bacteria | 1376 |
| 442 | Ga0495608_0000418 | 3300046511 | Bacteria | 29615 |
| 443 | Ga0495618_0069736 | 3300046514 | Bacteria | 2235 |
| 444 | Ga0495628_0000467 | 3300046516 | Bacteria | 37087 |
| 445 | Ga0495628_0091911 | 3300046516 | Bacteria | 2348 |
| 446 | Ga0495630_0001246 | 3300046517 | Bacteria | 17578 |
| 447 | Ga0495630_0079628 | 3300046517 | Bacteria | 2471 |
| 448 | Ga0495652_0000658 | 3300046529 | Bacteria | 40060 |
| 449 | Ga0495652_0002827 | 3300046529 | Bacteria | 17480 |
| 450 | Ga0495665_0000327 | 3300046531 | Bacteria | 24173 |
| 451 | Ga0495587_0000247 | 3300046536 | Bacteria | 39646 |
| 452 | Ga0495587_0003466 | 3300046536 | Bacteria | 10506 |
| 453 | Ga0495587_0010322 | 3300046536 | Bacteria | 5951 |
| 454 | Ga0495645_0000210 | 3300046543 | Bacteria | 41882 |
| 455 | Ga0495645_0005284 | 3300046543 | Bacteria | 8846 |
| 456 | Ga0495645_0022315 | 3300046543 | Bacteria | 4578 |
| 457 | Ga0495645_0051695 | 3300046543 | Bacteria | 2989 |
| 458 | Ga0495667_0004730 | 3300046559 | Bacteria | 9204 |
| 459 | Ga0495634_0057120 | 3300046642 | Bacteria | 2606 |
| 460 | Ga0495635_0000157 | 3300046663 | Bacteria | 41636 |
| 461 | Ga0495635_0068088 | 3300046663 | Bacteria | 2442 |
| 462 | Ga0495588_0001152 | 3300046674 | Bacteria | 11358 |
| 463 | Ga0495657_0008627 | 3300046675 | Bacteria | 7779 |
| 464 | Ga0495599_0000858 | 3300046678 | Bacteria | 16995 |
| 465 | Ga0495599_0014299 | 3300046678 | Bacteria | 4915 |
| 466 | Ga0495599_0030779 | 3300046678 | Bacteria | 3369 |
| 467 | Ga0495623_0000014 | 3300046679 | Bacteria | 119814 |
| 468 | Ga0495623_0001143 | 3300046679 | Bacteria | 17950 |
| 469 | Ga0495646_0040531 | 3300046680 | Bacteria | 2867 |
| 470 | Ga0495658_0000573 | 3300046683 | Bacteria | 20062 |
| 471 | Ga0495613_0124651 | 3300046689 | Bacteria | 1848 |
| 472 | Ga0495600_0000105 | 3300046809 | Bacteria | 46401 |
| 473 | Ga0495581_0000150 | 3300047315 | Bacteria | 30837 |
| 474 | Ga0495581_0023496 | 3300047315 | Bacteria | 3572 |
| 475 | Ga0495604_0002679 | 3300047317 | Bacteria | 14280 |
| 476 | Ga0495604_0208938 | 3300047317 | Bacteria | 1350 |
| 477 | Ga0495674_0005036 | 3300047319 | Bacteria | 12709 |
| 478 | Ga0495672_0003097 | 3300047320 | Bacteria | 14528 |
| 479 | Ga0495680_0001244 | 3300047322 | Bacteria | 27949 |
| 480 | Ga0495675_0021362 | 3300047444 | Bacteria | 4121 |
| 481 | Ga0495675_0043803 | 3300047444 | Bacteria | 2851 |
| 482 | Ga0495675_0083758 | 3300047444 | Unclassified | 2007 |
| 483 | Ga0495684_0003598 | 3300047471 | Bacteria | 12086 |
| 484 | Ga0495593_0000112 | 3300047673 | Bacteria | 38250 |
| 485 | Ga0495602_0003519 | 3300048088 | Bacteria | 16197 |
| 486 | Ga0495602_0034625 | 3300048088 | Bacteria | 4722 |
| 487 | Ga0495602_0146808 | 3300048088 | Bacteria | 1859 |
| 488 | Ga0495614_0000021 | 3300048089 | Bacteria | 45062 |
| 489 | Ga0496105_0113580 | 3300048908 | Bacteria | 2235 |
| 490 | Ga0496106_0137953 | 3300048909 | Bacteria | 1917 |
| 491 | Ga0496108_0082404 | 3300048911 | Bacteria | 2728 |
| 492 | Ga0496109_0007143 | 3300048912 | Bacteria | 9436 |
| 493 | Ga0496112_0025310 | 3300048915 | Bacteria | 5698 |
| 494 | Ga0496112_0050523 | 3300048915 | Bacteria | 4078 |
| 495 | Ga0496112_0158895 | 3300048915 | Bacteria | 2227 |
| 496 | Ga0496113_0017414 | 3300048916 | Bacteria | 4987 |
| 497 | Ga0496114_0118358 | 3300048917 | Bacteria | 2276 |
| 498 | Ga0496115_0003186 | 3300048918 | Bacteria | 11790 |
| 499 | Ga0501031_0036006 | 3300049568 | Bacteria | 3228 |
| 500 | Ga0501033_0006024 | 3300049570 | Bacteria | 9512 |
| 501 | Ga0501034_0281481 | 3300049571 | Bacteria | 1602 |
| 502 | Ga0501034_0315844 | 3300049571 | Bacteria | 1496 |
| 503 | Ga0501036_0168888 | 3300049572 | Bacteria | 1843 |
| 504 | Ga0501038_0032379 | 3300049574 | Bacteria | 4613 |
| 505 | Ga0501038_0300825 | 3300049574 | Bacteria | 1259 |
| 506 | Ga0501047_0067420 | 3300049581 | Bacteria | 3449 |
| 507 | Ga0501080_0178552 | 3300049742 | Bacteria | 1955 |
| 508 | Ga0501035_0203895 | 3300049822 | Bacteria | 1695 |
| 509 | Ga0501035_0221324 | 3300049822 | Bacteria | 1616 |
| 510 | Ga0501045_0009542 | 3300049824 | Bacteria | 6790 |
| 511 | nmdc:mga05p37_116123_c1 | 3300050507 | Bacteria | 3289 |
| 512 | nmdc:mga0qj67_149950_c1 | 3300050509 | Bacteria | 1892 |
| 513 | nmdc:mga0qj67_27546_c1 | 3300050509 | Bacteria | 4406 |
| 514 | nmdc:mga0qj67_303753_c1 | 3300050509 | Bacteria | 1293 |
| 515 | nmdc:mga0qj67_3307_c1 | 3300050509 | Bacteria | 11613 |
| 516 | nmdc:mga0qj67_42956_c1 | 3300050509 | Bacteria | 3560 |
| 517 | nmdc:mga06r32_36854_c1 | 3300050510 | Bacteria | 4625 |
| 518 | nmdc:mga06r32_57724_c1 | 3300050510 | Bacteria | 3729 |
| 519 | nmdc:mga08y16_47765_c1 | 3300050511 | Bacteria | 4480 |
| 520 | nmdc:mga0rr50_98846_c1 | 3300050513 | Bacteria | 2288 |
| 521 | nmdc:mga08x19_6841_c1 | 3300050514 | Bacteria | 6773 |
| 522 | Ga0495612_0004210 | 3300053078 | Bacteria | 5966 |
| 523 | Ga0495619_0003661 | 3300053085 | Bacteria | 9906 |
| 524 | Ga0501084_0183129 | 3300054114 | Bacteria | 1768 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035171 | Ga0373946_0019839 | Ga0373946_0019839_1534_2574 | 320 |
| 2 | 3300005530 | Ga0070679_100013713 | Ga0070679_1000137132 | 329 |
| 3 | 3300025921 | Ga0207652_10010341 | Ga0207652_100103416 | 329 |
| 4 | 3300044684 | Ga0466966_0129945 | Ga0466966_0129945_152_1174 | 330 |
| 5 | 3300025921 | Ga0207652_10002058 | Ga0207652_1000205812 | 334 |
| 6 | 3300009093 | Ga0105240_10001786 | Ga0105240_100017863 | 335 |
| 7 | 3300013104 | Ga0157370_10025875 | Ga0157370_100258752 | 335 |
| 8 | 3300013307 | Ga0157372_10131041 | Ga0157372_101310412 | 335 |
