F459018

General Info

Members Datasets Scaffolds Average Seq Length
523 277 1046 386

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_0028770|Ga0436363_0028770_1368_2648
Length 426
Sequence MPGSLRSVEEHRRIVAELIAAQPATMATLADAEGLVLAHDIVAEVPLPVFDNSAMDGYAVRADDIASAAADHPVKLPVAEDIPAGRTDIPTLERGTAHRIMTGAPLPAGATAVVPVEATDGRTDIVSIRVAVDEGRHVRHAGEDVAAGTTVLRAGQLVTPAVIGLAAALGLPALAVIPRQRVLVVSTGSELVLPGNPLQPGQIYESNAVMLAAAVRDAGATVVAIATSGDDVAEFAAVLDRYAAESDLIITSGGVSAGAYEVVKDAFGRAGDQGVEFAKVAMQPGMPQGTGRVAGTPIVALPGNPVSALVSFEVFIRPALRVAMGLPAPQRPRRTAVLTETVTSPGGKRQFRRGVLDAAAGTVTSYGPPASHHLRWLASANCLLEIGEDVVEMSAGSQVQVWDLAGFCQGPSSVESGRWPDAHQRS

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
136 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
153 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
154 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
155 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
156 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
161 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
166 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
184 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
185 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
189 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
190 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
242 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
243 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
244 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
245 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
249 2582580736 Prauserella sp. Am3 Isolate Unclassified
250 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
251 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
252 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
253 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
254 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
255 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
256 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
257 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
258 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
259 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
260 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
261 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
262 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
263 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
264 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
265 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
266 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
267 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
268 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
269 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
270 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
271 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
272 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
273 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
274 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
275 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
276 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
277 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.26
Metatranscriptomes 0
Isolates 5.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.24
Nodule 0.19
Rhizoplane 12.62
Rhizosphere 61.38
Stem 0
Stem Tuber 0.19
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_0028770 3300039450 Bacteria 2838
2 JGI24744J21845_10000121 3300002077 Bacteria 10835
3 JGI24742J22300_10001105 3300002244 Bacteria 4177
4 Ga0055540_1000049 3300003792 Bacteria 146100
5 Ga0055540_1001186 3300003792 Bacteria 16069
6 Ga0055540_1007323 3300003792 Bacteria 4190
7 Ga0070676_10146308 3300005328 Bacteria 1508
8 Ga0070683_100190268 3300005329 Bacteria 1948
9 Ga0070690_100011113 3300005330 Bacteria 5258
10 Ga0068869_100024517 3300005334 Bacteria 4178
11 Ga0068869_100026753 3300005334 Bacteria 4017
12 Ga0068868_100211097 3300005338 Bacteria 1622
13 Ga0070689_100004530 3300005340 Bacteria 9408
14 Ga0070668_100001480 3300005347 Bacteria 16964
15 Ga0070668_100002708 3300005347 Bacteria 13042
16 Ga0070668_100003755 3300005347 Bacteria 11204
17 Ga0070668_100021242 3300005347 Bacteria 4907
18 Ga0070669_100005973 3300005353 Bacteria 8784
19 Ga0070671_100002378 3300005355 Bacteria 14535
20 Ga0070671_100057641 3300005355 Bacteria 3232
21 Ga0070671_100195491 3300005355 Bacteria 1715
22 Ga0070674_100010917 3300005356 Bacteria 5509
23 Ga0070674_100078459 3300005356 Bacteria 2353
24 Ga0070688_100000634 3300005365 Bacteria 17482
25 Ga0070688_100174163 3300005365 Bacteria 1487
26 Ga0070659_100120871 3300005366 Bacteria 2121
27 Ga0070667_100000029 3300005367 Bacteria 178990
28 Ga0070667_100002385 3300005367 Bacteria 16455
29 Ga0070667_100006249 3300005367 Bacteria 9904
30 Ga0070709_10127242 3300005434 Bacteria 1735
31 Ga0070714_100041118 3300005435 Bacteria 3900
32 Ga0070713_100052673 3300005436 Bacteria 3370
33 Ga0070710_10002244 3300005437 Bacteria 9143
34 Ga0070710_10004356 3300005437 Bacteria 6705
35 Ga0070711_100002139 3300005439 Bacteria 11203
36 Ga0070705_100002682 3300005440 Bacteria 8898
37 Ga0070705_100007551 3300005440 Bacteria 5354
38 Ga0070700_100005654 3300005441 Bacteria 6634
39 Ga0070694_100029559 3300005444 Bacteria 3577
40 Ga0070663_100013316 3300005455 Bacteria 5239
41 Ga0070663_100044928 3300005455 Bacteria 3118
42 Ga0070678_100000705 3300005456 Bacteria 16534
43 Ga0070662_100000781 3300005457 Bacteria 19629
44 Ga0070662_100058684 3300005457 Bacteria 2801
45 Ga0068867_100001331 3300005459 Bacteria 17105
46 Ga0070684_100196684 3300005535 Bacteria 1836
47 Ga0068853_100003298 3300005539 Bacteria 12348
48 Ga0068853_100048969 3300005539 Bacteria 3630
