F459018
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 523 | 277 | 1046 | 386 |
Family's Representative Sequence
| Representative Sequence | 3300039450|Ga0436363_0028770|Ga0436363_0028770_1368_2648 |
| Length | 426 |
| Sequence | MPGSLRSVEEHRRIVAELIAAQPATMATLADAEGLVLAHDIVAEVPLPVFDNSAMDGYAVRADDIASAAADHPVKLPVAEDIPAGRTDIPTLERGTAHRIMTGAPLPAGATAVVPVEATDGRTDIVSIRVAVDEGRHVRHAGEDVAAGTTVLRAGQLVTPAVIGLAAALGLPALAVIPRQRVLVVSTGSELVLPGNPLQPGQIYESNAVMLAAAVRDAGATVVAIATSGDDVAEFAAVLDRYAAESDLIITSGGVSAGAYEVVKDAFGRAGDQGVEFAKVAMQPGMPQGTGRVAGTPIVALPGNPVSALVSFEVFIRPALRVAMGLPAPQRPRRTAVLTETVTSPGGKRQFRRGVLDAAAGTVTSYGPPASHHLRWLASANCLLEIGEDVVEMSAGSQVQVWDLAGFCQGPSSVESGRWPDAHQRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 38 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 40 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 41 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 54 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 89 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 134 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 135 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 136 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 137 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 138 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 139 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 140 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 144 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 145 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 146 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 147 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 148 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 149 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 150 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 151 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 152 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 159 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 160 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 161 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 162 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 163 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 164 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 165 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 166 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 169 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 170 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 174 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 175 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 176 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 177 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 193 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 194 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 195 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 196 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 197 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 198 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 199 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 201 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 202 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 203 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 204 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 205 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 206 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 207 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 208 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 209 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 210 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 211 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 212 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 213 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 214 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 215 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 216 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 217 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 233 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 234 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 235 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 237 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 241 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 242 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 243 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 244 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 245 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 246 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 247 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 248 | 2523231044 | Gordonia rhizosphera NBRC 16068 | Isolate | Rhizosphere |
| 249 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 250 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 251 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 252 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 253 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 254 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 255 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 256 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 257 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 258 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 259 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 260 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 261 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 262 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 263 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 264 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 265 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 266 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 267 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 268 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 269 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 270 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 271 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 272 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 273 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 274 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 275 | 2966921586 | Rathayibacter agropyri 617 | Isolate | Rhizosphere |
| 276 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 277 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.26 |
| Metatranscriptomes | 0 |
| Isolates | 5.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.24 |
| Nodule | 0.19 |
| Rhizoplane | 12.62 |
| Rhizosphere | 61.38 |
| Stem | 0 |
| Stem Tuber | 0.19 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436363_0028770 | 3300039450 | Bacteria | 2838 |
| 2 | JGI24744J21845_10000121 | 3300002077 | Bacteria | 10835 |
| 3 | JGI24742J22300_10001105 | 3300002244 | Bacteria | 4177 |
| 4 | Ga0055540_1000049 | 3300003792 | Bacteria | 146100 |
| 5 | Ga0055540_1001186 | 3300003792 | Bacteria | 16069 |
| 6 | Ga0055540_1007323 | 3300003792 | Bacteria | 4190 |