| 9 | 3300013308 | Ga0157375_10023763 | Ga0157375_100237633 | 335 |
| 10 | 3300042876 | Ga0451577_0000005 | Ga0451577_0000005_64868_65893 | 335 |
| 11 | 3300045976 | Ga0466967_0235142 | Ga0466967_0235142_364_1449 | 335 |
| 12 | 3300009093 | Ga0105240_10527918 | Ga0105240_105279181 | 336 |
| 13 | 3300009545 | Ga0105237_10004438 | Ga0105237_100044382 | 336 |
| 14 | 3300014969 | Ga0157376_10110333 | Ga0157376_101103332 | 336 |
| 15 | 3300025913 | Ga0207695_10369543 | Ga0207695_103695431 | 336 |
| 16 | 3300025914 | Ga0207671_10106249 | Ga0207671_101062492 | 336 |
| 17 | 3300005535 | Ga0070684_100008121 | Ga0070684_1000081215 | 338 |
| 18 | 3300005578 | Ga0068854_100031306 | Ga0068854_1000313062 | 338 |
| 19 | 3300005327 | Ga0070658_10001483 | Ga0070658_100014834 | 339 |
| 20 | 3300025909 | Ga0207705_10029168 | Ga0207705_100291684 | 339 |
| 21 | 3300025917 | Ga0207660_10034422 | Ga0207660_100344222 | 339 |
| 22 | 3300025919 | Ga0207657_10031470 | Ga0207657_100314704 | 339 |
| 23 | 3300025944 | Ga0207661_10231465 | Ga0207661_102314651 | 339 |
| 24 | 3300026041 | Ga0207639_10221437 | Ga0207639_102214372 | 339 |
| 25 | 3300005336 | Ga0070680_100192134 | Ga0070680_1001921341 | 340 |
| 26 | 3300025912 | Ga0207707_10032322 | Ga0207707_100323224 | 341 |
| 27 | 3300025917 | Ga0207660_10005979 | Ga0207660_100059794 | 341 |
| 28 | 3300005344 | Ga0070661_100020906 | Ga0070661_1000209064 | 342 |
| 29 | 3300005546 | Ga0070696_100015929 | Ga0070696_1000159294 | 342 |
| 30 | 3300013104 | Ga0157370_10161439 | Ga0157370_101614392 | 342 |
| 31 | 3300013105 | Ga0157369_10073946 | Ga0157369_100739464 | 342 |
| 32 | 3300025913 | Ga0207695_10004134 | Ga0207695_1000413416 | 342 |
| 33 | 3300025919 | Ga0207657_10116369 | Ga0207657_101163692 | 342 |
| 34 | 3300005434 | Ga0070709_10020880 | Ga0070709_100208803 | 343 |
| 35 | 3300005439 | Ga0070711_100051785 | Ga0070711_1000517853 | 343 |
| 36 | 3300005445 | Ga0070708_100000045 | Ga0070708_10000004533 | 343 |
| 37 | 3300005467 | Ga0070706_100029357 | Ga0070706_1000293574 | 343 |
| 38 | 3300005468 | Ga0070707_100029417 | Ga0070707_1000294173 | 343 |
| 39 | 3300005563 | Ga0068855_100207602 | Ga0068855_1002076021 | 343 |
| 40 | 3300005578 | Ga0068854_100291151 | Ga0068854_1002911512 | 343 |
| 41 | 3300025910 | Ga0207684_10089310 | Ga0207684_100893102 | 343 |
| 42 | 3300025912 | Ga0207707_10024036 | Ga0207707_100240361 | 343 |
| 43 | 3300025913 | Ga0207695_10022295 | Ga0207695_100222953 | 343 |
| 44 | 3300025917 | Ga0207660_10027935 | Ga0207660_100279352 | 343 |
| 45 | 3300025922 | Ga0207646_10035542 | Ga0207646_100355422 | 343 |
| 46 | 3300026078 | Ga0207702_10082598 | Ga0207702_100825982 | 343 |
| 47 | 3300050514 | nmdc:mga08x19_6841_c1 | nmdc:mga08x19_6841_c1_2048_3139 | 343 |
| 48 | 3300005329 | Ga0070683_100001197 | Ga0070683_10000119710 | 344 |
| 49 | 3300005329 | Ga0070683_100026676 | Ga0070683_1000266761 | 344 |
| 50 | 3300005330 | Ga0070690_100105005 | Ga0070690_1001050052 | 344 |
| 51 | 3300005335 | Ga0070666_10190707 | Ga0070666_101907072 | 344 |
| 52 | 3300005336 | Ga0070680_100001664 | Ga0070680_1000016643 | 344 |
| 53 | 3300005336 | Ga0070680_100029579 | Ga0070680_1000295792 | 344 |
| 54 | 3300005336 | Ga0070680_100124753 | Ga0070680_1001247532 | 344 |
| 55 | 3300005340 | Ga0070689_100128978 | Ga0070689_1001289782 | 344 |
| 56 | 3300005343 | Ga0070687_100024037 | Ga0070687_1000240372 | 344 |
| 57 | 3300005364 | Ga0070673_100178888 | Ga0070673_1001788881 | 344 |
| 58 | 3300005365 | Ga0070688_100008049 | Ga0070688_1000080492 | 344 |
| 59 | 3300005458 | Ga0070681_10000537 | Ga0070681_100005375 | 344 |
| 60 | 3300005458 | Ga0070681_10013515 | Ga0070681_100135153 | 344 |
| 61 | 3300005466 | Ga0070685_10017695 | Ga0070685_100176953 | 344 |
| 62 | 3300005530 | Ga0070679_100016000 | Ga0070679_1000160004 | 344 |
| 63 | 3300005530 | Ga0070679_100058934 | Ga0070679_1000589343 | 344 |
| 64 | 3300005535 | Ga0070684_100016538 | Ga0070684_1000165386 | 344 |
| 65 | 3300005535 | Ga0070684_100056307 | Ga0070684_1000563072 | 344 |
| 66 | 3300005535 | Ga0070684_100069933 | Ga0070684_1000699332 | 344 |
| 67 | 3300005543 | Ga0070672_100080441 | Ga0070672_1000804412 | 344 |
| 68 | 3300005563 | Ga0068855_100013870 | Ga0068855_1000138709 | 344 |
| 69 | 3300005564 | Ga0070664_100163564 | Ga0070664_1001635642 | 344 |
| 70 | 3300005577 | Ga0068857_100121082 | Ga0068857_1001210822 | 344 |
| 71 | 3300005616 | Ga0068852_100063876 | Ga0068852_1000638761 | 344 |
| 72 | 3300005617 | Ga0068859_100056249 | Ga0068859_1000562494 | 344 |
| 73 | 3300005840 | Ga0068870_10012345 | Ga0068870_100123453 | 344 |
| 74 | 3300006931 | Ga0097620_100056249 | Ga0097620_1000562494 | 344 |
| 75 | 3300009177 | Ga0105248_10068953 | Ga0105248_100689532 | 344 |
| 76 | 3300009553 | Ga0105249_10044399 | Ga0105249_100443992 | 344 |
| 77 | 3300013104 | Ga0157370_10007065 | Ga0157370_100070658 | 344 |
| 78 | 3300013105 | Ga0157369_10154196 | Ga0157369_101541962 | 344 |
| 79 | 3300013307 | Ga0157372_10011940 | Ga0157372_100119407 | 344 |
| 80 | 3300013308 | Ga0157375_10182494 | Ga0157375_101824942 | 344 |
| 81 | 3300025901 | Ga0207688_10107937 | Ga0207688_101079372 | 344 |
| 82 | 3300025907 | Ga0207645_10062675 | Ga0207645_100626752 | 344 |
| 83 | 3300025912 | Ga0207707_10004622 | Ga0207707_100046226 | 344 |
| 84 | 3300025913 | Ga0207695_10017490 | Ga0207695_100174905 | 344 |
| 85 | 3300025913 | Ga0207695_10296659 | Ga0207695_102966592 | 344 |
| 86 | 3300025917 | Ga0207660_10003457 | Ga0207660_1000345711 | 344 |
| 87 | 3300025917 | Ga0207660_10026731 | Ga0207660_100267314 | 344 |