49 Ga0070695_100005235 3300005545 Bacteria 7649
50 Ga0070665_100026226 3300005548 Bacteria 5869
51 Ga0070665_100069234 3300005548 Bacteria 3537
52 Ga0070665_100176119 3300005548 Bacteria 2140
53 Ga0070704_100001287 3300005549 Bacteria 13261
54 Ga0070704_100010537 3300005549 Bacteria 5628
55 Ga0068855_100283544 3300005563 Bacteria 1839
56 Ga0070664_100145548 3300005564 Bacteria 2089
57 Ga0068854_100001080 3300005578 Bacteria 16413
58 Ga0068854_100084756 3300005578 Bacteria 2345
59 Ga0070702_100000284 3300005615 Bacteria 17332
60 Ga0068852_100072347 3300005616 Bacteria 3030
61 Ga0068852_100281499 3300005616 Bacteria 1603
62 Ga0068859_100001467 3300005617 Bacteria 24018
63 Ga0068859_100004146 3300005617 Bacteria 14802
64 Ga0068864_100130803 3300005618 Bacteria 2254
65 Ga0068864_100253903 3300005618 Bacteria 1633
66 Ga0068866_10000683 3300005718 Bacteria 15439
67 Ga0068861_100001239 3300005719 Bacteria 15906
68 Ga0068863_100000465 3300005841 Bacteria 41376
69 Ga0068863_100012538 3300005841 Bacteria 8179
70 Ga0068858_100005427 3300005842 Bacteria 12491
71 Ga0068858_100020008 3300005842 Bacteria 6260
72 Ga0068860_100000088 3300005843 Bacteria 154416
73 Ga0068860_100147970 3300005843 Bacteria 2261
74 Ga0068862_100000056 3300005844 Bacteria 142257
75 Ga0068862_100006390 3300005844 Bacteria 9799
76 Ga0081455_10000037 3300005937 Bacteria 136059
77 Ga0081455_10115786 3300005937 Bacteria 2121
78 Ga0081538_10067437 3300005981 Bacteria 1998
79 Ga0081540_1023668 3300005983 Bacteria 3585
80 Ga0081539_10000027 3300005985 Bacteria 328691
81 Ga0070717_10006935 3300006028 Bacteria 8371
82 Ga0070717_10127140 3300006028 Bacteria 2189
83 Ga0075365_10006627 3300006038 Bacteria 6391
84 Ga0075365_10014230 3300006038 Bacteria 4782
85 Ga0075365_10026748 3300006038 Bacteria 3666
86 Ga0075365_10029399 3300006038 Bacteria 3512
87 Ga0075363_100000041 3300006048 Bacteria 24416
88 Ga0075363_100000435 3300006048 Bacteria 13030
89 Ga0075363_100000516 3300006048 Bacteria 12417
90 Ga0075363_100007919 3300006048 Bacteria 4921
91 Ga0075364_10013206 3300006051 Bacteria 5071
92 Ga0075364_10014042 3300006051 Bacteria 4940
93 Ga0075364_10014673 3300006051 Bacteria 4846
94 Ga0075364_10015251 3300006051 Bacteria 4762
95 Ga0075364_10023795 3300006051 Bacteria 3881
96 Ga0075364_10089322 3300006051 Bacteria 2043
97 Ga0070715_10002952 3300006163 Bacteria 5316
98 Ga0070716_100003099 3300006173 Bacteria 7763
99 Ga0070712_100000620 3300006175 Bacteria 20853
100 Ga0075362_10018107 3300006177 Bacteria 2910
101 Ga0075362_10020122 3300006177 Bacteria 2786
102 Ga0075362_10076474 3300006177 Bacteria 1537
103 Ga0075367_10002795 3300006178 Bacteria 8092
104 Ga0075369_10002281 3300006186 Bacteria 6811
105 Ga0075369_10010502 3300006186 Bacteria 3622
106 Ga0075369_10011212 3300006186 Bacteria 3522
107 Ga0075369_10026568 3300006186 Bacteria 2414
108 Ga0075369_10069546 3300006186 Bacteria 1548
109 Ga0075370_10000847 3300006353 Bacteria 12393
110 Ga0075370_10025187 3300006353 Bacteria 3288
111 Ga0075428_100014431 3300006844 Bacteria 8777
112 Ga0075430_100047321 3300006846 Bacteria 3631
113 Ga0075430_100195133 3300006846 Bacteria 1682
114 Ga0075431_100031921 3300006847 Bacteria 5426
115 Ga0068865_100000595 3300006881 Bacteria 20259
116 Ga0097620_100001467 3300006931 Bacteria 24018
117 Ga0097620_100004146 3300006931 Bacteria 14802
118 Ga0105240_10284077 3300009093 Bacteria 1900
119 Ga0105245_10000753 3300009098 Bacteria 29286
120 Ga0105245_10063502 3300009098 Bacteria 3335
121 Ga0105245_10133775 3300009098 Bacteria 2328
122 Ga0105245_10270129 3300009098 Bacteria 1658
123 Ga0105247_10000008 3300009101 Bacteria 391450
124 Ga0105247_10001050 3300009101 Bacteria 20695
125 Ga0105243_10000842 3300009148 Bacteria 29157
126 Ga0105243_10139381 3300009148 Bacteria 2067
127 Ga0105241_10065721 3300009174 Bacteria 2803
128 Ga0105242_10000885 3300009176 Bacteria 23245
129 Ga0105248_10000051 3300009177 Bacteria 150288
130 Ga0105248_10158682 3300009177 Bacteria 2552
131 Ga0105237_10007605 3300009545 Bacteria 11841
132 Ga0105237_10196757 3300009545 Bacteria 2016
133 Ga0105237_10236862 3300009545 Bacteria 1826
134 Ga0105238_10107324 3300009551 Bacteria 2773
135 Ga0105238_10318444 3300009551 Bacteria 1541
136 Ga0105249_10000040 3300009553 Bacteria 196153
137 Ga0105249_10002280 3300009553 Bacteria 16659
138 Ga0105249_10014474 3300009553 Bacteria 6973
139 Ga0105249_10179497 3300009553 Bacteria 2059
140 Ga0105239_10003892 3300010375 Bacteria 18093
141 Ga0105239_10022266 3300010375 Bacteria 6985
142 Ga0105246_10043427 3300011119 Bacteria 3050
143 Ga0157369_10074635 3300013105 Bacteria 3637
144 Ga0157378_10003960 3300013297 Bacteria 13087
145 Ga0163162_10003429 3300013306 Bacteria 15136
146 Ga0163162_10085191 3300013306 Bacteria 3237
147 Ga0163162_10510151 3300013306 Bacteria 1333
148 Ga0157375_10000340 3300013308 Bacteria 42196
149 Ga0157380_10000251 3300014326 Bacteria 32377
150 Ga0157380_10115729 3300014326 Bacteria 2262
151 Ga0157379_10002200 3300014968 Bacteria 16223
152 Ga0157376_10293299 3300014969 Bacteria 1536
153 Ga0163161_10000280 3300017792 Bacteria 44602
154 Ga0213876_10000845 3300021384 Bacteria 20595
155 Ga0213876_10057985 3300021384 Bacteria 2044
156 Ga0213876_10087013 3300021384 Bacteria 1654
157 Ga0213876_10095002 3300021384 Bacteria 1579
158 Ga0209673_1012854 3300025273 Bacteria 3343
159 Ga0209051_1000034 3300025303 Bacteria 371498
160 Ga0209051_1011403 3300025303 Bacteria 4390
161 Ga0209051_1021238 3300025303 Bacteria 2770
162 Ga0207642_10002542 3300025899 Bacteria 5678
163 Ga0207710_10000006 3300025900 Bacteria 538831
164 Ga0207685_10003925 3300025905 Bacteria 3695
165 Ga0207685_10005007 3300025905 Bacteria 3444
166 Ga0207699_10006468 3300025906 Bacteria 5676
167 Ga0207699_10021481 3300025906 Bacteria 3479