| 7 | Ga0070676_10146308 | 3300005328 | Bacteria | 1508 |
| 8 | Ga0070683_100190268 | 3300005329 | Bacteria | 1948 |
| 9 | Ga0070690_100011113 | 3300005330 | Bacteria | 5258 |
| 10 | Ga0068869_100024517 | 3300005334 | Bacteria | 4178 |
| 11 | Ga0068869_100026753 | 3300005334 | Bacteria | 4017 |
| 12 | Ga0068868_100211097 | 3300005338 | Bacteria | 1622 |
| 13 | Ga0070689_100004530 | 3300005340 | Bacteria | 9408 |
| 14 | Ga0070668_100001480 | 3300005347 | Bacteria | 16964 |
| 15 | Ga0070668_100002708 | 3300005347 | Bacteria | 13042 |
| 16 | Ga0070668_100003755 | 3300005347 | Bacteria | 11204 |
| 17 | Ga0070668_100021242 | 3300005347 | Bacteria | 4907 |
| 18 | Ga0070669_100005973 | 3300005353 | Bacteria | 8784 |
| 19 | Ga0070671_100002378 | 3300005355 | Bacteria | 14535 |
| 20 | Ga0070671_100057641 | 3300005355 | Bacteria | 3232 |
| 21 | Ga0070671_100195491 | 3300005355 | Bacteria | 1715 |
| 22 | Ga0070674_100010917 | 3300005356 | Bacteria | 5509 |
| 23 | Ga0070674_100078459 | 3300005356 | Bacteria | 2353 |
| 24 | Ga0070688_100000634 | 3300005365 | Bacteria | 17482 |
| 25 | Ga0070688_100174163 | 3300005365 | Bacteria | 1487 |
| 26 | Ga0070659_100120871 | 3300005366 | Bacteria | 2121 |
| 27 | Ga0070667_100000029 | 3300005367 | Bacteria | 178990 |
| 28 | Ga0070667_100002385 | 3300005367 | Bacteria | 16455 |
| 29 | Ga0070667_100006249 | 3300005367 | Bacteria | 9904 |
| 30 | Ga0070709_10127242 | 3300005434 | Bacteria | 1735 |
| 31 | Ga0070714_100041118 | 3300005435 | Bacteria | 3900 |
| 32 | Ga0070713_100052673 | 3300005436 | Bacteria | 3370 |
| 33 | Ga0070710_10002244 | 3300005437 | Bacteria | 9143 |
| 34 | Ga0070710_10004356 | 3300005437 | Bacteria | 6705 |
| 35 | Ga0070711_100002139 | 3300005439 | Bacteria | 11203 |
| 36 | Ga0070705_100002682 | 3300005440 | Bacteria | 8898 |
| 37 | Ga0070705_100007551 | 3300005440 | Bacteria | 5354 |
| 38 | Ga0070700_100005654 | 3300005441 | Bacteria | 6634 |
| 39 | Ga0070694_100029559 | 3300005444 | Bacteria | 3577 |
| 40 | Ga0070663_100013316 | 3300005455 | Bacteria | 5239 |
| 41 | Ga0070663_100044928 | 3300005455 | Bacteria | 3118 |
| 42 | Ga0070678_100000705 | 3300005456 | Bacteria | 16534 |
| 43 | Ga0070662_100000781 | 3300005457 | Bacteria | 19629 |
| 44 | Ga0070662_100058684 | 3300005457 | Bacteria | 2801 |
| 45 | Ga0068867_100001331 | 3300005459 | Bacteria | 17105 |
| 46 | Ga0070684_100196684 | 3300005535 | Bacteria | 1836 |
| 47 | Ga0068853_100003298 | 3300005539 | Bacteria | 12348 |
| 48 | Ga0068853_100048969 | 3300005539 | Bacteria | 3630 |
| 49 | Ga0070695_100005235 | 3300005545 | Bacteria | 7649 |
| 50 | Ga0070665_100026226 | 3300005548 | Bacteria | 5869 |
| 51 | Ga0070665_100069234 | 3300005548 | Bacteria | 3537 |
| 52 | Ga0070665_100176119 | 3300005548 | Bacteria | 2140 |
| 53 | Ga0070704_100001287 | 3300005549 | Bacteria | 13261 |
| 54 | Ga0070704_100010537 | 3300005549 | Bacteria | 5628 |
| 55 | Ga0068855_100283544 | 3300005563 | Bacteria | 1839 |
| 56 | Ga0070664_100145548 | 3300005564 | Bacteria | 2089 |
| 57 | Ga0068854_100001080 | 3300005578 | Bacteria | 16413 |
| 58 | Ga0068854_100084756 | 3300005578 | Bacteria | 2345 |
| 59 | Ga0070702_100000284 | 3300005615 | Bacteria | 17332 |
| 60 | Ga0068852_100072347 | 3300005616 | Bacteria | 3030 |
| 61 | Ga0068852_100281499 | 3300005616 | Bacteria | 1603 |
| 62 | Ga0068859_100001467 | 3300005617 | Bacteria | 24018 |
| 63 | Ga0068859_100004146 | 3300005617 | Bacteria | 14802 |
| 64 | Ga0068864_100130803 | 3300005618 | Bacteria | 2254 |
| 65 | Ga0068864_100253903 | 3300005618 | Bacteria | 1633 |
| 66 | Ga0068866_10000683 | 3300005718 | Bacteria | 15439 |
| 67 | Ga0068861_100001239 | 3300005719 | Bacteria | 15906 |
| 68 | Ga0068863_100000465 | 3300005841 | Bacteria | 41376 |
| 69 | Ga0068863_100012538 | 3300005841 | Bacteria | 8179 |
| 70 | Ga0068858_100005427 | 3300005842 | Bacteria | 12491 |
| 71 | Ga0068858_100020008 | 3300005842 | Bacteria | 6260 |
| 72 | Ga0068860_100000088 | 3300005843 | Bacteria | 154416 |
| 73 | Ga0068860_100147970 | 3300005843 | Bacteria | 2261 |
| 74 | Ga0068862_100000056 | 3300005844 | Bacteria | 142257 |
| 75 | Ga0068862_100006390 | 3300005844 | Bacteria | 9799 |
| 76 | Ga0081455_10000037 | 3300005937 | Bacteria | 136059 |
| 77 | Ga0081455_10115786 | 3300005937 | Bacteria | 2121 |
| 78 | Ga0081538_10067437 | 3300005981 | Bacteria | 1998 |
| 79 | Ga0081540_1023668 | 3300005983 | Bacteria | 3585 |
| 80 | Ga0081539_10000027 | 3300005985 | Bacteria | 328691 |
| 81 | Ga0070717_10006935 | 3300006028 | Bacteria | 8371 |
| 82 | Ga0070717_10127140 | 3300006028 | Bacteria | 2189 |
| 83 | Ga0075365_10006627 | 3300006038 | Bacteria | 6391 |
| 84 | Ga0075365_10014230 | 3300006038 | Bacteria | 4782 |
| 85 | Ga0075365_10026748 | 3300006038 | Bacteria | 3666 |
| 86 | Ga0075365_10029399 | 3300006038 | Bacteria | 3512 |
| 87 | Ga0075363_100000041 | 3300006048 | Bacteria | 24416 |
| 88 | Ga0075363_100000435 | 3300006048 | Bacteria | 13030 |
| 89 | Ga0075363_100000516 | 3300006048 | Bacteria | 12417 |
| 90 | Ga0075363_100007919 | 3300006048 | Bacteria | 4921 |
| 91 | Ga0075364_10013206 | 3300006051 | Bacteria | 5071 |
| 92 | Ga0075364_10014042 | 3300006051 | Bacteria | 4940 |
| 93 | Ga0075364_10014673 | 3300006051 | Bacteria | 4846 |
| 94 | Ga0075364_10015251 | 3300006051 | Bacteria | 4762 |
| 95 | Ga0075364_10023795 | 3300006051 | Bacteria | 3881 |
| 96 | Ga0075364_10089322 | 3300006051 | Bacteria | 2043 |
| 97 | Ga0070715_10002952 | 3300006163 | Bacteria | 5316 |
| 98 | Ga0070716_100003099 | 3300006173 | Bacteria | 7763 |
| 99 | Ga0070712_100000620 | 3300006175 | Bacteria | 20853 |
| 100 | Ga0075362_10018107 | 3300006177 | Bacteria | 2910 |
| 101 | Ga0075362_10020122 | 3300006177 | Bacteria | 2786 |
| 102 | Ga0075362_10076474 | 3300006177 | Bacteria | 1537 |
| 103 | Ga0075367_10002795 | 3300006178 | Bacteria | 8092 |
| 104 | Ga0075369_10002281 | 3300006186 | Bacteria | 6811 |
| 105 | Ga0075369_10010502 | 3300006186 | Bacteria | 3622 |
| 106 | Ga0075369_10011212 | 3300006186 | Bacteria | 3522 |
| 107 | Ga0075369_10026568 | 3300006186 | Bacteria | 2414 |
| 108 | Ga0075369_10069546 | 3300006186 | Bacteria | 1548 |
| 109 | Ga0075370_10000847 | 3300006353 | Bacteria | 12393 |
| 110 | Ga0075370_10025187 | 3300006353 | Bacteria | 3288 |
| 111 | Ga0075428_100014431 | 3300006844 | Bacteria | 8777 |
| 112 | Ga0075430_100047321 | 3300006846 | Bacteria | 3631 |
| 113 | Ga0075430_100195133 | 3300006846 | Bacteria | 1682 |
| 114 | Ga0075431_100031921 | 3300006847 | Bacteria | 5426 |
| 115 | Ga0068865_100000595 | 3300006881 | Bacteria | 20259 |
| 116 | Ga0097620_100001467 | 3300006931 | Bacteria | 24018 |
| 117 | Ga0097620_100004146 | 3300006931 | Bacteria | 14802 |
| 118 | Ga0105240_10284077 | 3300009093 | Bacteria | 1900 |
| 119 | Ga0105245_10000753 | 3300009098 | Bacteria | 29286 |
| 120 | Ga0105245_10063502 | 3300009098 | Bacteria | 3335 |
| 121 | Ga0105245_10133775 | 3300009098 | Bacteria | 2328 |
| 122 | Ga0105245_10270129 | 3300009098 | Bacteria | 1658 |
| 123 | Ga0105247_10000008 | 3300009101 | Bacteria | 391450 |
| 124 | Ga0105247_10001050 | 3300009101 | Bacteria | 20695 |