| 88 | 3300025917 | Ga0207660_10277457 | Ga0207660_102774571 | 344 |
| 89 | 3300025918 | Ga0207662_10010164 | Ga0207662_100101642 | 344 |
| 90 | 3300025921 | Ga0207652_10000636 | Ga0207652_100006362 | 344 |
| 91 | 3300025926 | Ga0207659_10100729 | Ga0207659_101007291 | 344 |
| 92 | 3300025940 | Ga0207691_10026902 | Ga0207691_100269022 | 344 |
| 93 | 3300025942 | Ga0207689_10044160 | Ga0207689_100441603 | 344 |
| 94 | 3300025944 | Ga0207661_10002251 | Ga0207661_100022511 | 344 |
| 95 | 3300025944 | Ga0207661_10011779 | Ga0207661_100117794 | 344 |
| 96 | 3300025944 | Ga0207661_10037775 | Ga0207661_100377753 | 344 |
| 97 | 3300025944 | Ga0207661_10053505 | Ga0207661_100535052 | 344 |
| 98 | 3300025972 | Ga0207668_10055322 | Ga0207668_100553222 | 344 |
| 99 | 3300026116 | Ga0207674_10084352 | Ga0207674_100843523 | 344 |
| 100 | 3300026142 | Ga0207698_10046074 | Ga0207698_100460742 | 344 |
| 101 | 3300028380 | Ga0268265_10029086 | Ga0268265_100290863 | 344 |
| 102 | 3300028381 | Ga0268264_10187788 | Ga0268264_101877882 | 344 |
| 103 | 3300035172 | Ga0373955_0028183 | Ga0373955_0028183_1635_2702 | 344 |
| 104 | 3300036401 | Ga0373937_0001025 | Ga0373937_0001025_6079_7146 | 344 |
| 105 | 3300045976 | Ga0466967_0025650 | Ga0466967_0025650_365_1435 | 344 |
| 106 | 3300046462 | Ga0495651_0035342 | Ga0495651_0035342_2612_3679 | 344 |
| 107 | 3300046499 | Ga0495594_0012106 | Ga0495594_0012106_1716_2783 | 344 |
| 108 | 3300046499 | Ga0495594_0043959 | Ga0495594_0043959_1367_2434 | 344 |
| 109 | 3300046536 | Ga0495587_0010322 | Ga0495587_0010322_947_2014 | 344 |
| 110 | 3300046543 | Ga0495645_0005284 | Ga0495645_0005284_1870_2937 | 344 |
| 111 | 3300046678 | Ga0495599_0014299 | Ga0495599_0014299_524_1591 | 344 |
| 112 | 3300046679 | Ga0495623_0001143 | Ga0495623_0001143_14516_15583 | 344 |
| 113 | 3300047444 | Ga0495675_0083758 | Ga0495675_0083758_611_1678 | 344 |
| 114 | 3300049571 | Ga0501034_0315844 | Ga0501034_0315844_134_1219 | 344 |
| 115 | 3300049822 | Ga0501035_0203895 | Ga0501035_0203895_511_1596 | 344 |
| 116 | 3300050509 | nmdc:mga0qj67_149950_c1 | nmdc:mga0qj67_149950_c1_399_1442 | 344 |
| 117 | 3300005329 | Ga0070683_100100284 | Ga0070683_1001002842 | 345 |
| 118 | 3300005336 | Ga0070680_100139430 | Ga0070680_1001394302 | 345 |
| 119 | 3300005339 | Ga0070660_100091095 | Ga0070660_1000910952 | 345 |
| 120 | 3300005339 | Ga0070660_100108771 | Ga0070660_1001087712 | 345 |
| 121 | 3300005366 | Ga0070659_100078772 | Ga0070659_1000787722 | 345 |
| 122 | 3300005435 | Ga0070714_100035830 | Ga0070714_1000358303 | 345 |
| 123 | 3300005530 | Ga0070679_100171118 | Ga0070679_1001711182 | 345 |
| 124 | 3300005535 | Ga0070684_100022918 | Ga0070684_1000229181 | 345 |
| 125 | 3300005564 | Ga0070664_100175397 | Ga0070664_1001753971 | 345 |
| 126 | 3300005616 | Ga0068852_100041149 | Ga0068852_1000411492 | 345 |
| 127 | 3300009098 | Ga0105245_10095260 | Ga0105245_100952602 | 345 |
| 128 | 3300009176 | Ga0105242_10007016 | Ga0105242_100070167 | 345 |
| 129 | 3300009177 | Ga0105248_10135631 | Ga0105248_101356312 | 345 |
| 130 | 3300013105 | Ga0157369_10028114 | Ga0157369_100281143 | 345 |
| 131 | 3300013105 | Ga0157369_10110302 | Ga0157369_101103023 | 345 |
| 132 | 3300013307 | Ga0157372_10003638 | Ga0157372_100036382 | 345 |
| 133 | 3300013307 | Ga0157372_10094480 | Ga0157372_100944803 | 345 |
| 134 | 3300013307 | Ga0157372_10109733 | Ga0157372_101097332 | 345 |
| 135 | 3300013308 | Ga0157375_10631634 | Ga0157375_106316341 | 345 |
| 136 | 3300025909 | Ga0207705_10006635 | Ga0207705_100066352 | 345 |
| 137 | 3300025919 | Ga0207657_10030969 | Ga0207657_100309693 | 345 |
| 138 | 3300025921 | Ga0207652_10112280 | Ga0207652_101122802 | 345 |
| 139 | 3300025921 | Ga0207652_10141794 | Ga0207652_101417942 | 345 |
| 140 | 3300025929 | Ga0207664_10040806 | Ga0207664_100408063 | 345 |
| 141 | 3300025944 | Ga0207661_10028981 | Ga0207661_100289812 | 345 |
| 142 | 3300025944 | Ga0207661_10166175 | Ga0207661_101661752 | 345 |
| 143 | 3300025945 | Ga0207679_10129184 | Ga0207679_101291842 | 345 |
| 144 | 3300031995 | Ga0307409_100065563 | Ga0307409_1000655633 | 345 |
| 145 | 3300032002 | Ga0307416_100026641 | Ga0307416_1000266412 | 345 |
| 146 | 3300032004 | Ga0307414_10038033 | Ga0307414_100380332 | 345 |
| 147 | 3300046476 | Ga0495662_0040127 | Ga0495662_0040127_527_1600 | 345 |
| 148 | 3300047317 | Ga0495604_0208938 | Ga0495604_0208938_162_1235 | 345 |
| 149 | 3300047320 | Ga0495672_0003097 | Ga0495672_0003097_6529_7599 | 345 |
| 150 | 3300047444 | Ga0495675_0043803 | Ga0495675_0043803_969_2042 | 345 |
| 151 | 3300048911 | Ga0496108_0082404 | Ga0496108_0082404_854_1924 | 345 |
| 152 | 3300048912 | Ga0496109_0007143 | Ga0496109_0007143_5635_6705 | 345 |
| 153 | 3300048915 | Ga0496112_0025310 | Ga0496112_0025310_3838_4908 | 345 |
| 154 | 3300049568 | Ga0501031_0036006 | Ga0501031_0036006_1291_2379 | 345 |
| 155 | 3300049574 | Ga0501038_0032379 | Ga0501038_0032379_917_1984 | 345 |
| 156 | 3300049742 | Ga0501080_0178552 | Ga0501080_0178552_425_1486 | 345 |
| 157 | 3300049822 | Ga0501035_0221324 | Ga0501035_0221324_515_1582 | 345 |
| 158 | 3300049824 | Ga0501045_0009542 | Ga0501045_0009542_2326_3414 | 345 |
| 159 | 3300054114 | Ga0501084_0183129 | Ga0501084_0183129_286_1374 | 345 |
| 160 | 3300005329 | Ga0070683_100128253 | Ga0070683_1001282532 | 346 |
| 161 | 3300005331 | Ga0070670_100001690 | Ga0070670_10000169011 | 346 |
| 162 | 3300005334 | Ga0068869_100006554 | Ga0068869_1000065546 | 346 |
| 163 | 3300005336 | Ga0070680_100002636 | Ga0070680_10000263611 | 346 |