168 Ga0207671_10012980 3300025914 Bacteria 6663
169 Ga0207693_10000806 3300025915 Bacteria 28060
170 Ga0207693_10002376 3300025915 Bacteria 16344
171 Ga0207663_10019762 3300025916 Bacteria 3802
172 Ga0207662_10108409 3300025918 Bacteria 1729
173 Ga0207657_10041417 3300025919 Bacteria 4073
174 Ga0207657_10093353 3300025919 Bacteria 2507
175 Ga0207681_10004258 3300025923 Bacteria 8833
176 Ga0207681_10004678 3300025923 Bacteria 8421
177 Ga0207681_10087506 3300025923 Bacteria 2217
178 Ga0207687_10003359 3300025927 Bacteria 10814
179 Ga0207700_10085353 3300025928 Bacteria 2478
180 Ga0207664_10040831 3300025929 Bacteria 3611
181 Ga0207664_10117965 3300025929 Bacteria 2216
182 Ga0207644_10004046 3300025931 Bacteria 9510
183 Ga0207644_10025202 3300025931 Bacteria 4089
184 Ga0207644_10152928 3300025931 Bacteria 1787
185 Ga0207706_10005681 3300025933 Bacteria 11617
186 Ga0207706_10024426 3300025933 Bacteria 5418
187 Ga0207706_10036400 3300025933 Bacteria 4371
188 Ga0207706_10155906 3300025933 Bacteria 2008
189 Ga0207709_10003804 3300025935 Bacteria 8862
190 Ga0207670_10005801 3300025936 Bacteria 6815
191 Ga0207669_10000179 3300025937 Bacteria 29393
192 Ga0207704_10000844 3300025938 Bacteria 13592
193 Ga0207665_10006775 3300025939 Bacteria 7588
194 Ga0207691_10094099 3300025940 Bacteria 2682
195 Ga0207711_10000811 3300025941 Bacteria 30675
196 Ga0207689_10005658 3300025942 Bacteria 11121
197 Ga0207689_10019792 3300025942 Bacteria 5669
198 Ga0207689_10033519 3300025942 Bacteria 4268
199 Ga0207712_10000017 3300025961 Bacteria 337943
200 Ga0207712_10036837 3300025961 Bacteria 3334
201 Ga0207712_10131364 3300025961 Bacteria 1909
202 Ga0207668_10008413 3300025972 Bacteria 6149
203 Ga0207668_10019592 3300025972 Bacteria 4279
204 Ga0207668_10100437 3300025972 Bacteria 2148
205 Ga0207668_10129984 3300025972 Bacteria 1922
206 Ga0207640_10002497 3300025981 Bacteria 9856
207 Ga0207658_10000016 3300025986 Bacteria 215618
208 Ga0207658_10001453 3300025986 Bacteria 18468
209 Ga0207658_10012328 3300025986 Bacteria 5835
210 Ga0207677_10003614 3300026023 Bacteria 8200
211 Ga0207703_10002078 3300026035 Bacteria 17601
212 Ga0207703_10022295 3300026035 Bacteria 4965
213 Ga0207639_10074758 3300026041 Bacteria 2662
214 Ga0207678_10000108 3300026067 Bacteria 67848
215 Ga0207678_10005674 3300026067 Bacteria 11152
216 Ga0207678_10018894 3300026067 Bacteria 6055
217 Ga0207708_10005354 3300026075 Bacteria 9452
218 Ga0207708_10020280 3300026075 Bacteria 5013
219 Ga0207641_10000564 3300026088 Bacteria 41406
220 Ga0207641_10004585 3300026088 Bacteria 11937
221 Ga0207648_10001139 3300026089 Bacteria 29879
222 Ga0207648_10073013 3300026089 Bacteria 2990
223 Ga0207648_10109035 3300026089 Bacteria 2430
224 Ga0207676_10228087 3300026095 Bacteria 1663
225 Ga0207674_10279782 3300026116 Bacteria 1616
226 Ga0207675_100002192 3300026118 Bacteria 19401
227 Ga0207675_100133234 3300026118 Bacteria 2357
228 Ga0207683_10000390 3300026121 Bacteria 40388
229 Ga0207683_10023579 3300026121 Bacteria 5294
230 Ga0207683_10175100 3300026121 Bacteria 1944
231 Ga0207698_10064759 3300026142 Bacteria 2867
232 Ga0268266_10006132 3300028379 Bacteria 11065
233 Ga0268266_10035902 3300028379 Bacteria 4216
234 Ga0268266_10231506 3300028379 Bacteria 1702
235 Ga0268265_10000068 3300028380 Bacteria 142272
236 Ga0268264_10000056 3300028381 Bacteria 310339
237 Ga0268264_10007790 3300028381 Bacteria 8918
238 Ga0268264_10123733 3300028381 Bacteria 2283
239 Ga0265327_10000004 3300031251 Bacteria 803973
240 Ga0265327_10000274 3300031251 Bacteria 101723
241 Ga0265327_10007084 3300031251 Bacteria 8770
242 Ga0265327_10007871 3300031251 Bacteria 8092
243 Ga0307513_10060222 3300031456 Bacteria 4025
244 Ga0307513_10070895 3300031456 Bacteria 3639
245 Ga0307513_10078908 3300031456 Bacteria 3403
246 Ga0307413_10000679 3300031824 Bacteria 11594
247 Ga0307518_10001566 3300031838 Bacteria 16907
248 Ga0307410_10092935 3300031852 Bacteria 2146
249 Ga0307406_10025644 3300031901 Bacteria 3531
250 Ga0307409_100005629 3300031995 Bacteria 7247
251 Ga0307409_100081348 3300031995 Bacteria 2618
252 Ga0307409_100147494 3300031995 Bacteria 2037
253 Ga0307416_100013931 3300032002 Bacteria 5485
254 Ga0307411_10001739 3300032005 Bacteria 9175
255 Ga0307415_100009079 3300032126 Bacteria 5552
256 Ga0307507_10004841 3300033179 Bacteria 23134
257 Ga0307507_10193725 3300033179 Bacteria 1422
258 Ga0307510_10041437 3300033180 Bacteria 5033
259 Ga0373956_0002749 3300035119 Bacteria 7113
260 Ga0395900_0178123 3300037418 Bacteria 2162
261 Ga0436364_0230724 3300037853 Bacteria 7135
262 Ga0436364_0741966 3300037853 Bacteria 1869
263 Ga0436364_1215586 3300037853 Bacteria 29880
264 Ga0436365_0139519 3300039437 Bacteria 6857
265 Ga0436365_0375738 3300039437 Bacteria 15027
266 Ga0436365_0433207 3300039437 Archaea 2503
267 Ga0436365_0596616 3300039437 Bacteria 14936
268 Ga0436365_0725179 3300039437 Bacteria 20604
269 Ga0436365_0968026 3300039437 Bacteria 6675
270 Ga0436365_1564100 3300039437 Bacteria 3264
271 Ga0439461_0003658 3300041410 Bacteria 2535
272 Ga0439466_0006203 3300041411 Bacteria 4551
273 Ga0439466_0020448 3300041411 Bacteria 2359
274 Ga0439465_0000928 3300041413 Bacteria 9300
275 Ga0439465_0008747 3300041413 Bacteria 3191
276 Ga0451789_0001997 3300041443 Bacteria 2172
277 Ga0451791_0236912 3300041451 Bacteria 5069
278 Ga0451793_0021053 3300041452 Bacteria 13856
279 Ga0451793_0686156 3300041452 Bacteria 2775
280 Ga0451797_0471812 3300041453 Bacteria 1708
281 Ga0451802_1089581 3300041460 Bacteria 3589
282 Ga0451807_0709980 3300041486 Bacteria 2488
283 Ga0451853_0992271 3300041512 Bacteria 5789
284 Ga0439431_0001493 3300041997 Bacteria 5167
285 Ga0439431_0004839 3300041997 Bacteria 2967
286 Ga0439445_0001493 3300042004 Bacteria 5091
287 Ga0439448_0031674 3300042005 Bacteria 1680