| 125 | Ga0105243_10000842 | 3300009148 | Bacteria | 29157 |
| 126 | Ga0105243_10139381 | 3300009148 | Bacteria | 2067 |
| 127 | Ga0105241_10065721 | 3300009174 | Bacteria | 2803 |
| 128 | Ga0105242_10000885 | 3300009176 | Bacteria | 23245 |
| 129 | Ga0105248_10000051 | 3300009177 | Bacteria | 150288 |
| 130 | Ga0105248_10158682 | 3300009177 | Bacteria | 2552 |
| 131 | Ga0105237_10007605 | 3300009545 | Bacteria | 11841 |
| 132 | Ga0105237_10196757 | 3300009545 | Bacteria | 2016 |
| 133 | Ga0105237_10236862 | 3300009545 | Bacteria | 1826 |
| 134 | Ga0105238_10107324 | 3300009551 | Bacteria | 2773 |
| 135 | Ga0105238_10318444 | 3300009551 | Bacteria | 1541 |
| 136 | Ga0105249_10000040 | 3300009553 | Bacteria | 196153 |
| 137 | Ga0105249_10002280 | 3300009553 | Bacteria | 16659 |
| 138 | Ga0105249_10014474 | 3300009553 | Bacteria | 6973 |
| 139 | Ga0105249_10179497 | 3300009553 | Bacteria | 2059 |
| 140 | Ga0105239_10003892 | 3300010375 | Bacteria | 18093 |
| 141 | Ga0105239_10022266 | 3300010375 | Bacteria | 6985 |
| 142 | Ga0105246_10043427 | 3300011119 | Bacteria | 3050 |
| 143 | Ga0157369_10074635 | 3300013105 | Bacteria | 3637 |
| 144 | Ga0157378_10003960 | 3300013297 | Bacteria | 13087 |
| 145 | Ga0163162_10003429 | 3300013306 | Bacteria | 15136 |
| 146 | Ga0163162_10085191 | 3300013306 | Bacteria | 3237 |
| 147 | Ga0163162_10510151 | 3300013306 | Bacteria | 1333 |
| 148 | Ga0157375_10000340 | 3300013308 | Bacteria | 42196 |
| 149 | Ga0157380_10000251 | 3300014326 | Bacteria | 32377 |
| 150 | Ga0157380_10115729 | 3300014326 | Bacteria | 2262 |
| 151 | Ga0157379_10002200 | 3300014968 | Bacteria | 16223 |
| 152 | Ga0157376_10293299 | 3300014969 | Bacteria | 1536 |
| 153 | Ga0163161_10000280 | 3300017792 | Bacteria | 44602 |
| 154 | Ga0213876_10000845 | 3300021384 | Bacteria | 20595 |
| 155 | Ga0213876_10057985 | 3300021384 | Bacteria | 2044 |
| 156 | Ga0213876_10087013 | 3300021384 | Bacteria | 1654 |
| 157 | Ga0213876_10095002 | 3300021384 | Bacteria | 1579 |
| 158 | Ga0209673_1012854 | 3300025273 | Bacteria | 3343 |
| 159 | Ga0209051_1000034 | 3300025303 | Bacteria | 371498 |
| 160 | Ga0209051_1011403 | 3300025303 | Bacteria | 4390 |
| 161 | Ga0209051_1021238 | 3300025303 | Bacteria | 2770 |
| 162 | Ga0207642_10002542 | 3300025899 | Bacteria | 5678 |
| 163 | Ga0207710_10000006 | 3300025900 | Bacteria | 538831 |
| 164 | Ga0207685_10003925 | 3300025905 | Bacteria | 3695 |
| 165 | Ga0207685_10005007 | 3300025905 | Bacteria | 3444 |
| 166 | Ga0207699_10006468 | 3300025906 | Bacteria | 5676 |
| 167 | Ga0207699_10021481 | 3300025906 | Bacteria | 3479 |
| 168 | Ga0207671_10012980 | 3300025914 | Bacteria | 6663 |
| 169 | Ga0207693_10000806 | 3300025915 | Bacteria | 28060 |
| 170 | Ga0207693_10002376 | 3300025915 | Bacteria | 16344 |
| 171 | Ga0207663_10019762 | 3300025916 | Bacteria | 3802 |
| 172 | Ga0207662_10108409 | 3300025918 | Bacteria | 1729 |
| 173 | Ga0207657_10041417 | 3300025919 | Bacteria | 4073 |
| 174 | Ga0207657_10093353 | 3300025919 | Bacteria | 2507 |
| 175 | Ga0207681_10004258 | 3300025923 | Bacteria | 8833 |
| 176 | Ga0207681_10004678 | 3300025923 | Bacteria | 8421 |
| 177 | Ga0207681_10087506 | 3300025923 | Bacteria | 2217 |
| 178 | Ga0207687_10003359 | 3300025927 | Bacteria | 10814 |
| 179 | Ga0207700_10085353 | 3300025928 | Bacteria | 2478 |
| 180 | Ga0207664_10040831 | 3300025929 | Bacteria | 3611 |
| 181 | Ga0207664_10117965 | 3300025929 | Bacteria | 2216 |
| 182 | Ga0207644_10004046 | 3300025931 | Bacteria | 9510 |
| 183 | Ga0207644_10025202 | 3300025931 | Bacteria | 4089 |
| 184 | Ga0207644_10152928 | 3300025931 | Bacteria | 1787 |
| 185 | Ga0207706_10005681 | 3300025933 | Bacteria | 11617 |
| 186 | Ga0207706_10024426 | 3300025933 | Bacteria | 5418 |
| 187 | Ga0207706_10036400 | 3300025933 | Bacteria | 4371 |
| 188 | Ga0207706_10155906 | 3300025933 | Bacteria | 2008 |
| 189 | Ga0207709_10003804 | 3300025935 | Bacteria | 8862 |
| 190 | Ga0207670_10005801 | 3300025936 | Bacteria | 6815 |
| 191 | Ga0207669_10000179 | 3300025937 | Bacteria | 29393 |
| 192 | Ga0207704_10000844 | 3300025938 | Bacteria | 13592 |
| 193 | Ga0207665_10006775 | 3300025939 | Bacteria | 7588 |
| 194 | Ga0207691_10094099 | 3300025940 | Bacteria | 2682 |
| 195 | Ga0207711_10000811 | 3300025941 | Bacteria | 30675 |
| 196 | Ga0207689_10005658 | 3300025942 | Bacteria | 11121 |
| 197 | Ga0207689_10019792 | 3300025942 | Bacteria | 5669 |
| 198 | Ga0207689_10033519 | 3300025942 | Bacteria | 4268 |
| 199 | Ga0207712_10000017 | 3300025961 | Bacteria | 337943 |
| 200 | Ga0207712_10036837 | 3300025961 | Bacteria | 3334 |
| 201 | Ga0207712_10131364 | 3300025961 | Bacteria | 1909 |
| 202 | Ga0207668_10008413 | 3300025972 | Bacteria | 6149 |
| 203 | Ga0207668_10019592 | 3300025972 | Bacteria | 4279 |
| 204 | Ga0207668_10100437 | 3300025972 | Bacteria | 2148 |
| 205 | Ga0207668_10129984 | 3300025972 | Bacteria | 1922 |
| 206 | Ga0207640_10002497 | 3300025981 | Bacteria | 9856 |
| 207 | Ga0207658_10000016 | 3300025986 | Bacteria | 215618 |
| 208 | Ga0207658_10001453 | 3300025986 | Bacteria | 18468 |
| 209 | Ga0207658_10012328 | 3300025986 | Bacteria | 5835 |
| 210 | Ga0207677_10003614 | 3300026023 | Bacteria | 8200 |
| 211 | Ga0207703_10002078 | 3300026035 | Bacteria | 17601 |
| 212 | Ga0207703_10022295 | 3300026035 | Bacteria | 4965 |
| 213 | Ga0207639_10074758 | 3300026041 | Bacteria | 2662 |
| 214 | Ga0207678_10000108 | 3300026067 | Bacteria | 67848 |
| 215 | Ga0207678_10005674 | 3300026067 | Bacteria | 11152 |
| 216 | Ga0207678_10018894 | 3300026067 | Bacteria | 6055 |
| 217 | Ga0207708_10005354 | 3300026075 | Bacteria | 9452 |
| 218 | Ga0207708_10020280 | 3300026075 | Bacteria | 5013 |
| 219 | Ga0207641_10000564 | 3300026088 | Bacteria | 41406 |
| 220 | Ga0207641_10004585 | 3300026088 | Bacteria | 11937 |
| 221 | Ga0207648_10001139 | 3300026089 | Bacteria | 29879 |
| 222 | Ga0207648_10073013 | 3300026089 | Bacteria | 2990 |
| 223 | Ga0207648_10109035 | 3300026089 | Bacteria | 2430 |
| 224 | Ga0207676_10228087 | 3300026095 | Bacteria | 1663 |
| 225 | Ga0207674_10279782 | 3300026116 | Bacteria | 1616 |
| 226 | Ga0207675_100002192 | 3300026118 | Bacteria | 19401 |
| 227 | Ga0207675_100133234 | 3300026118 | Bacteria | 2357 |
| 228 | Ga0207683_10000390 | 3300026121 | Bacteria | 40388 |
| 229 | Ga0207683_10023579 | 3300026121 | Bacteria | 5294 |
| 230 | Ga0207683_10175100 | 3300026121 | Bacteria | 1944 |
| 231 | Ga0207698_10064759 | 3300026142 | Bacteria | 2867 |
| 232 | Ga0268266_10006132 | 3300028379 | Bacteria | 11065 |
| 233 | Ga0268266_10035902 | 3300028379 | Bacteria | 4216 |
| 234 | Ga0268266_10231506 | 3300028379 | Bacteria | 1702 |
| 235 | Ga0268265_10000068 | 3300028380 | Bacteria | 142272 |
| 236 | Ga0268264_10000056 | 3300028381 | Bacteria | 310339 |
| 237 | Ga0268264_10007790 | 3300028381 | Bacteria | 8918 |
| 238 | Ga0268264_10123733 | 3300028381 | Bacteria | 2283 |
| 239 | Ga0265327_10000004 | 3300031251 | Bacteria | 803973 |
| 240 | Ga0265327_10000274 | 3300031251 | Bacteria | 101723 |
| 241 | Ga0265327_10007084 | 3300031251 | Bacteria | 8770 |
| 242 | Ga0265327_10007871 | 3300031251 | Bacteria | 8092 |