| 164 | 3300005339 | Ga0070660_100054163 | Ga0070660_1000541632 | 346 |
| 165 | 3300005344 | Ga0070661_100002651 | Ga0070661_10000265113 | 346 |
| 166 | 3300005345 | Ga0070692_10002754 | Ga0070692_100027543 | 346 |
| 167 | 3300005354 | Ga0070675_100001303 | Ga0070675_1000013035 | 346 |
| 168 | 3300005355 | Ga0070671_100061277 | Ga0070671_1000612772 | 346 |
| 169 | 3300005366 | Ga0070659_100005266 | Ga0070659_1000052668 | 346 |
| 170 | 3300005435 | Ga0070714_100016126 | Ga0070714_1000161266 | 346 |
| 171 | 3300005435 | Ga0070714_100022232 | Ga0070714_1000222323 | 346 |
| 172 | 3300005436 | Ga0070713_100000274 | Ga0070713_10000027411 | 346 |
| 173 | 3300005437 | Ga0070710_10059049 | Ga0070710_100590491 | 346 |
| 174 | 3300005457 | Ga0070662_100054079 | Ga0070662_1000540792 | 346 |
| 175 | 3300005458 | Ga0070681_10029456 | Ga0070681_100294562 | 346 |
| 176 | 3300005530 | Ga0070679_100002624 | Ga0070679_1000026246 | 346 |
| 177 | 3300005530 | Ga0070679_100049944 | Ga0070679_1000499442 | 346 |
| 178 | 3300005535 | Ga0070684_100094815 | Ga0070684_1000948152 | 346 |
| 179 | 3300005535 | Ga0070684_100116562 | Ga0070684_1001165622 | 346 |
| 180 | 3300005563 | Ga0068855_100441238 | Ga0068855_1004412382 | 346 |
| 181 | 3300005564 | Ga0070664_100092758 | Ga0070664_1000927582 | 346 |
| 182 | 3300005577 | Ga0068857_100008501 | Ga0068857_1000085013 | 346 |
| 183 | 3300005614 | Ga0068856_100008186 | Ga0068856_1000081862 | 346 |
| 184 | 3300005617 | Ga0068859_100020877 | Ga0068859_1000208774 | 346 |
| 185 | 3300005618 | Ga0068864_100008979 | Ga0068864_1000089798 | 346 |
| 186 | 3300005840 | Ga0068870_10063097 | Ga0068870_100630972 | 346 |
| 187 | 3300005841 | Ga0068863_100040124 | Ga0068863_1000401242 | 346 |
| 188 | 3300005842 | Ga0068858_100451767 | Ga0068858_1004517671 | 346 |
| 189 | 3300006028 | Ga0070717_10003227 | Ga0070717_100032279 | 346 |
| 190 | 3300006028 | Ga0070717_10165301 | Ga0070717_101653011 | 346 |
| 191 | 3300006175 | Ga0070712_100000729 | Ga0070712_1000007292 | 346 |
| 192 | 3300006358 | Ga0068871_100043477 | Ga0068871_1000434771 | 346 |
| 193 | 3300006931 | Ga0097620_100020878 | Ga0097620_1000208783 | 346 |
| 194 | 3300009174 | Ga0105241_10003130 | Ga0105241_100031304 | 346 |
| 195 | 3300009177 | Ga0105248_10010770 | Ga0105248_100107705 | 346 |
| 196 | 3300011119 | Ga0105246_10002700 | Ga0105246_1000270010 | 346 |
| 197 | 3300013100 | Ga0157373_10016174 | Ga0157373_100161742 | 346 |
| 198 | 3300013102 | Ga0157371_10007718 | Ga0157371_100077188 | 346 |
| 199 | 3300013296 | Ga0157374_10024820 | Ga0157374_100248202 | 346 |
| 200 | 3300013297 | Ga0157378_10107328 | Ga0157378_101073282 | 346 |
| 201 | 3300013307 | Ga0157372_10005371 | Ga0157372_100053713 | 346 |
| 202 | 3300013307 | Ga0157372_10177663 | Ga0157372_101776632 | 346 |
| 203 | 3300014325 | Ga0163163_10040544 | Ga0163163_100405444 | 346 |
| 204 | 3300014745 | Ga0157377_10000361 | Ga0157377_1000036115 | 346 |
| 205 | 3300025906 | Ga0207699_10041085 | Ga0207699_100410852 | 346 |
| 206 | 3300025908 | Ga0207643_10038298 | Ga0207643_100382982 | 346 |
| 207 | 3300025912 | Ga0207707_10003913 | Ga0207707_100039135 | 346 |
| 208 | 3300025912 | Ga0207707_10019956 | Ga0207707_100199565 | 346 |
| 209 | 3300025912 | Ga0207707_10034709 | Ga0207707_100347091 | 346 |
| 210 | 3300025915 | Ga0207693_10009781 | Ga0207693_100097814 | 346 |
| 211 | 3300025917 | Ga0207660_10039964 | Ga0207660_100399642 | 346 |
| 212 | 3300025917 | Ga0207660_10162998 | Ga0207660_101629981 | 346 |
| 213 | 3300025919 | Ga0207657_10059737 | Ga0207657_100597372 | 346 |
| 214 | 3300025921 | Ga0207652_10033953 | Ga0207652_100339531 | 346 |
| 215 | 3300025921 | Ga0207652_10177064 | Ga0207652_101770641 | 346 |
| 216 | 3300025926 | Ga0207659_10006490 | Ga0207659_100064902 | 346 |
| 217 | 3300025927 | Ga0207687_10002512 | Ga0207687_100025129 | 346 |
| 218 | 3300025928 | Ga0207700_10001579 | Ga0207700_100015795 | 346 |
| 219 | 3300025929 | Ga0207664_10033723 | Ga0207664_100337233 | 346 |
| 220 | 3300025931 | Ga0207644_10046697 | Ga0207644_100466972 | 346 |
| 221 | 3300025932 | Ga0207690_10003410 | Ga0207690_100034105 | 346 |
| 222 | 3300025933 | Ga0207706_10006192 | Ga0207706_1000619211 | 346 |
| 223 | 3300025941 | Ga0207711_10021340 | Ga0207711_100213405 | 346 |
| 224 | 3300025942 | Ga0207689_10003321 | Ga0207689_100033213 | 346 |
| 225 | 3300025945 | Ga0207679_10009151 | Ga0207679_100091516 | 346 |
| 226 | 3300026116 | Ga0207674_10000120 | Ga0207674_1000012064 | 346 |
| 227 | 3300026142 | Ga0207698_10004081 | Ga0207698_100040813 | 346 |
| 228 | 3300031731 | Ga0307405_10005306 | Ga0307405_100053064 | 346 |
| 229 | 3300031901 | Ga0307406_10021245 | Ga0307406_100212453 | 346 |
| 230 | 3300031903 | Ga0307407_10006838 | Ga0307407_100068384 | 346 |
| 231 | 3300031911 | Ga0307412_10137685 | Ga0307412_101376852 | 346 |
| 232 | 3300031995 | Ga0307409_100002209 | Ga0307409_1000022092 | 346 |
| 233 | 3300032002 | Ga0307416_100195182 | Ga0307416_1001951821 | 346 |
| 234 | 3300032005 | Ga0307411_10159814 | Ga0307411_101598141 | 346 |
| 235 | 3300032126 | Ga0307415_100001449 | Ga0307415_1000014494 | 346 |
| 236 | 3300037466 | Ga0395898_0157387 | Ga0395898_0157387_257_1372 | 346 |
| 237 | 3300037471 | Ga0395905_0012027 | Ga0395905_0012027_6421_7536 | 346 |
| 238 | 3300037471 | Ga0395905_0025986 | Ga0395905_0025986_1246_2331 | 346 |
| 239 | 3300038443 | Ga0395901_0012275 | Ga0395901_0012275_4456_5571 | 346 |
| 240 | 3300046459 | Ga0495629_0003679 | Ga0495629_0003679_3909_4982 | 346 |
| 241 | 3300046473 | Ga0495582_0008481 | Ga0495582_0008481_2233_3306 | 346 |
| 242 | 3300047315 | Ga0495581_0023496 | Ga0495581_0023496_1373_2446 | 346 |