288 Ga0439434_0011538 3300042435 Bacteria 2613
289 Ga0466969_0011144 3300044656 Bacteria 4762
290 Ga0466972_0002603 3300044658 Bacteria 8946
291 Ga0466972_0073129 3300044658 Bacteria 1634
292 Ga0466965_0004625 3300044683 Bacteria 6130
293 Ga0466965_0004787 3300044683 Bacteria 6036
294 Ga0466965_0004921 3300044683 Bacteria 5973
295 Ga0466965_0093244 3300044683 Bacteria 1534
296 Ga0466966_0004932 3300044684 Bacteria 8778
297 Ga0466966_0013380 3300044684 Bacteria 5431
298 Ga0466966_0114196 3300044684 Bacteria 1663
299 Ga0466961_0007362 3300044693 Bacteria 7001
300 Ga0466963_0051057 3300044694 Bacteria 2740
301 Ga0466963_0154140 3300044694 Bacteria 1596
302 Ga0466971_0024283 3300044719 Bacteria 2705
303 Ga0466971_0027924 3300044719 Bacteria 2527
304 Ga0466968_0001626 3300044735 Bacteria 8122
305 Ga0466968_0007139 3300044735 Bacteria 4241
306 Ga0466970_0024771 3300044765 Bacteria 3139
307 Ga0466970_0051537 3300044765 Bacteria 2196
308 Ga0466957_0009919 3300044842 Bacteria 5445
309 Ga0466957_0034240 3300044842 Bacteria 3047
310 Ga0466957_0234270 3300044842 Bacteria 1216
311 Ga0466960_0000242 3300044901 Bacteria 18888
312 Ga0466960_0000614 3300044901 Bacteria 12302
313 Ga0466960_0085785 3300044901 Bacteria 1595
314 Ga0466959_0010446 3300045049 Bacteria 6639
315 Ga0466959_0011756 3300045049 Bacteria 6301
316 Ga0466959_0017275 3300045049 Bacteria 5286
317 Ga0466959_0047173 3300045049 Bacteria 3169
318 Ga0466959_0111108 3300045049 Bacteria 1956
319 Ga0466958_0001798 3300045836 Bacteria 10408
320 Ga0466958_0041310 3300045836 Bacteria 2774
321 Ga0466958_0080650 3300045836 Bacteria 2002
322 Ga0466958_0100864 3300045836 Bacteria 1795
323 Ga0466967_0004715 3300045976 Bacteria 9267
324 Ga0466967_0011168 3300045976 Bacteria 6785
325 Ga0466967_0015180 3300045976 Bacteria 6030
326 Ga0466967_0027716 3300045976 Bacteria 4716
327 Ga0466967_0051197 3300045976 Bacteria 3618
328 Ga0466967_0051957 3300045976 Bacteria 3595
329 Ga0466967_0067978 3300045976 Bacteria 3180
330 Ga0466967_0217128 3300045976 Bacteria 1815
331 Ga0466967_0231178 3300045976 Bacteria 1761
332 Ga0495603_0057364 3300046455 Bacteria 2304
333 Ga0495638_0009714 3300046460 Bacteria 6725
334 Ga0495638_0015781 3300046460 Bacteria 5060
335 Ga0495641_0012903 3300046461 Bacteria 4635
336 Ga0495582_0097884 3300046473 Bacteria 1641
337 Ga0495594_0046161 3300046499 Bacteria 2392
338 Ga0495606_0029324 3300046507 Bacteria 3866
339 Ga0495648_0004750 3300046524 Bacteria 11498
340 Ga0495665_0052815 3300046531 Bacteria 2151
341 Ga0495640_0011954 3300046533 Bacteria 6657
342 Ga0495658_0044135 3300046683 Bacteria 2497
343 Ga0495581_0015800 3300047315 Bacteria 4384
344 Ga0495672_0001877 3300047320 Bacteria 20005
345 Ga0495672_0029939 3300047320 Bacteria 3422
346 Ga0495673_0001853 3300047469 Bacteria 15878
347 Ga0495686_0003392 3300047472 Bacteria 13866
348 Ga0496100_0000350 3300048903 Bacteria 22459
349 Ga0496100_0003532 3300048903 Bacteria 8163
350 Ga0496100_0012618 3300048903 Bacteria 4849
351 Ga0496100_0050397 3300048903 Bacteria 2697
352 Ga0496100_0248274 3300048903 Bacteria 1315
353 Ga0496101_0000014 3300048904 Bacteria 253487
354 Ga0496101_0000140 3300048904 Bacteria 63955
355 Ga0496101_0000241 3300048904 Bacteria 40574
356 Ga0496101_0006938 3300048904 Bacteria 7315
357 Ga0496101_0259586 3300048904 Bacteria 1355
358 Ga0496102_0000041 3300048905 Bacteria 196634
359 Ga0496102_0000396 3300048905 Bacteria 50858
360 Ga0496102_0001025 3300048905 Bacteria 26029
361 Ga0496102_0002609 3300048905 Bacteria 15345
362 Ga0496102_0009811 3300048905 Bacteria 8233
363 Ga0496102_0053696 3300048905 Bacteria 3672
364 Ga0496102_0056724 3300048905 Bacteria 3574
365 Ga0496102_0063403 3300048905 Bacteria 3384
366 Ga0496102_0113451 3300048905 Bacteria 2528
367 Ga0496102_0164985 3300048905 Bacteria 2084
368 Ga0496103_0000058 3300048906 Bacteria 141099
369 Ga0496103_0000183 3300048906 Bacteria 63106
370 Ga0496103_0001434 3300048906 Bacteria 15996
371 Ga0496103_0028531 3300048906 Bacteria 3388
372 Ga0496104_0014962 3300048907 Bacteria 7017
373 Ga0496104_0062068 3300048907 Bacteria 3543
374 Ga0496104_0087372 3300048907 Bacteria 2978
375 Ga0496105_0014196 3300048908 Bacteria 6339
376 Ga0496105_0209298 3300048908 Bacteria 1590
377 Ga0496106_0000410 3300048909 Bacteria 30399
378 Ga0496106_0000638 3300048909 Bacteria 25113
379 Ga0496106_0013150 3300048909 Bacteria 6107
380 Ga0496106_0093935 3300048909 Bacteria 2318
381 Ga0496107_0000483 3300048910 Bacteria 21887
382 Ga0496107_0002414 3300048910 Bacteria 12105
383 Ga0496107_0042742 3300048910 Bacteria 3255
384 Ga0496107_0043851 3300048910 Bacteria 3214
385 Ga0496107_0089934 3300048910 Bacteria 2242
386 Ga0496108_0001474 3300048911 Bacteria 18582
387 Ga0496108_0011047 3300048911 Bacteria 7332
388 Ga0496108_0310984 3300048911 Bacteria 1373
389 Ga0496109_0000161 3300048912 Bacteria 65633
390 Ga0496109_0006892 3300048912 Bacteria 9582
391 Ga0496109_0077411 3300048912 Bacteria 3061
392 Ga0496109_0091265 3300048912 Bacteria 2817
393 Ga0496110_0010223 3300048913 Bacteria 7624
394 Ga0496110_0054353 3300048913 Bacteria 3522
395 Ga0496111_0029440 3300048914 Bacteria 3901
396 Ga0496112_0003272 3300048915 Bacteria 13373
397 Ga0496112_0022831 3300048915 Bacteria 5969
398 Ga0496112_0155825 3300048915 Bacteria 2251
399 Ga0496114_0000496 3300048917 Bacteria 28786
400 Ga0496114_0016900 3300048917 Bacteria 5883
401 Ga0496114_0018407 3300048917 Bacteria 5646
402 Ga0496114_0089129 3300048917 Bacteria 2618
403 Ga0496114_0179772 3300048917 Bacteria 1847
404 Ga0496115_0000836 3300048918 Bacteria 22503
405 Ga0496115_0010211 3300048918 Bacteria 7006
406 Ga0496115_0020245 3300048918 Bacteria 5130
407 Ga0496116_0000098 3300048919 Bacteria 196497
408 Ga0496117_0000096 3300048920 Bacteria 196788