| 243 | Ga0307513_10060222 | 3300031456 | Bacteria | 4025 |
| 244 | Ga0307513_10070895 | 3300031456 | Bacteria | 3639 |
| 245 | Ga0307513_10078908 | 3300031456 | Bacteria | 3403 |
| 246 | Ga0307413_10000679 | 3300031824 | Bacteria | 11594 |
| 247 | Ga0307518_10001566 | 3300031838 | Bacteria | 16907 |
| 248 | Ga0307410_10092935 | 3300031852 | Bacteria | 2146 |
| 249 | Ga0307406_10025644 | 3300031901 | Bacteria | 3531 |
| 250 | Ga0307409_100005629 | 3300031995 | Bacteria | 7247 |
| 251 | Ga0307409_100081348 | 3300031995 | Bacteria | 2618 |
| 252 | Ga0307409_100147494 | 3300031995 | Bacteria | 2037 |
| 253 | Ga0307416_100013931 | 3300032002 | Bacteria | 5485 |
| 254 | Ga0307411_10001739 | 3300032005 | Bacteria | 9175 |
| 255 | Ga0307415_100009079 | 3300032126 | Bacteria | 5552 |
| 256 | Ga0307507_10004841 | 3300033179 | Bacteria | 23134 |
| 257 | Ga0307507_10193725 | 3300033179 | Bacteria | 1422 |
| 258 | Ga0307510_10041437 | 3300033180 | Bacteria | 5033 |
| 259 | Ga0373956_0002749 | 3300035119 | Bacteria | 7113 |
| 260 | Ga0395900_0178123 | 3300037418 | Bacteria | 2162 |
| 261 | Ga0436364_0230724 | 3300037853 | Bacteria | 7135 |
| 262 | Ga0436364_0741966 | 3300037853 | Bacteria | 1869 |
| 263 | Ga0436364_1215586 | 3300037853 | Bacteria | 29880 |
| 264 | Ga0436365_0139519 | 3300039437 | Bacteria | 6857 |
| 265 | Ga0436365_0375738 | 3300039437 | Bacteria | 15027 |
| 266 | Ga0436365_0433207 | 3300039437 | Archaea | 2503 |
| 267 | Ga0436365_0596616 | 3300039437 | Bacteria | 14936 |
| 268 | Ga0436365_0725179 | 3300039437 | Bacteria | 20604 |
| 269 | Ga0436365_0968026 | 3300039437 | Bacteria | 6675 |
| 270 | Ga0436365_1564100 | 3300039437 | Bacteria | 3264 |
| 271 | Ga0439461_0003658 | 3300041410 | Bacteria | 2535 |
| 272 | Ga0439466_0006203 | 3300041411 | Bacteria | 4551 |
| 273 | Ga0439466_0020448 | 3300041411 | Bacteria | 2359 |
| 274 | Ga0439465_0000928 | 3300041413 | Bacteria | 9300 |
| 275 | Ga0439465_0008747 | 3300041413 | Bacteria | 3191 |
| 276 | Ga0451789_0001997 | 3300041443 | Bacteria | 2172 |
| 277 | Ga0451791_0236912 | 3300041451 | Bacteria | 5069 |
| 278 | Ga0451793_0021053 | 3300041452 | Bacteria | 13856 |
| 279 | Ga0451793_0686156 | 3300041452 | Bacteria | 2775 |
| 280 | Ga0451797_0471812 | 3300041453 | Bacteria | 1708 |
| 281 | Ga0451802_1089581 | 3300041460 | Bacteria | 3589 |
| 282 | Ga0451807_0709980 | 3300041486 | Bacteria | 2488 |
| 283 | Ga0451853_0992271 | 3300041512 | Bacteria | 5789 |
| 284 | Ga0439431_0001493 | 3300041997 | Bacteria | 5167 |
| 285 | Ga0439431_0004839 | 3300041997 | Bacteria | 2967 |
| 286 | Ga0439445_0001493 | 3300042004 | Bacteria | 5091 |
| 287 | Ga0439448_0031674 | 3300042005 | Bacteria | 1680 |
| 288 | Ga0439434_0011538 | 3300042435 | Bacteria | 2613 |
| 289 | Ga0466969_0011144 | 3300044656 | Bacteria | 4762 |
| 290 | Ga0466972_0002603 | 3300044658 | Bacteria | 8946 |
| 291 | Ga0466972_0073129 | 3300044658 | Bacteria | 1634 |
| 292 | Ga0466965_0004625 | 3300044683 | Bacteria | 6130 |
| 293 | Ga0466965_0004787 | 3300044683 | Bacteria | 6036 |
| 294 | Ga0466965_0004921 | 3300044683 | Bacteria | 5973 |
| 295 | Ga0466965_0093244 | 3300044683 | Bacteria | 1534 |
| 296 | Ga0466966_0004932 | 3300044684 | Bacteria | 8778 |
| 297 | Ga0466966_0013380 | 3300044684 | Bacteria | 5431 |
| 298 | Ga0466966_0114196 | 3300044684 | Bacteria | 1663 |
| 299 | Ga0466961_0007362 | 3300044693 | Bacteria | 7001 |
| 300 | Ga0466963_0051057 | 3300044694 | Bacteria | 2740 |
| 301 | Ga0466963_0154140 | 3300044694 | Bacteria | 1596 |
| 302 | Ga0466971_0024283 | 3300044719 | Bacteria | 2705 |
| 303 | Ga0466971_0027924 | 3300044719 | Bacteria | 2527 |
| 304 | Ga0466968_0001626 | 3300044735 | Bacteria | 8122 |
| 305 | Ga0466968_0007139 | 3300044735 | Bacteria | 4241 |
| 306 | Ga0466970_0024771 | 3300044765 | Bacteria | 3139 |
| 307 | Ga0466970_0051537 | 3300044765 | Bacteria | 2196 |
| 308 | Ga0466957_0009919 | 3300044842 | Bacteria | 5445 |
| 309 | Ga0466957_0034240 | 3300044842 | Bacteria | 3047 |
| 310 | Ga0466957_0234270 | 3300044842 | Bacteria | 1216 |
| 311 | Ga0466960_0000242 | 3300044901 | Bacteria | 18888 |
| 312 | Ga0466960_0000614 | 3300044901 | Bacteria | 12302 |
| 313 | Ga0466960_0085785 | 3300044901 | Bacteria | 1595 |
| 314 | Ga0466959_0010446 | 3300045049 | Bacteria | 6639 |
| 315 | Ga0466959_0011756 | 3300045049 | Bacteria | 6301 |
| 316 | Ga0466959_0017275 | 3300045049 | Bacteria | 5286 |
| 317 | Ga0466959_0047173 | 3300045049 | Bacteria | 3169 |
| 318 | Ga0466959_0111108 | 3300045049 | Bacteria | 1956 |
| 319 | Ga0466958_0001798 | 3300045836 | Bacteria | 10408 |
| 320 | Ga0466958_0041310 | 3300045836 | Bacteria | 2774 |
| 321 | Ga0466958_0080650 | 3300045836 | Bacteria | 2002 |
| 322 | Ga0466958_0100864 | 3300045836 | Bacteria | 1795 |
| 323 | Ga0466967_0004715 | 3300045976 | Bacteria | 9267 |
| 324 | Ga0466967_0011168 | 3300045976 | Bacteria | 6785 |
| 325 | Ga0466967_0015180 | 3300045976 | Bacteria | 6030 |
| 326 | Ga0466967_0027716 | 3300045976 | Bacteria | 4716 |
| 327 | Ga0466967_0051197 | 3300045976 | Bacteria | 3618 |
| 328 | Ga0466967_0051957 | 3300045976 | Bacteria | 3595 |
| 329 | Ga0466967_0067978 | 3300045976 | Bacteria | 3180 |
| 330 | Ga0466967_0217128 | 3300045976 | Bacteria | 1815 |
| 331 | Ga0466967_0231178 | 3300045976 | Bacteria | 1761 |
| 332 | Ga0495603_0057364 | 3300046455 | Bacteria | 2304 |
| 333 | Ga0495638_0009714 | 3300046460 | Bacteria | 6725 |
| 334 | Ga0495638_0015781 | 3300046460 | Bacteria | 5060 |
| 335 | Ga0495641_0012903 | 3300046461 | Bacteria | 4635 |
| 336 | Ga0495582_0097884 | 3300046473 | Bacteria | 1641 |
| 337 | Ga0495594_0046161 | 3300046499 | Bacteria | 2392 |
| 338 | Ga0495606_0029324 | 3300046507 | Bacteria | 3866 |
| 339 | Ga0495648_0004750 | 3300046524 | Bacteria | 11498 |
| 340 | Ga0495665_0052815 | 3300046531 | Bacteria | 2151 |
| 341 | Ga0495640_0011954 | 3300046533 | Bacteria | 6657 |
| 342 | Ga0495658_0044135 | 3300046683 | Bacteria | 2497 |
| 343 | Ga0495581_0015800 | 3300047315 | Bacteria | 4384 |
| 344 | Ga0495672_0001877 | 3300047320 | Bacteria | 20005 |
| 345 | Ga0495672_0029939 | 3300047320 | Bacteria | 3422 |
| 346 | Ga0495673_0001853 | 3300047469 | Bacteria | 15878 |
| 347 | Ga0495686_0003392 | 3300047472 | Bacteria | 13866 |
| 348 | Ga0496100_0000350 | 3300048903 | Bacteria | 22459 |
| 349 | Ga0496100_0003532 | 3300048903 | Bacteria | 8163 |
| 350 | Ga0496100_0012618 | 3300048903 | Bacteria | 4849 |
| 351 | Ga0496100_0050397 | 3300048903 | Bacteria | 2697 |
| 352 | Ga0496100_0248274 | 3300048903 | Bacteria | 1315 |
| 353 | Ga0496101_0000014 | 3300048904 | Bacteria | 253487 |
| 354 | Ga0496101_0000140 | 3300048904 | Bacteria | 63955 |
| 355 | Ga0496101_0000241 | 3300048904 | Bacteria | 40574 |
| 356 | Ga0496101_0006938 | 3300048904 | Bacteria | 7315 |
| 357 | Ga0496101_0259586 | 3300048904 | Bacteria | 1355 |
| 358 | Ga0496102_0000041 | 3300048905 | Bacteria | 196634 |
| 359 | Ga0496102_0000396 | 3300048905 | Bacteria | 50858 |
| 360 | Ga0496102_0001025 | 3300048905 | Bacteria | 26029 |
| 361 | Ga0496102_0002609 | 3300048905 | Bacteria | 15345 |
| 362 | Ga0496102_0009811 | 3300048905 | Bacteria | 8233 |