| 243 | 3300005329 | Ga0070683_100049685 | Ga0070683_1000496852 | 347 |
| 244 | 3300005614 | Ga0068856_100200303 | Ga0068856_1002003032 | 347 |
| 245 | 3300006871 | Ga0075434_100048454 | Ga0075434_1000484543 | 347 |
| 246 | 3300025906 | Ga0207699_10037618 | Ga0207699_100376182 | 347 |
| 247 | 3300025944 | Ga0207661_10034946 | Ga0207661_100349462 | 347 |
| 248 | 3300026078 | Ga0207702_10006369 | Ga0207702_100063692 | 347 |
| 249 | 3300035083 | Ga0373926_0000847 | Ga0373926_0000847_64_1191 | 347 |
| 250 | 3300035086 | Ga0373934_0000268 | Ga0373934_0000268_14647_15744 | 347 |
| 251 | 3300035111 | Ga0373923_0004528 | Ga0373923_0004528_57_1154 | 347 |
| 252 | 3300035111 | Ga0373923_0052600 | Ga0373923_0052600_539_1618 | 347 |
| 253 | 3300035117 | Ga0373953_0006058 | Ga0373953_0006058_203_1300 | 347 |
| 254 | 3300035117 | Ga0373953_0023500 | Ga0373953_0023500_648_1727 | 347 |
| 255 | 3300035118 | Ga0373954_0012964 | Ga0373954_0012964_1157_2236 | 347 |
| 256 | 3300035119 | Ga0373956_0001288 | Ga0373956_0001288_8972_10069 | 347 |
| 257 | 3300035172 | Ga0373955_0009843 | Ga0373955_0009843_516_1613 | 347 |
| 258 | 3300035172 | Ga0373955_0022976 | Ga0373955_0022976_1542_2621 | 347 |
| 259 | 3300035692 | Ga0373935_0000326 | Ga0373935_0000326_15634_16761 | 347 |
| 260 | 3300035695 | Ga0373927_0005297 | Ga0373927_0005297_3491_4618 | 347 |
| 261 | 3300035724 | Ga0373933_0000033 | Ga0373933_0000033_47430_48527 | 347 |
| 262 | 3300035724 | Ga0373933_0052222 | Ga0373933_0052222_636_1715 | 347 |
| 263 | 3300035725 | Ga0373947_0001264 | Ga0373947_0001264_282_1409 | 347 |
| 264 | 3300036401 | Ga0373937_0000158 | Ga0373937_0000158_52166_53263 | 347 |
| 265 | 3300036401 | Ga0373937_0086795 | Ga0373937_0086795_1236_2315 | 347 |
| 266 | 3300037068 | Ga0373925_0000986 | Ga0373925_0000986_15258_16385 | 347 |
| 267 | 3300044656 | Ga0466969_0108285 | Ga0466969_0108285_153_1280 | 347 |
| 268 | 3300045049 | Ga0466959_0017315 | Ga0466959_0017315_2296_3423 | 347 |
| 269 | 3300046455 | Ga0495603_0016958 | Ga0495603_0016958_154_1281 | 347 |
| 270 | 3300046459 | Ga0495629_0100630 | Ga0495629_0100630_105_1379 | 347 |
| 271 | 3300046462 | Ga0495651_0000572 | Ga0495651_0000572_24628_25725 | 347 |
| 272 | 3300046462 | Ga0495651_0004202 | Ga0495651_0004202_2300_3379 | 347 |
| 273 | 3300046463 | Ga0495653_0000173 | Ga0495653_0000173_50790_51887 | 347 |
| 274 | 3300046463 | Ga0495653_0014450 | Ga0495653_0014450_4267_5346 | 347 |
| 275 | 3300046472 | Ga0495580_0006012 | Ga0495580_0006012_849_1976 | 347 |
| 276 | 3300046477 | Ga0495664_0013973 | Ga0495664_0013973_223_1302 | 347 |
| 277 | 3300046511 | Ga0495608_0000418 | Ga0495608_0000418_2897_3994 | 347 |
| 278 | 3300046514 | Ga0495618_0069736 | Ga0495618_0069736_1097_2194 | 347 |
| 279 | 3300046516 | Ga0495628_0000467 | Ga0495628_0000467_3222_4319 | 347 |
| 280 | 3300046516 | Ga0495628_0091911 | Ga0495628_0091911_1100_2179 | 347 |
| 281 | 3300046517 | Ga0495630_0001246 | Ga0495630_0001246_7697_8824 | 347 |
| 282 | 3300046517 | Ga0495630_0079628 | Ga0495630_0079628_189_1286 | 347 |
| 283 | 3300046529 | Ga0495652_0000658 | Ga0495652_0000658_36092_37189 | 347 |
| 284 | 3300046529 | Ga0495652_0002827 | Ga0495652_0002827_8751_9830 | 347 |
| 285 | 3300046531 | Ga0495665_0000327 | Ga0495665_0000327_15350_16477 | 347 |
| 286 | 3300046536 | Ga0495587_0000247 | Ga0495587_0000247_1199_2296 | 347 |
| 287 | 3300046536 | Ga0495587_0003466 | Ga0495587_0003466_6109_7188 | 347 |
| 288 | 3300046543 | Ga0495645_0000210 | Ga0495645_0000210_26874_27971 | 347 |
| 289 | 3300046543 | Ga0495645_0022315 | Ga0495645_0022315_284_1363 | 347 |
| 290 | 3300046543 | Ga0495645_0051695 | Ga0495645_0051695_698_1777 | 347 |
| 291 | 3300046642 | Ga0495634_0057120 | Ga0495634_0057120_561_1658 | 347 |
| 292 | 3300046663 | Ga0495635_0000157 | Ga0495635_0000157_4057_5154 | 347 |
| 293 | 3300046663 | Ga0495635_0068088 | Ga0495635_0068088_137_1216 | 347 |
| 294 | 3300046674 | Ga0495588_0001152 | Ga0495588_0001152_3145_4272 | 347 |
| 295 | 3300046675 | Ga0495657_0008627 | Ga0495657_0008627_3739_4836 | 347 |
| 296 | 3300046678 | Ga0495599_0000858 | Ga0495599_0000858_2863_3960 | 347 |
| 297 | 3300046678 | Ga0495599_0030779 | Ga0495599_0030779_1166_2245 | 347 |
| 298 | 3300046679 | Ga0495623_0000014 | Ga0495623_0000014_34589_35686 | 347 |
| 299 | 3300046680 | Ga0495646_0040531 | Ga0495646_0040531_361_1440 | 347 |
| 300 | 3300046683 | Ga0495658_0000573 | Ga0495658_0000573_13656_14783 | 347 |
| 301 | 3300046689 | Ga0495613_0124651 | Ga0495613_0124651_669_1766 | 347 |
| 302 | 3300046809 | Ga0495600_0000105 | Ga0495600_0000105_2876_3973 | 347 |
| 303 | 3300047315 | Ga0495581_0000150 | Ga0495581_0000150_14163_15290 | 347 |
| 304 | 3300047317 | Ga0495604_0002679 | Ga0495604_0002679_3642_4721 | 347 |
| 305 | 3300047319 | Ga0495674_0005036 | Ga0495674_0005036_2866_3963 | 347 |
| 306 | 3300047322 | Ga0495680_0001244 | Ga0495680_0001244_2484_3581 | 347 |
| 307 | 3300047444 | Ga0495675_0021362 | Ga0495675_0021362_2942_4021 | 347 |
| 308 | 3300047471 | Ga0495684_0003598 | Ga0495684_0003598_5504_6583 | 347 |
| 309 | 3300047673 | Ga0495593_0000112 | Ga0495593_0000112_33729_34856 | 347 |
| 310 | 3300048088 | Ga0495602_0003519 | Ga0495602_0003519_12267_13364 | 347 |
| 311 | 3300048088 | Ga0495602_0034625 | Ga0495602_0034625_698_1777 | 347 |
| 312 | 3300048089 | Ga0495614_0000021 | Ga0495614_0000021_12213_13340 | 347 |
| 313 | 3300053078 | Ga0495612_0004210 | Ga0495612_0004210_1000_2097 | 347 |
| 314 | 3300053085 | Ga0495619_0003661 | Ga0495619_0003661_6977_8074 | 347 |