409 Ga0496117_0001778 3300048920 Bacteria 29523
410 Ga0496117_0054364 3300048920 Bacteria 2805
411 Ga0496118_0000067 3300048921 Bacteria 207219
412 Ga0496118_0000073 3300048921 Bacteria 196712
413 Ga0496118_0000461 3300048921 Bacteria 67437
414 Ga0496118_0023244 3300048921 Bacteria 5389
415 Ga0496119_0032739 3300048922 Bacteria 3460
416 Ga0496119_0037133 3300048922 Bacteria 3169
417 Ga0496119_0128080 3300048922 Bacteria 1386
418 Ga0496120_0003981 3300048923 Bacteria 12836
419 Ga0496121_0000002 3300048924 Bacteria 1494588
420 Ga0496121_0003647 3300048924 Bacteria 21657
421 Ga0496122_0005035 3300048925 Bacteria 15982
422 Ga0496123_0081650 3300048926 Bacteria 1963
423 Ga0496124_0000002 3300048927 Bacteria 1494588
424 Ga0496124_0066575 3300048927 Bacteria 2999
425 Ga0496124_0103284 3300048927 Bacteria 2306
426 Ga0496125_0000002 3300048928 Bacteria 1480920
427 Ga0496125_0019362 3300048928 Bacteria 6422
428 Ga0496126_0000009 3300048929 Bacteria 750350
429 Ga0496126_0002602 3300048929 Bacteria 24056
430 Ga0496126_0006511 3300048929 Bacteria 12997
431 Ga0496126_0081736 3300048929 Bacteria 2855
432 Ga0501032_0003558 3300049569 Bacteria 11874
433 Ga0501032_0045328 3300049569 Bacteria 2974
434 Ga0501034_0007804 3300049571 Bacteria 11385
435 Ga0501034_0018322 3300049571 Bacteria 7183
436 Ga0501036_0001947 3300049572 Bacteria 16022
437 Ga0501036_0150244 3300049572 Bacteria 1965
438 Ga0501037_0000190 3300049573 Bacteria 56966
439 Ga0501037_0004900 3300049573 Bacteria 9740
440 Ga0501043_0005724 3300049579 Bacteria 10011
441 Ga0501046_0002953 3300049580 Bacteria 15736
442 Ga0501047_0022934 3300049581 Bacteria 5992
443 Ga0501048_0008880 3300049582 Bacteria 7566
444 Ga0501069_0015660 3300049585 Bacteria 4065
445 Ga0501069_0018824 3300049585 Bacteria 3729
446 Ga0501070_0000521 3300049586 Bacteria 35236
447 Ga0501070_0083993 3300049586 Bacteria 2636
448 Ga0501073_0030923 3300049589 Bacteria 3822
449 Ga0501073_0041823 3300049589 Bacteria 3237
450 Ga0501073_0078338 3300049589 Bacteria 2300
451 Ga0501080_0329863 3300049742 Bacteria 1380
452 Ga0501083_0082153 3300049744 Bacteria 2135
453 Ga0501035_0002236 3300049822 Bacteria 19181
454 Ga0501044_0006785 3300049823 Bacteria 12621
455 Ga0501044_0010888 3300049823 Bacteria 9870
456 Ga0501044_0059390 3300049823 Bacteria 3918
457 Ga0501044_0180260 3300049823 Bacteria 2080
458 Ga0501044_0259411 3300049823 Bacteria 1677
459 nmdc:mga03n38_161_c1 3300050490 Bacteria 14893
460 nmdc:mga03n38_2311_c1 3300050490 Bacteria 5850
461 nmdc:mga03n38_602_c1 3300050490 Bacteria 9185
462 nmdc:mga03n38_9240_c1 3300050490 Bacteria 3576
463 nmdc:mga00v17_24305_c1 3300050491 Bacteria 3513
464 nmdc:mga00v17_25563_c1 3300050491 Bacteria 3433
465 nmdc:mga00v17_2765_c1 3300050491 Bacteria 4856
466 nmdc:mga00v17_42677_c1 3300050491 Bacteria 2729
467 nmdc:mga00v17_4515_c1 3300050491 Bacteria 7245
468 nmdc:mga00v17_76716_c1 3300050491 Bacteria 2080
469 nmdc:mga0yw44_30655_c1 3300050492 Bacteria 3119
470 nmdc:mga0yw44_88623_c1 3300050492 Bacteria 1951
471 nmdc:mga06z11_1000_c1 3300050494 Bacteria 10307
472 nmdc:mga06z11_119559_c1 3300050494 Bacteria 1468
473 nmdc:mga06z11_173553_c1 3300050494 Bacteria 1239
474 nmdc:mga07m45_199_c1 3300050496 Bacteria 23682
475 nmdc:mga07m45_33544_c1 3300050496 Bacteria 2851
476 nmdc:mga05p37_69209_c1 3300050507 Bacteria 4341
477 nmdc:mga0qj67_135025_c1 3300050509 Bacteria 1999
478 nmdc:mga06r32_2284_c4 3300050510 Bacteria 7415
479 nmdc:mga0sz30_1229_c1 3300050516 Bacteria 7305
480 nmdc:mga0sz30_1451_c1 3300050516 Bacteria 8465
481 nmdc:mga0sz30_16335_c1 3300050516 Bacteria 1656
482 nmdc:mga0sz30_18394_c1 3300050516 Bacteria 2796
483 nmdc:mga0sz30_26345_c1 3300050516 Bacteria 2382
484 nmdc:mga0sz30_7440_c1 3300050516 Bacteria 4106
485 nmdc:mga0sz30_8052_c1 3300050516 Bacteria 3970
486 Ga0500610_0004842 3300053079 Bacteria 5422
487 Ga0500635_0001649 3300053080 Bacteria 5390
488 Ga0500643_007886 3300053087 Bacteria 4241
489 Ga0500646_0025707 3300053090 Bacteria 1592
490 Ga0500556_0007032 3300053104 Bacteria 3211
491 Ga0500652_004959 3300053131 Bacteria 4161
492 Ga0500645_000031 3300053730 Bacteria 119643
493 Ga0500645_013611 3300053730 Bacteria 2607
494 2523382366 2523231044 Bacteria 6434991
495 2583149241 2582580736 Bacteria 5325865
496 2586057814 2585427649 Bacteria 9053857
497 2644487344 2643221687 Bacteria 6500351
498 2644638955 2643221715 Bacteria 6671032
499 2738665791 2738541264 Bacteria 5935393
500 2738702628 2738541274 Bacteria 6909446
501 2739144925 2738541356 Bacteria 5935017
502 2739329538 2738543028 Bacteria 6917070
503 2753037389 2751185725 Bacteria 5740550
504 2753325258 2751185792 Bacteria 5739090
505 2791916640 2791354901 Bacteria 8322202
506 2809593352 2808606522 Bacteria 9488490
507 2842135157 2842134933 Bacteria 5847019
508 2866612680 2866612099 Bacteria 7543886
509 2870782988 2870782633 Bacteria 9624083
510 2899366002 2899359706 Bacteria 10940472
511 2899374832 2899370129 Bacteria 6781179
512 2902794430 2902792274 Bacteria 7270173
513 2902803224 2902799365 Bacteria 5419524
514 2902814081 2902810491 Bacteria 6794147
515 2902839446 2902837492 Bacteria 6697721
516 2915768989 2915768154 Bacteria 8424322
517 2917740693 2917736166 Bacteria 9690793
518 2929213175 2929212328 Bacteria 7708288
519 2939587104 2939582691 Bacteria 7088898
520 2956942207 2956939328 Bacteria 3474458
521 2966922261 2966921586 Bacteria 3092803
522 3001121955 3001119090 Bacteria 3449530
523 8003319726 8003314358 Bacteria 10575343
524 Ga0436363_0028770
525 JGI24744J21845_10000121
526 JGI24742J22300_10001105
527 Ga0055540_1000049
528 Ga0055540_1001186
529 Ga0055540_1007323
530 Ga0070676_10146308
531 Ga0070683_100190268
532 Ga0070690_100011113
533 Ga0068869_100024517
534 Ga0068869_100026753
535 Ga0068868_100211097
536 Ga0070689_100004530
537 Ga0070668_100001480
538 Ga0070668_100002708
539 Ga0070668_100003755
540 Ga0070668_100021242
541 Ga0070669_100005973
542 Ga0070671_100002378
543 Ga0070671_100057641
544 Ga0070671_100195491
545 Ga0070674_100010917
546 Ga0070674_100078459
547 Ga0070688_100000634
548 Ga0070688_100174163
549 Ga0070659_100120871
550 Ga0070667_100000029
551 Ga0070667_100002385
552 Ga0070667_100006249
553 Ga0070709_10127242
554 Ga0070714_100041118
555 Ga0070713_100052673
556 Ga0070710_10002244
557 Ga0070710_10004356
558 Ga0070711_100002139
559 Ga0070705_100002682
560 Ga0070705_100007551
561 Ga0070700_100005654
562 Ga0070694_100029559
563 Ga0070663_100013316
564 Ga0070663_100044928
565 Ga0070678_100000705
566 Ga0070662_100000781
567 Ga0070662_100058684
568 Ga0068867_100001331
569 Ga0070684_100196684
570 Ga0068853_100003298
571 Ga0068853_100048969
572 Ga0070695_100005235
573 Ga0070665_100026226
574 Ga0070665_100069234
575 Ga0070665_100176119
576 Ga0070704_100001287
577 Ga0070704_100010537
578 Ga0068855_100283544
579 Ga0070664_100145548
580 Ga0068854_100001080
581 Ga0068854_100084756
582 Ga0070702_100000284
583 Ga0068852_100072347
584 Ga0068852_100281499
585 Ga0068859_100001467
586 Ga0068859_100004146
587 Ga0068864_100130803
588 Ga0068864_100253903
589 Ga0068866_10000683
590 Ga0068861_100001239
591 Ga0068863_100000465
592 Ga0068863_100012538
593 Ga0068858_100005427
594 Ga0068858_100020008
595 Ga0068860_100000088
596 Ga0068860_100147970
597 Ga0068862_100000056
598 Ga0068862_100006390
599 Ga0081455_10000037
600 Ga0081455_10115786
601 Ga0081538_10067437
602 Ga0081540_1023668
603 Ga0081539_10000027
604 Ga0070717_10006935
605 Ga0070717_10127140
606 Ga0075365_10006627
607 Ga0075365_10014230
608 Ga0075365_10026748
609 Ga0075365_10029399
610 Ga0075363_100000041
611 Ga0075363_100000435
612 Ga0075363_100000516
613 Ga0075363_100007919
614 Ga0075364_10013206
615 Ga0075364_10014042
616 Ga0075364_10014673
617 Ga0075364_10015251
618 Ga0075364_10023795
619 Ga0075364_10089322
620 Ga0070715_10002952
621 Ga0070716_100003099
622 Ga0070712_100000620
623 Ga0075362_10018107
624 Ga0075362_10020122
625 Ga0075362_10076474
626 Ga0075367_10002795
627 Ga0075369_10002281
628 Ga0075369_10010502
629 Ga0075369_10011212
630 Ga0075369_10026568
631 Ga0075369_10069546
632 Ga0075370_10000847
633 Ga0075370_10025187
634 Ga0075428_100014431
635 Ga0075430_100047321
636 Ga0075430_100195133
637 Ga0075431_100031921
638 Ga0068865_100000595
639 Ga0097620_100001467
640 Ga0097620_100004146
641 Ga0105240_10284077
642 Ga0105245_10000753
643 Ga0105245_10063502
644 Ga0105245_10133775
645 Ga0105245_10270129
646 Ga0105247_10000008
647 Ga0105247_10001050
648 Ga0105243_10000842
649 Ga0105243_10139381
650 Ga0105241_10065721
651 Ga0105242_10000885
652 Ga0105248_10000051
653 Ga0105248_10158682
654 Ga0105237_10007605
655 Ga0105237_10196757
656 Ga0105237_10236862
657 Ga0105238_10107324
658 Ga0105238_10318444
659 Ga0105249_10000040
660 Ga0105249_10002280
661 Ga0105249_10014474
662 Ga0105249_10179497
663 Ga0105239_10003892
664 Ga0105239_10022266
665 Ga0105246_10043427
666 Ga0157369_10074635
667 Ga0157378_10003960
668 Ga0163162_10003429
669 Ga0163162_10085191
670 Ga0163162_10510151
671 Ga0157375_10000340
672 Ga0157380_10000251
673 Ga0157380_10115729
674 Ga0157379_10002200
675 Ga0157376_10293299
676 Ga0163161_10000280
677 Ga0213876_10000845
678 Ga0213876_10057985
679 Ga0213876_10087013
680 Ga0213876_10095002
681 Ga0209673_1012854
682 Ga0209051_1000034
683 Ga0209051_1011403
684 Ga0209051_1021238
685 Ga0207642_10002542
686 Ga0207710_10000006
687 Ga0207685_10003925
688 Ga0207685_10005007
689 Ga0207699_10006468
690 Ga0207699_10021481
691 Ga0207671_10012980
692 Ga0207693_10000806
693 Ga0207693_10002376
694 Ga0207663_10019762
695 Ga0207662_10108409
696 Ga0207657_10041417
697 Ga0207657_10093353
698 Ga0207681_10004258
699 Ga0207681_10004678
700 Ga0207681_10087506
701 Ga0207687_10003359
702 Ga0207700_10085353
703 Ga0207664_10040831
704 Ga0207664_10117965
705 Ga0207644_10004046
706 Ga0207644_10025202
707 Ga0207644_10152928
708 Ga0207706_10005681
709 Ga0207706_10024426
710 Ga0207706_10036400
711 Ga0207706_10155906
712 Ga0207709_10003804
713 Ga0207670_10005801
714 Ga0207669_10000179
715 Ga0207704_10000844
716 Ga0207665_10006775
717 Ga0207691_10094099
718 Ga0207711_10000811
719 Ga0207689_10005658
720 Ga0207689_10019792
721 Ga0207689_10033519
722 Ga0207712_10000017
723 Ga0207712_10036837
724 Ga0207712_10131364
725 Ga0207668_10008413
726 Ga0207668_10019592
727 Ga0207668_10100437
728 Ga0207668_10129984
729 Ga0207640_10002497
730 Ga0207658_10000016
731 Ga0207658_10001453
732 Ga0207658_10012328
733 Ga0207677_10003614
734 Ga0207703_10002078
735 Ga0207703_10022295
736 Ga0207639_10074758
737 Ga0207678_10000108
738 Ga0207678_10005674
739 Ga0207678_10018894
740 Ga0207708_10005354
741 Ga0207708_10020280
742 Ga0207641_10000564
743 Ga0207641_10004585
744 Ga0207648_10001139
745 Ga0207648_10073013
746 Ga0207648_10109035
747 Ga0207676_10228087
748 Ga0207674_10279782
749 Ga0207675_100002192
750 Ga0207675_100133234
751 Ga0207683_10000390
752 Ga0207683_10023579
753 Ga0207683_10175100
754 Ga0207698_10064759
755 Ga0268266_10006132
756 Ga0268266_10035902
757 Ga0268266_10231506
758 Ga0268265_10000068
759 Ga0268264_10000056
760 Ga0268264_10007790
761 Ga0268264_10123733
762 Ga0265327_10000004
763 Ga0265327_10000274
764 Ga0265327_10007084
765 Ga0265327_10007871
766 Ga0307513_10060222
767 Ga0307513_10070895
768 Ga0307513_10078908
769 Ga0307413_10000679
770 Ga0307518_10001566
771 Ga0307410_10092935
772 Ga0307406_10025644
773 Ga0307409_100005629
774 Ga0307409_100081348
775 Ga0307409_100147494
776 Ga0307416_100013931
777 Ga0307411_10001739
778 Ga0307415_100009079
779 Ga0307507_10004841
780 Ga0307507_10193725
781 Ga0307510_10041437
782 Ga0373956_0002749
783 Ga0395900_0178123
784 Ga0436364_0230724
785 Ga0436364_0741966
786 Ga0436364_1215586
787 Ga0436365_0139519
788 Ga0436365_0375738
789 Ga0436365_0433207
790 Ga0436365_0596616
791 Ga0436365_0725179
792 Ga0436365_0968026
793 Ga0436365_1564100
794 Ga0439461_0003658
795 Ga0439466_0006203
796 Ga0439466_0020448
797 Ga0439465_0000928
798 Ga0439465_0008747
799 Ga0451789_0001997
800 Ga0451791_0236912
801 Ga0451793_0021053
802 Ga0451793_0686156
803 Ga0451797_0471812
804 Ga0451802_1089581
805 Ga0451807_0709980
806 Ga0451853_0992271
807 Ga0439431_0001493
808 Ga0439431_0004839
809 Ga0439445_0001493
810 Ga0439448_0031674
811 Ga0439434_0011538
812 Ga0466969_0011144
813 Ga0466972_0002603
814 Ga0466972_0073129
815 Ga0466965_0004625
816 Ga0466965_0004787
817 Ga0466965_0004921
818 Ga0466965_0093244
819 Ga0466966_0004932
820 Ga0466966_0013380
821 Ga0466966_0114196
822 Ga0466961_0007362
823 Ga0466963_0051057
824 Ga0466963_0154140
825 Ga0466971_0024283
826 Ga0466971_0027924
827 Ga0466968_0001626
828 Ga0466968_0007139
829 Ga0466970_0024771
830 Ga0466970_0051537
831 Ga0466957_0009919
832 Ga0466957_0034240
833 Ga0466957_0234270
834 Ga0466960_0000242
835 Ga0466960_0000614
836 Ga0466960_0085785
837 Ga0466959_0010446
838 Ga0466959_0011756
839 Ga0466959_0017275
840 Ga0466959_0047173
841 Ga0466959_0111108
842 Ga0466958_0001798
843 Ga0466958_0041310
844 Ga0466958_0080650
845 Ga0466958_0100864
846 Ga0466967_0004715
847 Ga0466967_0011168
848 Ga0466967_0015180
849 Ga0466967_0027716
850 Ga0466967_0051197
851 Ga0466967_0051957
852 Ga0466967_0067978
853 Ga0466967_0217128
854 Ga0466967_0231178
855 Ga0495603_0057364
856 Ga0495638_0009714
857 Ga0495638_0015781
858 Ga0495641_0012903
859 Ga0495582_0097884
860 Ga0495594_0046161
861 Ga0495606_0029324
862 Ga0495648_0004750
863 Ga0495665_0052815
864 Ga0495640_0011954
865 Ga0495658_0044135
866 Ga0495581_0015800
867 Ga0495672_0001877
868 Ga0495672_0029939
869 Ga0495673_0001853
870 Ga0495686_0003392
871 Ga0496100_0000350
872 Ga0496100_0003532
873 Ga0496100_0012618
874 Ga0496100_0050397
875 Ga0496100_0248274
876 Ga0496101_0000014
877 Ga0496101_0000140
878 Ga0496101_0000241
879 Ga0496101_0006938
880 Ga0496101_0259586
881 Ga0496102_0000041
882 Ga0496102_0000396
883 Ga0496102_0001025
884 Ga0496102_0002609
885 Ga0496102_0009811
886 Ga0496102_0053696
887 Ga0496102_0056724
888 Ga0496102_0063403
889 Ga0496102_0113451
890 Ga0496102_0164985
891 Ga0496103_0000058
892 Ga0496103_0000183
893 Ga0496103_0001434
894 Ga0496103_0028531
895 Ga0496104_0014962
896 Ga0496104_0062068
897 Ga0496104_0087372
898 Ga0496105_0014196
899 Ga0496105_0209298
900 Ga0496106_0000410
901 Ga0496106_0000638
902 Ga0496106_0013150
903 Ga0496106_0093935
904 Ga0496107_0000483
905 Ga0496107_0002414
906 Ga0496107_0042742
907 Ga0496107_0043851
908 Ga0496107_0089934
909 Ga0496108_0001474
910 Ga0496108_0011047
911 Ga0496108_0310984
912 Ga0496109_0000161
913 Ga0496109_0006892
914 Ga0496109_0077411
915 Ga0496109_0091265
916 Ga0496110_0010223
917 Ga0496110_0054353
918 Ga0496111_0029440
919 Ga0496112_0003272
920 Ga0496112_0022831
921 Ga0496112_0155825
922 Ga0496114_0000496
923 Ga0496114_0016900
924 Ga0496114_0018407
925 Ga0496114_0089129
926 Ga0496114_0179772
927 Ga0496115_0000836
928 Ga0496115_0010211
929 Ga0496115_0020245
930 Ga0496116_0000098
931 Ga0496117_0000096
932 Ga0496117_0001778
933 Ga0496117_0054364
934 Ga0496118_0000067
935 Ga0496118_0000073
936 Ga0496118_0000461
937 Ga0496118_0023244
938 Ga0496119_0032739
939 Ga0496119_0037133
940 Ga0496119_0128080
941 Ga0496120_0003981
942 Ga0496121_0000002
943 Ga0496121_0003647
944 Ga0496122_0005035
945 Ga0496123_0081650
946 Ga0496124_0000002
947 Ga0496124_0066575
948 Ga0496124_0103284
949 Ga0496125_0000002
950 Ga0496125_0019362
951 Ga0496126_0000009
952 Ga0496126_0002602
953 Ga0496126_0006511
954 Ga0496126_0081736
955 Ga0501032_0003558
956 Ga0501032_0045328
957 Ga0501034_0007804
958 Ga0501034_0018322
959 Ga0501036_0001947
960 Ga0501036_0150244
961 Ga0501037_0000190
962 Ga0501037_0004900
963 Ga0501043_0005724
964 Ga0501046_0002953
965 Ga0501047_0022934
966 Ga0501048_0008880
967 Ga0501069_0015660
968 Ga0501069_0018824
969 Ga0501070_0000521
970 Ga0501070_0083993
971 Ga0501073_0030923
972 Ga0501073_0041823
973 Ga0501073_0078338
974 Ga0501080_0329863
975 Ga0501083_0082153
976 Ga0501035_0002236
977 Ga0501044_0006785
978 Ga0501044_0010888
979 Ga0501044_0059390
980 Ga0501044_0180260
981 Ga0501044_0259411
982 nmdc:mga03n38_161_c1
983 nmdc:mga03n38_2311_c1
984 nmdc:mga03n38_602_c1
985 nmdc:mga03n38_9240_c1
986 nmdc:mga00v17_24305_c1
987 nmdc:mga00v17_25563_c1
988 nmdc:mga00v17_2765_c1
989 nmdc:mga00v17_42677_c1
990 nmdc:mga00v17_4515_c1
991 nmdc:mga00v17_76716_c1
992 nmdc:mga0yw44_30655_c1
993 nmdc:mga0yw44_88623_c1
994 nmdc:mga06z11_1000_c1
995 nmdc:mga06z11_119559_c1
996 nmdc:mga06z11_173553_c1
997 nmdc:mga07m45_199_c1
998 nmdc:mga07m45_33544_c1
999 nmdc:mga05p37_69209_c1
1000 nmdc:mga0qj67_135025_c1
1001 nmdc:mga06r32_2284_c4
1002 nmdc:mga0sz30_1229_c1
1003 nmdc:mga0sz30_1451_c1
1004 nmdc:mga0sz30_16335_c1
1005 nmdc:mga0sz30_18394_c1
1006 nmdc:mga0sz30_26345_c1
1007 nmdc:mga0sz30_7440_c1
1008 nmdc:mga0sz30_8052_c1
1009 Ga0500610_0004842
1010 Ga0500635_0001649
1011 Ga0500643_007886
1012 Ga0500646_0025707
1013 Ga0500556_0007032
1014 Ga0500652_004959
1015 Ga0500645_000031
1016 Ga0500645_013611
1017 2523382366
1018 2583149241
1019 2586057814
1020 2644487344
1021 2644638955
1022 2738665791
1023 2738702628
1024 2739144925
1025 2739329538
1026 2753037389
1027 2753325258
1028 2791916640
1029 2809593352
1030 2842135157
1031 2866612680
1032 2870782988
1033 2899366002
1034 2899374832
1035 2902794430
1036 2902803224
1037 2902814081
1038 2902839446
1039 2915768989
1040 2917740693
1041 2929213175
1042 2939587104
1043 2956942207
1044 2966922261
1045 3001121955
1046 8003319726

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

183

322

0.95

PF03454

MoeA_C

MoeA C-terminal region (domain IV)

335

404

0.95

PF03453

MoeA_N

MoeA N-terminal region (domain I and II)

6

170

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xi8-assembly1.cif.gz_B molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 0.8128 1 395
1xi8-assembly1.cif.gz_B molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 0.8042 1 395
1xi8-assembly1.cif.gz_A molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 0.8039 1 393
1xi8-assembly1.cif.gz_A molybdenum cofactor biosynthesis protein from pyrococcus furiosus pfu-1657500-001 0.7899 1 393
4ys6-assembly1.cif.gz_A crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentans (cphy_1585, target efi-511156) with bound beta-d-glucose 0.7888 158 231
ID Description Score Start End Superfamily
af_Q58080_327_398_2.40.340.10 Mainly Beta;Beta Barrel;Beta-clip;MoeA, C-terminal, domain IV 0.9344 323 397 2.40.340.10
af_P9WJQ5_34_138_2.170.190.11 Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. 0.9263 34 138 2.170.190.11
af_Q58080_327_398_2.40.340.10 Mainly Beta;Beta Barrel;Beta-clip;MoeA, C-terminal, domain IV 0.9223 323 397 2.40.340.10
af_Q2FVY0_53_145_2.170.190.11 Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. 0.9204 46 138 2.170.190.11
af_P9WJQ5_34_138_2.170.190.11 Mainly Beta;Beta Complex;Molybdopterin biosynthesis moeA protein; domain 3;Molybdopterin biosynthesis moea protein, domain 3. 0.9178 34 138 2.170.190.11
ID Description Score Start End GO Terms
AF-X8FG60-F1-model_v4 deleted 0.9804 303 397
AF-X8FG60-F1-model_v4 deleted 0.9606 303 397
AF-A0A6G2UNJ6-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9514 267 397 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A6B3G071-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9496 156 229 GO:0005829
GO:0006777
GO:0046872
GO:0061599
AF-A0A535K998-F1-model_v4 Molybdopterin molybdenumtransferase (EC 2.10.1.1) 0.9484 294 397 GO:0005829
GO:0006777
GO:0046872
GO:0061599

Map