| 363 | Ga0496102_0053696 | 3300048905 | Bacteria | 3672 |
| 364 | Ga0496102_0056724 | 3300048905 | Bacteria | 3574 |
| 365 | Ga0496102_0063403 | 3300048905 | Bacteria | 3384 |
| 366 | Ga0496102_0113451 | 3300048905 | Bacteria | 2528 |
| 367 | Ga0496102_0164985 | 3300048905 | Bacteria | 2084 |
| 368 | Ga0496103_0000058 | 3300048906 | Bacteria | 141099 |
| 369 | Ga0496103_0000183 | 3300048906 | Bacteria | 63106 |
| 370 | Ga0496103_0001434 | 3300048906 | Bacteria | 15996 |
| 371 | Ga0496103_0028531 | 3300048906 | Bacteria | 3388 |
| 372 | Ga0496104_0014962 | 3300048907 | Bacteria | 7017 |
| 373 | Ga0496104_0062068 | 3300048907 | Bacteria | 3543 |
| 374 | Ga0496104_0087372 | 3300048907 | Bacteria | 2978 |
| 375 | Ga0496105_0014196 | 3300048908 | Bacteria | 6339 |
| 376 | Ga0496105_0209298 | 3300048908 | Bacteria | 1590 |
| 377 | Ga0496106_0000410 | 3300048909 | Bacteria | 30399 |
| 378 | Ga0496106_0000638 | 3300048909 | Bacteria | 25113 |
| 379 | Ga0496106_0013150 | 3300048909 | Bacteria | 6107 |
| 380 | Ga0496106_0093935 | 3300048909 | Bacteria | 2318 |
| 381 | Ga0496107_0000483 | 3300048910 | Bacteria | 21887 |
| 382 | Ga0496107_0002414 | 3300048910 | Bacteria | 12105 |
| 383 | Ga0496107_0042742 | 3300048910 | Bacteria | 3255 |
| 384 | Ga0496107_0043851 | 3300048910 | Bacteria | 3214 |
| 385 | Ga0496107_0089934 | 3300048910 | Bacteria | 2242 |
| 386 | Ga0496108_0001474 | 3300048911 | Bacteria | 18582 |
| 387 | Ga0496108_0011047 | 3300048911 | Bacteria | 7332 |
| 388 | Ga0496108_0310984 | 3300048911 | Bacteria | 1373 |
| 389 | Ga0496109_0000161 | 3300048912 | Bacteria | 65633 |
| 390 | Ga0496109_0006892 | 3300048912 | Bacteria | 9582 |
| 391 | Ga0496109_0077411 | 3300048912 | Bacteria | 3061 |
| 392 | Ga0496109_0091265 | 3300048912 | Bacteria | 2817 |
| 393 | Ga0496110_0010223 | 3300048913 | Bacteria | 7624 |
| 394 | Ga0496110_0054353 | 3300048913 | Bacteria | 3522 |
| 395 | Ga0496111_0029440 | 3300048914 | Bacteria | 3901 |
| 396 | Ga0496112_0003272 | 3300048915 | Bacteria | 13373 |
| 397 | Ga0496112_0022831 | 3300048915 | Bacteria | 5969 |
| 398 | Ga0496112_0155825 | 3300048915 | Bacteria | 2251 |
| 399 | Ga0496114_0000496 | 3300048917 | Bacteria | 28786 |
| 400 | Ga0496114_0016900 | 3300048917 | Bacteria | 5883 |
| 401 | Ga0496114_0018407 | 3300048917 | Bacteria | 5646 |
| 402 | Ga0496114_0089129 | 3300048917 | Bacteria | 2618 |
| 403 | Ga0496114_0179772 | 3300048917 | Bacteria | 1847 |
| 404 | Ga0496115_0000836 | 3300048918 | Bacteria | 22503 |
| 405 | Ga0496115_0010211 | 3300048918 | Bacteria | 7006 |
| 406 | Ga0496115_0020245 | 3300048918 | Bacteria | 5130 |
| 407 | Ga0496116_0000098 | 3300048919 | Bacteria | 196497 |
| 408 | Ga0496117_0000096 | 3300048920 | Bacteria | 196788 |
| 409 | Ga0496117_0001778 | 3300048920 | Bacteria | 29523 |
| 410 | Ga0496117_0054364 | 3300048920 | Bacteria | 2805 |
| 411 | Ga0496118_0000067 | 3300048921 | Bacteria | 207219 |
| 412 | Ga0496118_0000073 | 3300048921 | Bacteria | 196712 |
| 413 | Ga0496118_0000461 | 3300048921 | Bacteria | 67437 |
| 414 | Ga0496118_0023244 | 3300048921 | Bacteria | 5389 |
| 415 | Ga0496119_0032739 | 3300048922 | Bacteria | 3460 |
| 416 | Ga0496119_0037133 | 3300048922 | Bacteria | 3169 |
| 417 | Ga0496119_0128080 | 3300048922 | Bacteria | 1386 |
| 418 | Ga0496120_0003981 | 3300048923 | Bacteria | 12836 |
| 419 | Ga0496121_0000002 | 3300048924 | Bacteria | 1494588 |
| 420 | Ga0496121_0003647 | 3300048924 | Bacteria | 21657 |
| 421 | Ga0496122_0005035 | 3300048925 | Bacteria | 15982 |
| 422 | Ga0496123_0081650 | 3300048926 | Bacteria | 1963 |
| 423 | Ga0496124_0000002 | 3300048927 | Bacteria | 1494588 |
| 424 | Ga0496124_0066575 | 3300048927 | Bacteria | 2999 |
| 425 | Ga0496124_0103284 | 3300048927 | Bacteria | 2306 |
| 426 | Ga0496125_0000002 | 3300048928 | Bacteria | 1480920 |
| 427 | Ga0496125_0019362 | 3300048928 | Bacteria | 6422 |
| 428 | Ga0496126_0000009 | 3300048929 | Bacteria | 750350 |
| 429 | Ga0496126_0002602 | 3300048929 | Bacteria | 24056 |
| 430 | Ga0496126_0006511 | 3300048929 | Bacteria | 12997 |
| 431 | Ga0496126_0081736 | 3300048929 | Bacteria | 2855 |
| 432 | Ga0501032_0003558 | 3300049569 | Bacteria | 11874 |
| 433 | Ga0501032_0045328 | 3300049569 | Bacteria | 2974 |
| 434 | Ga0501034_0007804 | 3300049571 | Bacteria | 11385 |
| 435 | Ga0501034_0018322 | 3300049571 | Bacteria | 7183 |
| 436 | Ga0501036_0001947 | 3300049572 | Bacteria | 16022 |
| 437 | Ga0501036_0150244 | 3300049572 | Bacteria | 1965 |
| 438 | Ga0501037_0000190 | 3300049573 | Bacteria | 56966 |
| 439 | Ga0501037_0004900 | 3300049573 | Bacteria | 9740 |
| 440 | Ga0501043_0005724 | 3300049579 | Bacteria | 10011 |
| 441 | Ga0501046_0002953 | 3300049580 | Bacteria | 15736 |
| 442 | Ga0501047_0022934 | 3300049581 | Bacteria | 5992 |
| 443 | Ga0501048_0008880 | 3300049582 | Bacteria | 7566 |
| 444 | Ga0501069_0015660 | 3300049585 | Bacteria | 4065 |
| 445 | Ga0501069_0018824 | 3300049585 | Bacteria | 3729 |
| 446 | Ga0501070_0000521 | 3300049586 | Bacteria | 35236 |
| 447 | Ga0501070_0083993 | 3300049586 | Bacteria | 2636 |
| 448 | Ga0501073_0030923 | 3300049589 | Bacteria | 3822 |
| 449 | Ga0501073_0041823 | 3300049589 | Bacteria | 3237 |
| 450 | Ga0501073_0078338 | 3300049589 | Bacteria | 2300 |
| 451 | Ga0501080_0329863 | 3300049742 | Bacteria | 1380 |
| 452 | Ga0501083_0082153 | 3300049744 | Bacteria | 2135 |
| 453 | Ga0501035_0002236 | 3300049822 | Bacteria | 19181 |
| 454 | Ga0501044_0006785 | 3300049823 | Bacteria | 12621 |
| 455 | Ga0501044_0010888 | 3300049823 | Bacteria | 9870 |
| 456 | Ga0501044_0059390 | 3300049823 | Bacteria | 3918 |
| 457 | Ga0501044_0180260 | 3300049823 | Bacteria | 2080 |
| 458 | Ga0501044_0259411 | 3300049823 | Bacteria | 1677 |
| 459 | nmdc:mga03n38_161_c1 | 3300050490 | Bacteria | 14893 |
| 460 | nmdc:mga03n38_2311_c1 | 3300050490 | Bacteria | 5850 |
| 461 | nmdc:mga03n38_602_c1 | 3300050490 | Bacteria | 9185 |
| 462 | nmdc:mga03n38_9240_c1 | 3300050490 | Bacteria | 3576 |
| 463 | nmdc:mga00v17_24305_c1 | 3300050491 | Bacteria | 3513 |
| 464 | nmdc:mga00v17_25563_c1 | 3300050491 | Bacteria | 3433 |
| 465 | nmdc:mga00v17_2765_c1 | 3300050491 | Bacteria | 4856 |
| 466 | nmdc:mga00v17_42677_c1 | 3300050491 | Bacteria | 2729 |
| 467 | nmdc:mga00v17_4515_c1 | 3300050491 | Bacteria | 7245 |
| 468 | nmdc:mga00v17_76716_c1 | 3300050491 | Bacteria | 2080 |
| 469 | nmdc:mga0yw44_30655_c1 | 3300050492 | Bacteria | 3119 |
| 470 | nmdc:mga0yw44_88623_c1 | 3300050492 | Bacteria | 1951 |
| 471 | nmdc:mga06z11_1000_c1 | 3300050494 | Bacteria | 10307 |
| 472 | nmdc:mga06z11_119559_c1 | 3300050494 | Bacteria | 1468 |
| 473 | nmdc:mga06z11_173553_c1 | 3300050494 | Bacteria | 1239 |
| 474 | nmdc:mga07m45_199_c1 | 3300050496 | Bacteria | 23682 |
| 475 | nmdc:mga07m45_33544_c1 | 3300050496 | Bacteria | 2851 |
| 476 | nmdc:mga05p37_69209_c1 | 3300050507 | Bacteria | 4341 |
| 477 | nmdc:mga0qj67_135025_c1 | 3300050509 | Bacteria | 1999 |
| 478 | nmdc:mga06r32_2284_c4 | 3300050510 | Bacteria | 7415 |
| 479 | nmdc:mga0sz30_1229_c1 | 3300050516 | Bacteria | 7305 |
| 480 | nmdc:mga0sz30_1451_c1 | 3300050516 | Bacteria | 8465 |