| 315 | 3300005328 | Ga0070676_10042873 | Ga0070676_100428732 | 348 |
| 316 | 3300005328 | Ga0070676_10102670 | Ga0070676_101026702 | 348 |
| 317 | 3300005329 | Ga0070683_100033866 | Ga0070683_1000338663 | 348 |
| 318 | 3300005329 | Ga0070683_100109671 | Ga0070683_1001096712 | 348 |
| 319 | 3300005334 | Ga0068869_100333923 | Ga0068869_1003339231 | 348 |
| 320 | 3300005343 | Ga0070687_100069337 | Ga0070687_1000693372 | 348 |
| 321 | 3300005347 | Ga0070668_100019433 | Ga0070668_1000194334 | 348 |
| 322 | 3300005353 | Ga0070669_100141216 | Ga0070669_1001412162 | 348 |
| 323 | 3300005355 | Ga0070671_100010754 | Ga0070671_1000107541 | 348 |
| 324 | 3300005356 | Ga0070674_100014636 | Ga0070674_1000146363 | 348 |
| 325 | 3300005367 | Ga0070667_100081347 | Ga0070667_1000813472 | 348 |
| 326 | 3300005367 | Ga0070667_100256759 | Ga0070667_1002567592 | 348 |
| 327 | 3300005367 | Ga0070667_100309469 | Ga0070667_1003094691 | 348 |
| 328 | 3300005457 | Ga0070662_100067162 | Ga0070662_1000671622 | 348 |
| 329 | 3300005459 | Ga0068867_100035337 | Ga0068867_1000353373 | 348 |
| 330 | 3300005466 | Ga0070685_10089744 | Ga0070685_100897441 | 348 |
| 331 | 3300005518 | Ga0070699_100375959 | Ga0070699_1003759591 | 348 |
| 332 | 3300005535 | Ga0070684_100026145 | Ga0070684_1000261451 | 348 |
| 333 | 3300005535 | Ga0070684_100245940 | Ga0070684_1002459402 | 348 |
| 334 | 3300005535 | Ga0070684_100380168 | Ga0070684_1003801681 | 348 |
| 335 | 3300005564 | Ga0070664_100013127 | Ga0070664_1000131275 | 348 |
| 336 | 3300005564 | Ga0070664_100135355 | Ga0070664_1001353552 | 348 |
| 337 | 3300005577 | Ga0068857_100040907 | Ga0068857_1000409073 | 348 |
| 338 | 3300005618 | Ga0068864_100090837 | Ga0068864_1000908371 | 348 |
| 339 | 3300005840 | Ga0068870_10010164 | Ga0068870_100101643 | 348 |
| 340 | 3300005842 | Ga0068858_100107302 | Ga0068858_1001073022 | 348 |
| 341 | 3300005843 | Ga0068860_100069019 | Ga0068860_1000690192 | 348 |
| 342 | 3300006846 | Ga0075430_100004889 | Ga0075430_1000048897 | 348 |
| 343 | 3300006847 | Ga0075431_100073766 | Ga0075431_1000737662 | 348 |
| 344 | 3300006881 | Ga0068865_100072567 | Ga0068865_1000725672 | 348 |
| 345 | 3300009098 | Ga0105245_10478892 | Ga0105245_104788921 | 348 |
| 346 | 3300009177 | Ga0105248_10071471 | Ga0105248_100714713 | 348 |
| 347 | 3300009177 | Ga0105248_10151299 | Ga0105248_101512992 | 348 |
| 348 | 3300013102 | Ga0157371_10189813 | Ga0157371_101898131 | 348 |
| 349 | 3300013308 | Ga0157375_10073656 | Ga0157375_100736562 | 348 |
| 350 | 3300014325 | Ga0163163_10371975 | Ga0163163_103719751 | 348 |
| 351 | 3300015262 | Ga0182007_10059774 | Ga0182007_100597741 | 348 |
| 352 | 3300017792 | Ga0163161_10034811 | Ga0163161_100348112 | 348 |
| 353 | 3300025893 | Ga0207682_10027922 | Ga0207682_100279222 | 348 |
| 354 | 3300025907 | Ga0207645_10048955 | Ga0207645_100489552 | 348 |
| 355 | 3300025907 | Ga0207645_10071034 | Ga0207645_100710342 | 348 |
| 356 | 3300025908 | Ga0207643_10003121 | Ga0207643_100031215 | 348 |
| 357 | 3300025909 | Ga0207705_10070941 | Ga0207705_100709412 | 348 |
| 358 | 3300025923 | Ga0207681_10032103 | Ga0207681_100321033 | 348 |
| 359 | 3300025923 | Ga0207681_10077594 | Ga0207681_100775942 | 348 |
| 360 | 3300025933 | Ga0207706_10122547 | Ga0207706_101225472 | 348 |
| 361 | 3300025938 | Ga0207704_10019217 | Ga0207704_100192171 | 348 |
| 362 | 3300025940 | Ga0207691_10016638 | Ga0207691_100166383 | 348 |
| 363 | 3300025940 | Ga0207691_10030149 | Ga0207691_100301492 | 348 |
| 364 | 3300025941 | Ga0207711_10235955 | Ga0207711_102359552 | 348 |
| 365 | 3300025944 | Ga0207661_10100013 | Ga0207661_101000132 | 348 |
| 366 | 3300025944 | Ga0207661_10203919 | Ga0207661_102039192 | 348 |
| 367 | 3300025944 | Ga0207661_10307475 | Ga0207661_103074752 | 348 |
| 368 | 3300025945 | Ga0207679_10044518 | Ga0207679_100445182 | 348 |
| 369 | 3300025972 | Ga0207668_10027847 | Ga0207668_100278472 | 348 |
| 370 | 3300025986 | Ga0207658_10050495 | Ga0207658_100504952 | 348 |
| 371 | 3300026088 | Ga0207641_10234572 | Ga0207641_102345721 | 348 |
| 372 | 3300026089 | Ga0207648_10037599 | Ga0207648_100375992 | 348 |
| 373 | 3300026095 | Ga0207676_10032435 | Ga0207676_100324351 | 348 |
| 374 | 3300026116 | Ga0207674_10022748 | Ga0207674_100227482 | 348 |
| 375 | 3300026116 | Ga0207674_10131472 | Ga0207674_101314721 | 348 |
| 376 | 3300032002 | Ga0307416_100224637 | Ga0307416_1002246372 | 348 |
| 377 | 3300048908 | Ga0496105_0113580 | Ga0496105_0113580_867_1934 | 348 |
| 378 | 3300048909 | Ga0496106_0137953 | Ga0496106_0137953_41_1108 | 348 |
| 379 | 3300048915 | Ga0496112_0050523 | Ga0496112_0050523_1601_2668 | 348 |
| 380 | 3300048916 | Ga0496113_0017414 | Ga0496113_0017414_103_1170 | 348 |
| 381 | 3300049570 | Ga0501033_0006024 | Ga0501033_0006024_4701_5783 | 348 |
| 382 | 3300049571 | Ga0501034_0281481 | Ga0501034_0281481_473_1555 | 348 |
| 383 | 3300049572 | Ga0501036_0168888 | Ga0501036_0168888_90_1172 | 348 |
| 384 | 3300049574 | Ga0501038_0300825 | Ga0501038_0300825_17_1099 | 348 |
| 385 | 3300049581 | Ga0501047_0067420 | Ga0501047_0067420_1865_2947 | 348 |
| 386 | 3300050509 | nmdc:mga0qj67_303753_c1 | nmdc:mga0qj67_303753_c1_130_1248 | 348 |
| 387 | 3300005331 | Ga0070670_100175930 | Ga0070670_1001759302 | 349 |
| 388 | 3300005336 | Ga0070680_100049831 | Ga0070680_1000498312 | 349 |
| 389 | 3300005347 | Ga0070668_100024411 | Ga0070668_1000244112 | 349 |
| 390 | 3300005353 | Ga0070669_100004597 | Ga0070669_1000045972 | 349 |
| 391 | 3300005353 | Ga0070669_100254161 | Ga0070669_1002541612 | 349 |
| 392 | 3300005354 | Ga0070675_100004851 | Ga0070675_1000048513 | 349 |