| 481 | nmdc:mga0sz30_16335_c1 | 3300050516 | Bacteria | 1656 |
| 482 | nmdc:mga0sz30_18394_c1 | 3300050516 | Bacteria | 2796 |
| 483 | nmdc:mga0sz30_26345_c1 | 3300050516 | Bacteria | 2382 |
| 484 | nmdc:mga0sz30_7440_c1 | 3300050516 | Bacteria | 4106 |
| 485 | nmdc:mga0sz30_8052_c1 | 3300050516 | Bacteria | 3970 |
| 486 | Ga0500610_0004842 | 3300053079 | Bacteria | 5422 |
| 487 | Ga0500635_0001649 | 3300053080 | Bacteria | 5390 |
| 488 | Ga0500643_007886 | 3300053087 | Bacteria | 4241 |
| 489 | Ga0500646_0025707 | 3300053090 | Bacteria | 1592 |
| 490 | Ga0500556_0007032 | 3300053104 | Bacteria | 3211 |
| 491 | Ga0500652_004959 | 3300053131 | Bacteria | 4161 |
| 492 | Ga0500645_000031 | 3300053730 | Bacteria | 119643 |
| 493 | Ga0500645_013611 | 3300053730 | Bacteria | 2607 |
| 494 | 2523382366 | 2523231044 | Bacteria | 6434991 |
| 495 | 2583149241 | 2582580736 | Bacteria | 5325865 |
| 496 | 2586057814 | 2585427649 | Bacteria | 9053857 |
| 497 | 2644487344 | 2643221687 | Bacteria | 6500351 |
| 498 | 2644638955 | 2643221715 | Bacteria | 6671032 |
| 499 | 2738665791 | 2738541264 | Bacteria | 5935393 |
| 500 | 2738702628 | 2738541274 | Bacteria | 6909446 |
| 501 | 2739144925 | 2738541356 | Bacteria | 5935017 |
| 502 | 2739329538 | 2738543028 | Bacteria | 6917070 |
| 503 | 2753037389 | 2751185725 | Bacteria | 5740550 |
| 504 | 2753325258 | 2751185792 | Bacteria | 5739090 |
| 505 | 2791916640 | 2791354901 | Bacteria | 8322202 |
| 506 | 2809593352 | 2808606522 | Bacteria | 9488490 |
| 507 | 2842135157 | 2842134933 | Bacteria | 5847019 |
| 508 | 2866612680 | 2866612099 | Bacteria | 7543886 |
| 509 | 2870782988 | 2870782633 | Bacteria | 9624083 |
| 510 | 2899366002 | 2899359706 | Bacteria | 10940472 |
| 511 | 2899374832 | 2899370129 | Bacteria | 6781179 |
| 512 | 2902794430 | 2902792274 | Bacteria | 7270173 |
| 513 | 2902803224 | 2902799365 | Bacteria | 5419524 |
| 514 | 2902814081 | 2902810491 | Bacteria | 6794147 |
| 515 | 2902839446 | 2902837492 | Bacteria | 6697721 |
| 516 | 2915768989 | 2915768154 | Bacteria | 8424322 |
| 517 | 2917740693 | 2917736166 | Bacteria | 9690793 |
| 518 | 2929213175 | 2929212328 | Bacteria | 7708288 |
| 519 | 2939587104 | 2939582691 | Bacteria | 7088898 |
| 520 | 2956942207 | 2956939328 | Bacteria | 3474458 |
| 521 | 2966922261 | 2966921586 | Bacteria | 3092803 |
| 522 | 3001121955 | 3001119090 | Bacteria | 3449530 |
| 523 | 8003319726 | 8003314358 | Bacteria | 10575343 |
| 524 | Ga0436363_0028770 | |||
| 525 | JGI24744J21845_10000121 | |||
| 526 | JGI24742J22300_10001105 | |||
| 527 | Ga0055540_1000049 | |||
| 528 | Ga0055540_1001186 | |||
| 529 | Ga0055540_1007323 | |||
| 530 | Ga0070676_10146308 | |||
| 531 | Ga0070683_100190268 | |||
| 532 | Ga0070690_100011113 | |||
| 533 | Ga0068869_100024517 | |||
| 534 | Ga0068869_100026753 | |||
| 535 | Ga0068868_100211097 | |||
| 536 | Ga0070689_100004530 | |||
| 537 | Ga0070668_100001480 | |||
| 538 | Ga0070668_100002708 | |||
| 539 | Ga0070668_100003755 | |||
| 540 | Ga0070668_100021242 | |||
| 541 | Ga0070669_100005973 | |||
| 542 | Ga0070671_100002378 | |||
| 543 | Ga0070671_100057641 | |||
| 544 | Ga0070671_100195491 | |||
| 545 | Ga0070674_100010917 | |||
| 546 | Ga0070674_100078459 | |||
| 547 | Ga0070688_100000634 | |||
| 548 | Ga0070688_100174163 | |||
| 549 | Ga0070659_100120871 | |||
| 550 | Ga0070667_100000029 | |||
| 551 | Ga0070667_100002385 | |||
| 552 | Ga0070667_100006249 | |||
| 553 | Ga0070709_10127242 | |||
| 554 | Ga0070714_100041118 | |||
| 555 | Ga0070713_100052673 | |||
| 556 | Ga0070710_10002244 | |||
| 557 | Ga0070710_10004356 | |||
| 558 | Ga0070711_100002139 | |||
| 559 | Ga0070705_100002682 | |||
| 560 | Ga0070705_100007551 | |||
| 561 | Ga0070700_100005654 | |||
| 562 | Ga0070694_100029559 | |||
| 563 | Ga0070663_100013316 | |||
| 564 | Ga0070663_100044928 | |||
| 565 | Ga0070678_100000705 | |||
| 566 | Ga0070662_100000781 | |||
| 567 | Ga0070662_100058684 | |||
| 568 | Ga0068867_100001331 | |||
| 569 | Ga0070684_100196684 | |||
| 570 | Ga0068853_100003298 | |||
| 571 | Ga0068853_100048969 | |||
| 572 | Ga0070695_100005235 | |||
| 573 | Ga0070665_100026226 | |||
| 574 | Ga0070665_100069234 | |||
| 575 | Ga0070665_100176119 | |||
| 576 | Ga0070704_100001287 | |||
| 577 | Ga0070704_100010537 | |||
| 578 | Ga0068855_100283544 | |||
| 579 | Ga0070664_100145548 | |||
| 580 | Ga0068854_100001080 | |||
| 581 | Ga0068854_100084756 | |||
| 582 | Ga0070702_100000284 | |||
| 583 | Ga0068852_100072347 | |||
| 584 | Ga0068852_100281499 | |||
| 585 | Ga0068859_100001467 | |||
| 586 | Ga0068859_100004146 | |||
| 587 | Ga0068864_100130803 | |||
| 588 | Ga0068864_100253903 | |||
| 589 | Ga0068866_10000683 | |||
| 590 | Ga0068861_100001239 | |||
| 591 | Ga0068863_100000465 | |||
| 592 | Ga0068863_100012538 | |||
| 593 | Ga0068858_100005427 | |||
| 594 | Ga0068858_100020008 | |||
| 595 | Ga0068860_100000088 | |||
| 596 | Ga0068860_100147970 | |||
| 597 | Ga0068862_100000056 | |||
| 598 | Ga0068862_100006390 | |||
| 599 | Ga0081455_10000037 | |||
| 600 | Ga0081455_10115786 | |||
| 601 | Ga0081538_10067437 | |||
| 602 | Ga0081540_1023668 | |||
| 603 | Ga0081539_10000027 | |||
| 604 | Ga0070717_10006935 | |||
| 605 | Ga0070717_10127140 | |||
| 606 | Ga0075365_10006627 | |||
| 607 | Ga0075365_10014230 | |||
| 608 | Ga0075365_10026748 | |||
| 609 | Ga0075365_10029399 | |||
| 610 | Ga0075363_100000041 | |||
| 611 | Ga0075363_100000435 | |||
| 612 | Ga0075363_100000516 | |||
| 613 | Ga0075363_100007919 | |||
| 614 | Ga0075364_10013206 | |||
| 615 | Ga0075364_10014042 | |||
| 616 | Ga0075364_10014673 | |||
| 617 | Ga0075364_10015251 | |||
| 618 | Ga0075364_10023795 | |||
| 619 | Ga0075364_10089322 | |||
| 620 | Ga0070715_10002952 | |||
| 621 | Ga0070716_100003099 | |||
| 622 | Ga0070712_100000620 | |||
| 623 | Ga0075362_10018107 | |||
| 624 | Ga0075362_10020122 | |||
| 625 | Ga0075362_10076474 | |||
| 626 | Ga0075367_10002795 | |||
| 627 | Ga0075369_10002281 | |||
| 628 | Ga0075369_10010502 | |||
| 629 | Ga0075369_10011212 | |||
| 630 | Ga0075369_10026568 | |||
| 631 | Ga0075369_10069546 | |||
| 632 | Ga0075370_10000847 | |||
| 633 | Ga0075370_10025187 | |||
| 634 | Ga0075428_100014431 | |||
| 635 | Ga0075430_100047321 | |||
| 636 | Ga0075430_100195133 | |||
| 637 | Ga0075431_100031921 | |||
| 638 | Ga0068865_100000595 | |||
| 639 | Ga0097620_100001467 | |||
| 640 | Ga0097620_100004146 | |||
| 641 | Ga0105240_10284077 | |||
| 642 | Ga0105245_10000753 | |||
| 643 | Ga0105245_10063502 | |||
| 644 | Ga0105245_10133775 | |||
| 645 | Ga0105245_10270129 | |||
| 646 | Ga0105247_10000008 | |||
| 647 | Ga0105247_10001050 | |||
| 648 | Ga0105243_10000842 | |||
| 649 | Ga0105243_10139381 | |||
| 650 | Ga0105241_10065721 | |||
| 651 | Ga0105242_10000885 | |||
| 652 | Ga0105248_10000051 | |||
| 653 | Ga0105248_10158682 | |||
| 654 | Ga0105237_10007605 | |||
| 655 | Ga0105237_10196757 | |||
| 656 | Ga0105237_10236862 | |||
| 657 | Ga0105238_10107324 | |||
| 658 | Ga0105238_10318444 | |||
| 659 | Ga0105249_10000040 | |||
| 660 | Ga0105249_10002280 | |||
| 661 | Ga0105249_10014474 | |||
| 662 | Ga0105249_10179497 | |||
| 663 | Ga0105239_10003892 | |||
| 664 | Ga0105239_10022266 | |||
| 665 | Ga0105246_10043427 | |||
| 666 | Ga0157369_10074635 | |||
| 667 | Ga0157378_10003960 | |||
| 668 | Ga0163162_10003429 | |||
| 669 | Ga0163162_10085191 | |||
| 670 | Ga0163162_10510151 | |||
| 671 | Ga0157375_10000340 | |||
| 672 | Ga0157380_10000251 | |||
| 673 | Ga0157380_10115729 | |||
| 674 | Ga0157379_10002200 | |||
| 675 | Ga0157376_10293299 | |||
| 676 | Ga0163161_10000280 | |||
| 677 | Ga0213876_10000845 | |||
| 678 | Ga0213876_10057985 | |||
| 679 | Ga0213876_10087013 | |||
| 680 | Ga0213876_10095002 | |||
| 681 | Ga0209673_1012854 | |||
| 682 | Ga0209051_1000034 | |||
| 683 | Ga0209051_1011403 | |||
| 684 | Ga0209051_1021238 | |||
| 685 | Ga0207642_10002542 | |||
| 686 | Ga0207710_10000006 | |||
| 687 | Ga0207685_10003925 | |||
| 688 | Ga0207685_10005007 | |||
| 689 | Ga0207699_10006468 | |||
| 690 | Ga0207699_10021481 | |||
| 691 | Ga0207671_10012980 | |||
| 692 | Ga0207693_10000806 | |||
| 693 | Ga0207693_10002376 | |||
| 694 | Ga0207663_10019762 | |||
| 695 | Ga0207662_10108409 | |||
| 696 | Ga0207657_10041417 | |||
| 697 | Ga0207657_10093353 | |||
| 698 | Ga0207681_10004258 | |||
| 699 | Ga0207681_10004678 | |||
| 700 | Ga0207681_10087506 | |||
| 701 | Ga0207687_10003359 | |||
| 702 | Ga0207700_10085353 | |||
| 703 | Ga0207664_10040831 | |||
| 704 | Ga0207664_10117965 | |||
| 705 | Ga0207644_10004046 | |||
| 706 | Ga0207644_10025202 | |||
| 707 | Ga0207644_10152928 | |||
| 708 | Ga0207706_10005681 | |||
| 709 | Ga0207706_10024426 | |||
| 710 | Ga0207706_10036400 | |||
| 711 | Ga0207706_10155906 | |||
| 712 | Ga0207709_10003804 | |||
| 713 | Ga0207670_10005801 | |||
| 714 | Ga0207669_10000179 | |||
| 715 | Ga0207704_10000844 | |||
| 716 | Ga0207665_10006775 | |||
| 717 | Ga0207691_10094099 | |||
| 718 | Ga0207711_10000811 | |||
| 719 | Ga0207689_10005658 | |||
| 720 | Ga0207689_10019792 | |||
| 721 | Ga0207689_10033519 | |||
| 722 | Ga0207712_10000017 | |||
| 723 | Ga0207712_10036837 | |||
| 724 | Ga0207712_10131364 | |||
| 725 | Ga0207668_10008413 | |||
| 726 | Ga0207668_10019592 | |||
| 727 | Ga0207668_10100437 | |||
| 728 | Ga0207668_10129984 | |||
| 729 | Ga0207640_10002497 | |||
| 730 | Ga0207658_10000016 | |||
| 731 | Ga0207658_10001453 | |||
| 732 | Ga0207658_10012328 | |||
| 733 | Ga0207677_10003614 | |||
| 734 | Ga0207703_10002078 | |||
| 735 | Ga0207703_10022295 | |||
| 736 | Ga0207639_10074758 | |||
| 737 | Ga0207678_10000108 | |||
| 738 | Ga0207678_10005674 | |||
| 739 | Ga0207678_10018894 | |||
| 740 | Ga0207708_10005354 | |||
| 741 | Ga0207708_10020280 | |||
| 742 | Ga0207641_10000564 | |||
| 743 | Ga0207641_10004585 | |||
| 744 | Ga0207648_10001139 | |||
| 745 | Ga0207648_10073013 | |||
| 746 | Ga0207648_10109035 | |||
| 747 | Ga0207676_10228087 | |||
| 748 | Ga0207674_10279782 | |||
| 749 | Ga0207675_100002192 | |||
| 750 | Ga0207675_100133234 | |||
| 751 | Ga0207683_10000390 | |||
| 752 | Ga0207683_10023579 | |||
| 753 | Ga0207683_10175100 | |||
| 754 | Ga0207698_10064759 | |||
| 755 | Ga0268266_10006132 | |||
| 756 | Ga0268266_10035902 | |||
| 757 | Ga0268266_10231506 | |||
| 758 | Ga0268265_10000068 | |||
| 759 | Ga0268264_10000056 | |||
| 760 | Ga0268264_10007790 | |||
| 761 | Ga0268264_10123733 | |||
| 762 | Ga0265327_10000004 | |||
| 763 | Ga0265327_10000274 | |||
| 764 | Ga0265327_10007084 | |||
| 765 | Ga0265327_10007871 | |||
| 766 | Ga0307513_10060222 | |||
| 767 | Ga0307513_10070895 | |||
| 768 | Ga0307513_10078908 | |||
| 769 | Ga0307413_10000679 | |||
| 770 | Ga0307518_10001566 | |||
| 771 | Ga0307410_10092935 | |||
| 772 | Ga0307406_10025644 | |||
| 773 | Ga0307409_100005629 | |||
| 774 | Ga0307409_100081348 | |||
| 775 | Ga0307409_100147494 | |||
| 776 | Ga0307416_100013931 | |||
| 777 | Ga0307411_10001739 | |||
| 778 | Ga0307415_100009079 | |||
| 779 | Ga0307507_10004841 | |||
| 780 | Ga0307507_10193725 | |||
| 781 | Ga0307510_10041437 | |||
| 782 | Ga0373956_0002749 | |||
| 783 | Ga0395900_0178123 | |||
| 784 | Ga0436364_0230724 | |||
| 785 | Ga0436364_0741966 | |||
| 786 | Ga0436364_1215586 | |||
| 787 | Ga0436365_0139519 | |||
| 788 | Ga0436365_0375738 | |||
| 789 | Ga0436365_0433207 | |||
| 790 | Ga0436365_0596616 | |||
| 791 | Ga0436365_0725179 | |||
| 792 | Ga0436365_0968026 | |||
| 793 | Ga0436365_1564100 | |||
| 794 | Ga0439461_0003658 | |||
| 795 | Ga0439466_0006203 | |||
| 796 | Ga0439466_0020448 | |||
| 797 | Ga0439465_0000928 | |||
| 798 | Ga0439465_0008747 | |||
| 799 | Ga0451789_0001997 | |||
| 800 | Ga0451791_0236912 | |||
| 801 | Ga0451793_0021053 | |||
| 802 | Ga0451793_0686156 | |||
| 803 | Ga0451797_0471812 | |||
| 804 | Ga0451802_1089581 | |||
| 805 | Ga0451807_0709980 | |||
| 806 | Ga0451853_0992271 | |||
| 807 | Ga0439431_0001493 | |||
| 808 | Ga0439431_0004839 | |||
| 809 | Ga0439445_0001493 | |||
| 810 | Ga0439448_0031674 | |||
| 811 | Ga0439434_0011538 | |||
| 812 | Ga0466969_0011144 | |||
| 813 | Ga0466972_0002603 | |||
| 814 | Ga0466972_0073129 | |||
| 815 | Ga0466965_0004625 | |||
| 816 | Ga0466965_0004787 | |||
| 817 | Ga0466965_0004921 | |||
| 818 | Ga0466965_0093244 | |||
| 819 | Ga0466966_0004932 | |||
| 820 | Ga0466966_0013380 | |||
| 821 | Ga0466966_0114196 | |||
| 822 | Ga0466961_0007362 | |||
| 823 | Ga0466963_0051057 | |||
| 824 | Ga0466963_0154140 | |||
| 825 | Ga0466971_0024283 | |||
| 826 | Ga0466971_0027924 | |||
| 827 | Ga0466968_0001626 | |||
| 828 | Ga0466968_0007139 | |||
| 829 | Ga0466970_0024771 | |||
| 830 | Ga0466970_0051537 | |||
| 831 | Ga0466957_0009919 | |||
| 832 | Ga0466957_0034240 | |||
| 833 | Ga0466957_0234270 | |||
| 834 | Ga0466960_0000242 | |||
| 835 | Ga0466960_0000614 | |||
| 836 | Ga0466960_0085785 | |||
| 837 | Ga0466959_0010446 | |||
| 838 | Ga0466959_0011756 | |||
| 839 | Ga0466959_0017275 | |||
| 840 | Ga0466959_0047173 | |||
| 841 | Ga0466959_0111108 | |||
| 842 | Ga0466958_0001798 | |||
| 843 | Ga0466958_0041310 | |||
| 844 | Ga0466958_0080650 | |||
| 845 | Ga0466958_0100864 | |||
| 846 | Ga0466967_0004715 | |||
| 847 | Ga0466967_0011168 | |||
| 848 | Ga0466967_0015180 | |||
| 849 | Ga0466967_0027716 | |||
| 850 | Ga0466967_0051197 | |||
| 851 | Ga0466967_0051957 | |||
| 852 | Ga0466967_0067978 | |||
| 853 | Ga0466967_0217128 | |||
| 854 | Ga0466967_0231178 | |||
| 855 | Ga0495603_0057364 | |||
| 856 | Ga0495638_0009714 | |||
| 857 | Ga0495638_0015781 | |||
| 858 | Ga0495641_0012903 | |||
| 859 | Ga0495582_0097884 | |||
| 860 | Ga0495594_0046161 | |||
| 861 | Ga0495606_0029324 | |||
| 862 | Ga0495648_0004750 | |||
| 863 | Ga0495665_0052815 | |||
| 864 | Ga0495640_0011954 | |||
| 865 | Ga0495658_0044135 | |||
| 866 | Ga0495581_0015800 | |||
| 867 | Ga0495672_0001877 | |||
| 868 | Ga0495672_0029939 | |||
| 869 | Ga0495673_0001853 | |||
| 870 | Ga0495686_0003392 | |||
| 871 | Ga0496100_0000350 | |||
| 872 | Ga0496100_0003532 | |||
| 873 | Ga0496100_0012618 | |||
| 874 | Ga0496100_0050397 | |||
| 875 | Ga0496100_0248274 | |||
| 876 | Ga0496101_0000014 | |||
| 877 | Ga0496101_0000140 | |||
| 878 | Ga0496101_0000241 | |||
| 879 | Ga0496101_0006938 | |||
| 880 | Ga0496101_0259586 | |||
| 881 | Ga0496102_0000041 | |||
| 882 | Ga0496102_0000396 | |||