| 393 | 3300005355 | Ga0070671_100072157 | Ga0070671_1000721571 | 349 |
| 394 | 3300005457 | Ga0070662_100082564 | Ga0070662_1000825642 | 349 |
| 395 | 3300005457 | Ga0070662_100086544 | Ga0070662_1000865442 | 349 |
| 396 | 3300005458 | Ga0070681_10008034 | Ga0070681_100080344 | 349 |
| 397 | 3300005459 | Ga0068867_100083776 | Ga0068867_1000837762 | 349 |
| 398 | 3300005467 | Ga0070706_100128581 | Ga0070706_1001285812 | 349 |
| 399 | 3300005471 | Ga0070698_100146751 | Ga0070698_1001467512 | 349 |
| 400 | 3300005471 | Ga0070698_100205329 | Ga0070698_1002053292 | 349 |
| 401 | 3300005535 | Ga0070684_100045645 | Ga0070684_1000456453 | 349 |
| 402 | 3300005543 | Ga0070672_100016872 | Ga0070672_1000168722 | 349 |
| 403 | 3300005548 | Ga0070665_100204588 | Ga0070665_1002045882 | 349 |
| 404 | 3300005577 | Ga0068857_100013444 | Ga0068857_1000134444 | 349 |
| 405 | 3300005614 | Ga0068856_100176153 | Ga0068856_1001761532 | 349 |
| 406 | 3300005718 | Ga0068866_10013526 | Ga0068866_100135261 | 349 |
| 407 | 3300005719 | Ga0068861_100012315 | Ga0068861_1000123155 | 349 |
| 408 | 3300005834 | Ga0068851_10019465 | Ga0068851_100194652 | 349 |
| 409 | 3300005840 | Ga0068870_10012484 | Ga0068870_100124843 | 349 |
| 410 | 3300005840 | Ga0068870_10163537 | Ga0068870_101635372 | 349 |
| 411 | 3300005841 | Ga0068863_100305094 | Ga0068863_1003050942 | 349 |
| 412 | 3300005844 | Ga0068862_100000513 | Ga0068862_10000051326 | 349 |
| 413 | 3300006846 | Ga0075430_100015467 | Ga0075430_1000154673 | 349 |
| 414 | 3300006846 | Ga0075430_100021793 | Ga0075430_1000217933 | 349 |
| 415 | 3300006846 | Ga0075430_100244046 | Ga0075430_1002440462 | 349 |
| 416 | 3300006847 | Ga0075431_100001756 | Ga0075431_1000017564 | 349 |
| 417 | 3300006847 | Ga0075431_100013780 | Ga0075431_1000137802 | 349 |
| 418 | 3300006880 | Ga0075429_100012636 | Ga0075429_1000126363 | 349 |
| 419 | 3300009094 | Ga0111539_10037513 | Ga0111539_100375133 | 349 |
| 420 | 3300009147 | Ga0114129_10177230 | Ga0114129_101772302 | 349 |
| 421 | 3300009148 | Ga0105243_10179084 | Ga0105243_101790842 | 349 |
| 422 | 3300009176 | Ga0105242_10035562 | Ga0105242_100355624 | 349 |
| 423 | 3300009545 | Ga0105237_10115057 | Ga0105237_101150572 | 349 |
| 424 | 3300009551 | Ga0105238_10042389 | Ga0105238_100423892 | 349 |
| 425 | 3300009553 | Ga0105249_10000251 | Ga0105249_1000025113 | 349 |
| 426 | 3300013102 | Ga0157371_10011433 | Ga0157371_100114336 | 349 |
| 427 | 3300013105 | Ga0157369_10109713 | Ga0157369_101097133 | 349 |
| 428 | 3300013296 | Ga0157374_10239765 | Ga0157374_102397652 | 349 |
| 429 | 3300013297 | Ga0157378_10075869 | Ga0157378_100758691 | 349 |
| 430 | 3300013306 | Ga0163162_10187794 | Ga0163162_101877942 | 349 |
| 431 | 3300013307 | Ga0157372_10025243 | Ga0157372_100252432 | 349 |
| 432 | 3300013307 | Ga0157372_10028700 | Ga0157372_100287001 | 349 |
| 433 | 3300013308 | Ga0157375_10500040 | Ga0157375_105000401 | 349 |
| 434 | 3300014325 | Ga0163163_10002771 | Ga0163163_100027717 | 349 |
| 435 | 3300014326 | Ga0157380_10023530 | Ga0157380_100235302 | 349 |
| 436 | 3300014968 | Ga0157379_10001669 | Ga0157379_1000166913 | 349 |
| 437 | 3300014969 | Ga0157376_10248369 | Ga0157376_102483692 | 349 |
| 438 | 3300025903 | Ga0207680_10182171 | Ga0207680_101821712 | 349 |
| 439 | 3300025908 | Ga0207643_10002389 | Ga0207643_1000238911 | 349 |
| 440 | 3300025908 | Ga0207643_10140316 | Ga0207643_101403162 | 349 |
| 441 | 3300025910 | Ga0207684_10036904 | Ga0207684_100369044 | 349 |
| 442 | 3300025912 | Ga0207707_10015537 | Ga0207707_100155373 | 349 |
| 443 | 3300025914 | Ga0207671_10042557 | Ga0207671_100425572 | 349 |
| 444 | 3300025915 | Ga0207693_10124994 | Ga0207693_101249942 | 349 |
| 445 | 3300025918 | Ga0207662_10002218 | Ga0207662_100022181 | 349 |
| 446 | 3300025923 | Ga0207681_10001166 | Ga0207681_100011668 | 349 |
| 447 | 3300025924 | Ga0207694_10127219 | Ga0207694_101272192 | 349 |
| 448 | 3300025925 | Ga0207650_10020901 | Ga0207650_100209012 | 349 |
| 449 | 3300025925 | Ga0207650_10200054 | Ga0207650_102000541 | 349 |
| 450 | 3300025926 | Ga0207659_10054273 | Ga0207659_100542732 | 349 |
| 451 | 3300025933 | Ga0207706_10216576 | Ga0207706_102165761 | 349 |
| 452 | 3300025933 | Ga0207706_10257060 | Ga0207706_102570602 | 349 |
| 453 | 3300025935 | Ga0207709_10108714 | Ga0207709_101087142 | 349 |
| 454 | 3300025937 | Ga0207669_10013126 | Ga0207669_100131264 | 349 |
| 455 | 3300025940 | Ga0207691_10018984 | Ga0207691_100189843 | 349 |
| 456 | 3300025961 | Ga0207712_10004110 | Ga0207712_100041104 | 349 |
| 457 | 3300025972 | Ga0207668_10019443 | Ga0207668_100194432 | 349 |
| 458 | 3300026075 | Ga0207708_10122013 | Ga0207708_101220132 | 349 |
| 459 | 3300026088 | Ga0207641_10129055 | Ga0207641_101290552 | 349 |
| 460 | 3300026089 | Ga0207648_10003275 | Ga0207648_1000327512 | 349 |
| 461 | 3300027907 | Ga0207428_10037258 | Ga0207428_100372582 | 349 |
| 462 | 3300028380 | Ga0268265_10001595 | Ga0268265_100015959 | 349 |
| 463 | 3300031548 | Ga0307408_100041290 | Ga0307408_1000412902 | 349 |
| 464 | 3300031852 | Ga0307410_10100626 | Ga0307410_101006262 | 349 |
| 465 | 3300032002 | Ga0307416_100018746 | Ga0307416_1000187463 | 349 |
| 466 | 3300032005 | Ga0307411_10420757 | Ga0307411_104207571 | 349 |
| 467 | 3300042133 | Ga0450896_004842 | Ga0450896_004842_619_1677 | 349 |
| 468 | 3300046459 | Ga0495629_0045502 | Ga0495629_0045502_1739_2824 | 349 |
| 469 | 3300046472 | Ga0495580_0038935 | Ga0495580_0038935_1856_2941 | 349 |
| 470 | 3300046499 | Ga0495594_0139221 | Ga0495594_0139221_228_1313 | 349 |