| 883 | Ga0496102_0001025 | |||
| 884 | Ga0496102_0002609 | |||
| 885 | Ga0496102_0009811 | |||
| 886 | Ga0496102_0053696 | |||
| 887 | Ga0496102_0056724 | |||
| 888 | Ga0496102_0063403 | |||
| 889 | Ga0496102_0113451 | |||
| 890 | Ga0496102_0164985 | |||
| 891 | Ga0496103_0000058 | |||
| 892 | Ga0496103_0000183 | |||
| 893 | Ga0496103_0001434 | |||
| 894 | Ga0496103_0028531 | |||
| 895 | Ga0496104_0014962 | |||
| 896 | Ga0496104_0062068 | |||
| 897 | Ga0496104_0087372 | |||
| 898 | Ga0496105_0014196 | |||
| 899 | Ga0496105_0209298 | |||
| 900 | Ga0496106_0000410 | |||
| 901 | Ga0496106_0000638 | |||
| 902 | Ga0496106_0013150 | |||
| 903 | Ga0496106_0093935 | |||
| 904 | Ga0496107_0000483 | |||
| 905 | Ga0496107_0002414 | |||
| 906 | Ga0496107_0042742 | |||
| 907 | Ga0496107_0043851 | |||
| 908 | Ga0496107_0089934 | |||
| 909 | Ga0496108_0001474 | |||
| 910 | Ga0496108_0011047 | |||
| 911 | Ga0496108_0310984 | |||
| 912 | Ga0496109_0000161 | |||
| 913 | Ga0496109_0006892 | |||
| 914 | Ga0496109_0077411 | |||
| 915 | Ga0496109_0091265 | |||
| 916 | Ga0496110_0010223 | |||
| 917 | Ga0496110_0054353 | |||
| 918 | Ga0496111_0029440 | |||
| 919 | Ga0496112_0003272 | |||
| 920 | Ga0496112_0022831 | |||
| 921 | Ga0496112_0155825 | |||
| 922 | Ga0496114_0000496 | |||
| 923 | Ga0496114_0016900 | |||
| 924 | Ga0496114_0018407 | |||
| 925 | Ga0496114_0089129 | |||
| 926 | Ga0496114_0179772 | |||
| 927 | Ga0496115_0000836 | |||
| 928 | Ga0496115_0010211 | |||
| 929 | Ga0496115_0020245 | |||
| 930 | Ga0496116_0000098 | |||
| 931 | Ga0496117_0000096 | |||
| 932 | Ga0496117_0001778 | |||
| 933 | Ga0496117_0054364 | |||
| 934 | Ga0496118_0000067 | |||
| 935 | Ga0496118_0000073 | |||
| 936 | Ga0496118_0000461 | |||
| 937 | Ga0496118_0023244 | |||
| 938 | Ga0496119_0032739 | |||
| 939 | Ga0496119_0037133 | |||
| 940 | Ga0496119_0128080 | |||
| 941 | Ga0496120_0003981 | |||
| 942 | Ga0496121_0000002 | |||
| 943 | Ga0496121_0003647 | |||
| 944 | Ga0496122_0005035 | |||
| 945 | Ga0496123_0081650 | |||
| 946 | Ga0496124_0000002 | |||
| 947 | Ga0496124_0066575 | |||
| 948 | Ga0496124_0103284 | |||
| 949 | Ga0496125_0000002 | |||
| 950 | Ga0496125_0019362 | |||
| 951 | Ga0496126_0000009 | |||
| 952 | Ga0496126_0002602 | |||
| 953 | Ga0496126_0006511 | |||
| 954 | Ga0496126_0081736 | |||
| 955 | Ga0501032_0003558 | |||
| 956 | Ga0501032_0045328 | |||
| 957 | Ga0501034_0007804 | |||
| 958 | Ga0501034_0018322 | |||
| 959 | Ga0501036_0001947 | |||
| 960 | Ga0501036_0150244 | |||
| 961 | Ga0501037_0000190 | |||
| 962 | Ga0501037_0004900 | |||
| 963 | Ga0501043_0005724 | |||
| 964 | Ga0501046_0002953 | |||
| 965 | Ga0501047_0022934 | |||
| 966 | Ga0501048_0008880 | |||
| 967 | Ga0501069_0015660 | |||
| 968 | Ga0501069_0018824 | |||
| 969 | Ga0501070_0000521 | |||
| 970 | Ga0501070_0083993 | |||
| 971 | Ga0501073_0030923 | |||
| 972 | Ga0501073_0041823 | |||
| 973 | Ga0501073_0078338 | |||
| 974 | Ga0501080_0329863 | |||
| 975 | Ga0501083_0082153 | |||
| 976 | Ga0501035_0002236 | |||
| 977 | Ga0501044_0006785 | |||
| 978 | Ga0501044_0010888 | |||
| 979 | Ga0501044_0059390 | |||
| 980 | Ga0501044_0180260 | |||
| 981 | Ga0501044_0259411 | |||
| 982 | nmdc:mga03n38_161_c1 | |||
| 983 | nmdc:mga03n38_2311_c1 | |||
| 984 | nmdc:mga03n38_602_c1 | |||
| 985 | nmdc:mga03n38_9240_c1 | |||
| 986 | nmdc:mga00v17_24305_c1 | |||
| 987 | nmdc:mga00v17_25563_c1 | |||
| 988 | nmdc:mga00v17_2765_c1 | |||
| 989 | nmdc:mga00v17_42677_c1 | |||
| 990 | nmdc:mga00v17_4515_c1 | |||
| 991 | nmdc:mga00v17_76716_c1 | |||
| 992 | nmdc:mga0yw44_30655_c1 | |||
| 993 | nmdc:mga0yw44_88623_c1 | |||
| 994 | nmdc:mga06z11_1000_c1 | |||
| 995 | nmdc:mga06z11_119559_c1 | |||
| 996 | nmdc:mga06z11_173553_c1 | |||
| 997 | nmdc:mga07m45_199_c1 | |||
| 998 | nmdc:mga07m45_33544_c1 | |||
| 999 | nmdc:mga05p37_69209_c1 | |||
| 1000 | nmdc:mga0qj67_135025_c1 | |||
| 1001 | nmdc:mga06r32_2284_c4 | |||
| 1002 | nmdc:mga0sz30_1229_c1 | |||
| 1003 | nmdc:mga0sz30_1451_c1 | |||
| 1004 | nmdc:mga0sz30_16335_c1 | |||
| 1005 | nmdc:mga0sz30_18394_c1 | |||
| 1006 | nmdc:mga0sz30_26345_c1 | |||
| 1007 | nmdc:mga0sz30_7440_c1 | |||
| 1008 | nmdc:mga0sz30_8052_c1 | |||
| 1009 | Ga0500610_0004842 | |||
| 1010 | Ga0500635_0001649 | |||
| 1011 | Ga0500643_007886 | |||
| 1012 | Ga0500646_0025707 | |||
| 1013 | Ga0500556_0007032 | |||
| 1014 | Ga0500652_004959 | |||
| 1015 | Ga0500645_000031 | |||
| 1016 | Ga0500645_013611 | |||
| 1017 | 2523382366 | |||
| 1018 | 2583149241 | |||
| 1019 | 2586057814 | |||
| 1020 | 2644487344 | |||
| 1021 | 2644638955 | |||
| 1022 | 2738665791 | |||
| 1023 | 2738702628 | |||
| 1024 | 2739144925 | |||
| 1025 | 2739329538 | |||
| 1026 | 2753037389 | |||
| 1027 | 2753325258 | |||
| 1028 | 2791916640 | |||
| 1029 | 2809593352 | |||
| 1030 | 2842135157 | |||
| 1031 | 2866612680 | |||
| 1032 | 2870782988 | |||
| 1033 | 2899366002 | |||
| 1034 | 2899374832 | |||
| 1035 | 2902794430 | |||
| 1036 | 2902803224 | |||
| 1037 | 2902814081 | |||
| 1038 | 2902839446 | |||
| 1039 | 2915768989 | |||
| 1040 | 2917740693 | |||
| 1041 | 2929213175 | |||
| 1042 | 2939587104 | |||
| 1043 | 2956942207 | |||
| 1044 | 2966922261 | |||
| 1045 | 3001121955 | |||
| 1046 | 8003319726 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xi8-assembly1.cif.gz_B | molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 | 0.8128 | 1 | 395 |
| 1xi8-assembly1.cif.gz_B | molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 | 0.8042 | 1 | 395 |
| 1xi8-assembly1.cif.gz_A | molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 | 0.8039 | 1 | 393 |
| 1xi8-assembly1.cif.gz_A | molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 | 0.7899 | 1 | 393 |
| 4ys6-assembly1.cif.gz_A | crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentans (cphy_1585, target efi-511156) with bound beta-d-glucose | 0.7888 | 158 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58080_327_398_2.40.340.10 | Mainly Beta;Beta Barrel;Beta-clip;MoeA, C-terminal, domain IV | 0.9344 | 323 | 397 | 2.40.340.10 |
| af_P9WJQ5_34_138_2.170.190.11 | Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. | 0.9263 | 34 | 138 | 2.170.190.11 |
| af_Q58080_327_398_2.40.340.10 | Mainly Beta;Beta Barrel;Beta-clip;MoeA, C-terminal, domain IV | 0.9223 | 323 | 397 | 2.40.340.10 |
| af_Q2FVY0_53_145_2.170.190.11 | Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. | 0.9204 | 46 | 138 | 2.170.190.11 |
| af_P9WJQ5_34_138_2.170.190.11 | Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. | 0.9178 | 34 | 138 | 2.170.190.11 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-X8FG60-F1-model_v4 | deleted | 0.9804 | 303 | 397 |
|
| AF-X8FG60-F1-model_v4 | deleted | 0.9606 | 303 | 397 |
|
| AF-A0A6G2UNJ6-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9514 | 267 | 397 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |
| AF-A0A6B3G071-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9496 | 156 | 229 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |
| AF-A0A535K998-F1-model_v4 | Molybdopterin molybdenumtransferase (EC 2.10.1.1) | 0.9484 | 294 | 397 |
GO:0005829
GO:0006777 GO:0046872 GO:0061599 |