| 471 | 3300046559 | Ga0495667_0004730 | Ga0495667_0004730_2161_3246 | 349 |
| 472 | 3300048088 | Ga0495602_0146808 | Ga0495602_0146808_281_1366 | 349 |
| 473 | 3300048915 | Ga0496112_0158895 | Ga0496112_0158895_937_1995 | 349 |
| 474 | 3300048917 | Ga0496114_0118358 | Ga0496114_0118358_123_1235 | 349 |
| 475 | 3300048918 | Ga0496115_0003186 | Ga0496115_0003186_9569_10681 | 349 |
| 476 | 3300050507 | nmdc:mga05p37_116123_c1 | nmdc:mga05p37_116123_c1_1503_2561 | 349 |
| 477 | 3300050509 | nmdc:mga0qj67_27546_c1 | nmdc:mga0qj67_27546_c1_1783_2844 | 349 |
| 478 | 3300050509 | nmdc:mga0qj67_3307_c1 | nmdc:mga0qj67_3307_c1_8021_9079 | 349 |
| 479 | 3300050509 | nmdc:mga0qj67_42956_c1 | nmdc:mga0qj67_42956_c1_283_1404 | 349 |
| 480 | 3300050510 | nmdc:mga06r32_36854_c1 | nmdc:mga06r32_36854_c1_3374_4435 | 349 |
| 481 | 3300050510 | nmdc:mga06r32_57724_c1 | nmdc:mga06r32_57724_c1_1765_2886 | 349 |
| 482 | 3300050513 | nmdc:mga0rr50_98846_c1 | nmdc:mga0rr50_98846_c1_297_1355 | 349 |
| 483 | 3300013105 | Ga0157369_10015607 | Ga0157369_100156075 | 352 |
| 484 | 3300031548 | Ga0307408_100007743 | Ga0307408_1000077435 | 352 |
| 485 | 3300031731 | Ga0307405_10006690 | Ga0307405_100066903 | 352 |
| 486 | 3300031903 | Ga0307407_10019916 | Ga0307407_100199162 | 352 |
| 487 | 3300031995 | Ga0307409_100023682 | Ga0307409_1000236823 | 352 |
| 488 | 3300032002 | Ga0307416_100038762 | Ga0307416_1000387622 | 352 |
| 489 | 3300032004 | Ga0307414_10005718 | Ga0307414_100057182 | 352 |
| 490 | 3300005546 | Ga0070696_100005390 | Ga0070696_1000053905 | 353 |
| 491 | 3300005436 | Ga0070713_100062954 | Ga0070713_1000629542 | 354 |
| 492 | 3300005985 | Ga0081539_10000174 | Ga0081539_10000174130 | 354 |
| 493 | 3300009147 | Ga0114129_10738944 | Ga0114129_107389441 | 354 |
| 494 | 3300025928 | Ga0207700_10063341 | Ga0207700_100633412 | 354 |
| 495 | 3300005336 | Ga0070680_100018440 | Ga0070680_1000184402 | 357 |
| 496 | 3300005458 | Ga0070681_10013030 | Ga0070681_100130307 | 357 |
| 497 | 3300005530 | Ga0070679_100000940 | Ga0070679_10000094019 | 357 |
| 498 | 3300025912 | Ga0207707_10001274 | Ga0207707_1000127420 | 357 |
| 499 | 3300025917 | Ga0207660_10028418 | Ga0207660_100284184 | 357 |
| 500 | 3300025921 | Ga0207652_10003798 | Ga0207652_1000379811 | 357 |
| 501 | 3300005347 | Ga0070668_100046693 | Ga0070668_1000466932 | 358 |
| 502 | 3300005458 | Ga0070681_10207396 | Ga0070681_102073962 | 358 |
| 503 | 3300005548 | Ga0070665_100264590 | Ga0070665_1002645901 | 358 |
| 504 | 3300005614 | Ga0068856_100034774 | Ga0068856_1000347743 | 358 |
| 505 | 3300005616 | Ga0068852_100056074 | Ga0068852_1000560742 | 358 |
| 506 | 3300006914 | Ga0075436_100002168 | Ga0075436_1000021681 | 358 |
| 507 | 3300009093 | Ga0105240_10018268 | Ga0105240_100182684 | 358 |
| 508 | 3300013100 | Ga0157373_10070660 | Ga0157373_100706601 | 358 |
| 509 | 3300013104 | Ga0157370_10014177 | Ga0157370_100141775 | 358 |
| 510 | 3300013105 | Ga0157369_10004783 | Ga0157369_100047835 | 358 |
| 511 | 3300013307 | Ga0157372_10014215 | Ga0157372_100142155 | 358 |
| 512 | 3300014969 | Ga0157376_10007918 | Ga0157376_100079183 | 358 |
| 513 | 3300020070 | Ga0206356_11147558 | Ga0206356_111475582 | 358 |
| 514 | 3300025912 | Ga0207707_10036663 | Ga0207707_100366633 | 358 |
| 515 | 3300025912 | Ga0207707_10042475 | Ga0207707_100424752 | 358 |
| 516 | 3300025913 | Ga0207695_10309910 | Ga0207695_103099101 | 358 |
| 517 | 3300025921 | Ga0207652_10035111 | Ga0207652_100351112 | 358 |
| 518 | 3300025961 | Ga0207712_10001263 | Ga0207712_1000126310 | 358 |
| 519 | 3300026142 | Ga0207698_10048475 | Ga0207698_100484752 | 358 |
| 520 | 3300005295 | Ga0065707_10092301 | Ga0065707_100923013 | 359 |
| 521 | 3300005844 | Ga0068862_100105087 | Ga0068862_1001050871 | 359 |
| 522 | 3300006846 | Ga0075430_100053013 | Ga0075430_1000530134 | 359 |
| 523 | 3300009094 | Ga0111539_10048767 | Ga0111539_100487673 | 359 |
| 524 | 3300050511 | nmdc:mga08y16_47765_c1 | nmdc:mga08y16_47765_c1_1883_2962 | 359 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fk2-assembly1.cif.gz_B | the n-terminal vicr from streptococcus mutans | 0.9564 | 20 | 137 |
| 2a9r-assembly1.cif.gz_A-2 | rr02-rec phosphate in the active site | 0.9562 | 21 | 137 |
| 1nxt-assembly1.cif.gz_A-2 | micarec ph 4.0 | 0.9549 | 21 | 137 |
| 1nxx-assembly1.cif.gz_A-2 | micarec ph 5.5 | 0.9545 | 21 | 137 |
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.951 | 20 | 137 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9672 | 19 | 99 | 3.40.50.2300 |
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9558 | 19 | 99 | 3.40.50.2300 |
| 4d6yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9516 | 22 | 136 | 3.40.50.2300 |
| 1zy2A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9466 | 20 | 143 | 3.40.50.2300 |
| 1zy2B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9445 | 20 | 143 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A353LGX9-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.9699 | 19 | 139 |
GO:0000160
GO:0005524 GO:0006355 GO:0043565 |
| AF-A0A497IEC0-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.9685 | 18 | 144 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |
| AF-A0A7W7Y2B2-F1-model_v4 | DNA-binding NtrC family response regulator | 0.9635 | 20 | 138 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |
| AF-A0A1G1I1A7-F1-model_v4 | Response regulatory domain-containing protein | 0.9633 | 20 | 138 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A419DN44-F1-model_v4 | DNA-binding response regulator | 0.9624 | 20 | 130 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar