F458983

General Info

Members Datasets Scaffolds Average Seq Length
523 243 1046 128

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10040797|Ga0182008_100407973
Length 141
Sequence MREAGYRRIVMTEQDAPYHAHLYYVPETRAVAEATRLRLIERMESGDIPQLLFVGQLKDGKAGPHPIPQFEIHYTKAALPSVLRLIEESGLTALVHPLTDDDLADHTSLAHWIGTPIELDLSTLDPPGRNQGVARFAKSDF

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
9 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
10 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
99 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
158 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
159 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
167 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
176 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
177 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
178 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
179 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
180 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
181 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
182 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
183 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
186 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
187 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
188 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
189 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
190 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
191 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
195 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
196 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
223 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
224 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
225 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
226 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
229 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
230 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
234 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
235 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
238 2537561836 Rhodanobacter spathiphylli B39 Isolate Unclassified
239 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
240 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
241 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
242 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
243 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.85
Metatranscriptomes 0
Isolates 1.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0
Rhizoplane 5.16
Rhizosphere 89.1
Stem 0
Stem Tuber 0
Unclassified 2.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10040797 3300014497 Bacteria 2316
2 MBSR1b_contig_10418494 2162886012 Unclassified 1015
3 JGI24740J21852_10006952 3300001979 Bacteria 4643
4 JGI24739J22299_10004812 3300001989 Bacteria 5146
5 JGI24737J22298_10006099 3300001990 Bacteria 4130
6 JGI24735J21928_10024348 3300002067 Bacteria 1832
7 JGI24744J21845_10003054 3300002077 Bacteria 3428
8 Ga0055536_1001698 3300003781 Bacteria 13031
9 Ga0055536_1002016 3300003781 Bacteria 11649
10 Ga0055534_1016268 3300003784 Bacteria 1339
11 Ga0055530_10005728 3300003791 Bacteria 5781
12 Ga0055530_10039861 3300003791 Bacteria 1157
13 Ga0055531_10002077 3300003794 Bacteria 13771
14 Ga0055531_10003205 3300003794 Bacteria 10506
15 Ga0055531_10034241 3300003794 Bacteria 1616
16 Ga0065715_10149513 3300005293 Bacteria 1746
17 Ga0070658_10042210 3300005327 Bacteria 3682
18 Ga0070658_10047533 3300005327 Bacteria 3473
19 Ga0070658_10102756 3300005327 Bacteria 2364
20 Ga0070658_10398897 3300005327 Bacteria 1181
21 Ga0070658_11154731 3300005327 Bacteria 673
22 Ga0070676_10158394 3300005328 Bacteria 1455
23 Ga0070676_10173832 3300005328 Bacteria 1395
24 Ga0070676_11173893 3300005328 Bacteria 582
25 Ga0070683_100052489 3300005329 Bacteria 3777
26 Ga0070690_100005982 3300005330 Bacteria 6872
27 Ga0070670_100000807 3300005331 Bacteria 24382
28 Ga0070670_100013118 3300005331 Bacteria 7099
29 Ga0070670_100423644 3300005331 Bacteria 1177
30 Ga0070670_100679626 3300005331 Bacteria 925
31 Ga0070666_10002373 3300005335 Bacteria 11380
32 Ga0070666_10002658 3300005335 Bacteria 10780
33 Ga0070682_100001349 3300005337 Bacteria 13850
34 Ga0070682_100011369 3300005337 Bacteria 5085
35 Ga0070682_101427837 3300005337 Bacteria 593
36 Ga0068868_100000007 3300005338 Bacteria 123028
37 Ga0068868_100221026 3300005338 Bacteria 1586
38 Ga0068868_100483146 3300005338 Bacteria 1082
39 Ga0068868_100571614 3300005338 Bacteria 998
40 Ga0068868_101839682 3300005338 Bacteria 572
41 Ga0070660_100002348 3300005339 Bacteria 13005
42 Ga0070660_100018261 3300005339 Bacteria 5123
43 Ga0070660_100029903 3300005339 Bacteria 4084
44 Ga0070660_100034146 3300005339 Bacteria 3841
45 Ga0070660_100416609 3300005339 Bacteria 1112
46 Ga0070660_100585155 3300005339 Unclassified 932
47 Ga0070660_100618299 3300005339 Bacteria 906
48 Ga0070689_100271613 3300005340 Bacteria 1404
49 Ga0070661_100009704 3300005344 Bacteria 6676
50 Ga0070661_100012197 3300005344 Bacteria 6008
51 Ga0070661_100013551 3300005344 Bacteria 5724
52 Ga0070661_100044204 3300005344 Bacteria 3254
53 Ga0070661_100094950 3300005344 Bacteria 2211
54 Ga0070661_100264398 3300005344 Bacteria 1331
55 Ga0070669_101928447 3300005353 Bacteria 516
56 Ga0070675_100450668 3300005354 Bacteria 1154
57 Ga0070671_100008387 3300005355 Bacteria 8281
58 Ga0070671_100031788 3300005355 Bacteria 4363
59 Ga0070671_100248195 3300005355 Bacteria 1512
60 Ga0070671_100310670 3300005355 Bacteria 1343
61 Ga0070674_100009580 3300005356 Bacteria 5803
62 Ga0070674_100054825 3300005356 Bacteria 2758
63 Ga0070673_100070204 3300005364 Bacteria 2810
64 Ga0070673_100071965 3300005364 Bacteria 2779
65 Ga0070673_101669540 3300005364 Bacteria 603
66 Ga0070673_101955500 3300005364 Unclassified 556
67 Ga0070659_100000004 3300005366 Bacteria 267958
68 Ga0070659_100000593 3300005366 Bacteria 26524
69 Ga0070659_100034685 3300005366 Bacteria 3925
70 Ga0070659_100076361 3300005366 Bacteria 2671
71 Ga0070659_100119348 3300005366 Bacteria 2134
72 Ga0070659_100275969 3300005366 Bacteria 1398
73 Ga0070659_101403803 3300005366 Bacteria 621
74 Ga0070667_100008431 3300005367 Bacteria 8548
75 Ga0070667_100021218 3300005367 Bacteria 5397
76 Ga0070667_100023846 3300005367 Bacteria 5080
77 Ga0070667_102253448 3300005367 Bacteria 513
78 Ga0070709_10050461 3300005434 Bacteria 2607
79 Ga0070714_100048635 3300005435 Bacteria 3607
80 Ga0070714_100262111 3300005435 Bacteria 1601
81 Ga0070713_100125548 3300005436 Bacteria 2256
82 Ga0070705_101202440 3300005440 Bacteria 624
83 Ga0070700_100341593 3300005441 Bacteria 1107
84 Ga0070708_100227692 3300005445 Bacteria 1749
85 Ga0070663_100005821 3300005455 Bacteria 7365
86 Ga0070663_100200994 3300005455 Bacteria 1555
87 Ga0070678_100009697 3300005456 Bacteria 5851
88 Ga0070678_100042578 3300005456 Bacteria 3228
89 Ga0070678_100107805 3300005456 Bacteria 2173
90 Ga0070678_100899666 3300005456 Unclassified 809
91 Ga0070662_100034885 3300005457 Bacteria 3549
92 Ga0070662_100042403 3300005457 Bacteria 3250
93 Ga0070662_100297799 3300005457 Bacteria 1310
94 Ga0070681_10003684 3300005458 Bacteria 14374
95 Ga0070681_10164084 3300005458 Bacteria 2145
96 Ga0068867_100012473 3300005459 Bacteria 6015
97 Ga0068867_100278245 3300005459 Bacteria 1371
98 Ga0068867_100381752 3300005459 Bacteria 1184
99 Ga0070685_10266186 3300005466 Bacteria 1142
100 Ga0070706_100145962 3300005467 Bacteria 2209
101 Ga0070698_100223214 3300005471 Bacteria 1817
102 Ga0070699_100213307 3300005518 Bacteria 1719
103 Ga0070679_100168452 3300005530 Bacteria 2163
104 Ga0070679_100387085 3300005530 Bacteria 1345
105 Ga0070684_100384968 3300005535 Bacteria 1292
106 Ga0068853_100129281 3300005539 Bacteria 2259
107 Ga0068853_100262360 3300005539 Bacteria 1588
108 Ga0068853_100635422 3300005539 Bacteria 1015
109 Ga0070672_100015078 3300005543 Bacteria 5493
110 Ga0070672_100053549 3300005543 Bacteria 3155
111 Ga0070672_100106406 3300005543 Bacteria 2282
112 Ga0070672_100132185 3300005543 Bacteria 2052
113 Ga0070686_100117135 3300005544 Bacteria 1824
114 Ga0070665_100022554 3300005548 Bacteria 6336
115 Ga0070665_100034005 3300005548 Bacteria 5126
116 Ga0070665_100263905 3300005548 Bacteria 1723
117 Ga0070664_100000446 3300005564 Bacteria 31189
118 Ga0070664_100002469 3300005564 Bacteria 14893
119 Ga0070664_100012179 3300005564 Bacteria 6990
120 Ga0070664_100626461 3300005564 Bacteria 999
121 Ga0070664_101414428 3300005564 Bacteria 658
122 Ga0068857_100475728 3300005577 Bacteria 1170
123 Ga0068857_101046341 3300005577 Bacteria 787
124 Ga0068854_100011091 3300005578 Bacteria 5851
125 Ga0068854_100294634 3300005578 Bacteria 1310
126 Ga0068854_100402796 3300005578 Bacteria 1133
127 Ga0068856_100229698 3300005614 Bacteria 1871
128 Ga0070702_100453230 3300005615 Bacteria 931
129 Ga0070702_101120062 3300005615 Bacteria 630
130 Ga0068852_100007528 3300005616 Bacteria 7950
131 Ga0068852_100126481 3300005616 Bacteria 2348
132 Ga0068852_100313765 3300005616 Bacteria 1521
133 Ga0068852_100554783 3300005616 Bacteria 1149
134 Ga0068852_101657455 3300005616 Bacteria 662
135 Ga0068864_100041312 3300005618 Bacteria 3944
136 Ga0068864_100041811 3300005618 Bacteria 3920
137 Ga0068866_10146917 3300005718 Bacteria 1361
138 Ga0068866_10209001 3300005718 Bacteria 1171
139 Ga0068866_10349325 3300005718 Bacteria 939
140 Ga0068851_10004531 3300005834 Bacteria 6267
141 Ga0068851_10125784 3300005834 Bacteria 1382
142 Ga0068863_100003487 3300005841 Bacteria 15520
143 Ga0068863_100009175 3300005841 Bacteria 9650
144 Ga0068863_100125153 3300005841 Bacteria 2452
145 Ga0068858_100017583 3300005842 Bacteria 6704
146 Ga0068858_100448941 3300005842 Bacteria 1242
147 Ga0068858_101679645 3300005842 Bacteria 627
148 Ga0068860_100132199 3300005843 Bacteria 2395
149 Ga0068860_100241808 3300005843 Bacteria 1756
150 Ga0068860_100792851 3300005843 Bacteria 960
151 Ga0068860_101312906 3300005843 Bacteria 744
152 Ga0068860_101788684 3300005843 Bacteria 636
153 Ga0068862_100240818 3300005844 Bacteria 1645
154 Ga0070716_100547998 3300006173 Bacteria 862
155 Ga0070712_100029285 3300006175 Bacteria 3690
156 Ga0097621_100003754 3300006237 Bacteria 10526
157 Ga0068871_100039095 3300006358 Bacteria 3794
158 Ga0068871_100165372 3300006358 Bacteria 1893
159 Ga0068871_101861190 3300006358 Bacteria 572
160 Ga0068865_100014815 3300006881 Bacteria 4961
161 Ga0105240_10629134 3300009093 Bacteria 1179
162 Ga0111539_10846806 3300009094 Bacteria 1064
163 Ga0105245_10005749 3300009098 Bacteria 10885
164 Ga0105245_10033128 3300009098 Bacteria 4577
165 Ga0105245_10642931 3300009098 Bacteria 1090
166 Ga0105245_11105329 3300009098 Bacteria 839
167 Ga0105247_10241365 3300009101 Bacteria 1231
168 Ga0105243_10239042 3300009148 Bacteria 1615
169 Ga0105241_11251097 3300009174 Bacteria 705
170 Ga0105242_10016587 3300009176 Bacteria 5728
171 Ga0105242_11830404 3300009176 Bacteria 646
172 Ga0105248_10002658 3300009177 Bacteria 19845
173 Ga0105248_10051378 3300009177 Bacteria 4625
174 Ga0105248_11528662 3300009177 Bacteria 756
175 Ga0105248_12152984 3300009177 Bacteria 634
176 Ga0105238_10009673 3300009551 Bacteria 9649
177 Ga0105238_10015503 3300009551 Bacteria 7714
178 Ga0105238_10025107 3300009551 Bacteria 6073
179 Ga0105249_10825642 3300009553 Bacteria 992
180 Ga0105239_10310123 3300010375 Bacteria 1778
181 Ga0105239_11645185 3300010375 Bacteria 743
182 Ga0105246_10004544 3300011119 Bacteria 8442
183 Ga0157373_10109749 3300013100 Bacteria 1939
184 Ga0157373_10121646 3300013100 Bacteria 1835
185 Ga0157373_10304068 3300013100 Bacteria 1132
186 Ga0157373_10394862 3300013100 Bacteria 991
187 Ga0157373_10550163 3300013100 Bacteria 837
188 Ga0157373_11554706 3300013100 Bacteria 506
189 Ga0157371_10013415 3300013102 Bacteria 6221
190 Ga0157371_10037322 3300013102 Bacteria 3478
191 Ga0157371_10061242 3300013102 Bacteria 2668
192 Ga0157371_10098035 3300013102 Bacteria 2078
193 Ga0157371_10132648 3300013102 Bacteria 1773
194 Ga0157371_10196086 3300013102 Bacteria 1447
195 Ga0157371_10489654 3300013102 Bacteria 907
196 Ga0157370_10536683 3300013104 Bacteria 1073
197 Ga0157369_10049778 3300013105 Bacteria 4540
198 Ga0157369_10484776 3300013105 Bacteria 1280
199 Ga0157374_10035946 3300013296 Bacteria 4535
200 Ga0157374_11728532 3300013296 Bacteria 650
201 Ga0157378_10023762 3300013297 Bacteria 5392
202 Ga0157378_10097308 3300013297 Bacteria 2682
203 Ga0157378_10823953 3300013297 Unclassified 955
204 Ga0157378_11076549 3300013297 Bacteria 840
205 Ga0157378_11544511 3300013297 Bacteria 709
206 Ga0163162_10053636 3300013306 Bacteria 4053
207 Ga0163162_10181955 3300013306 Bacteria 2228
208 Ga0163162_10565098 3300013306 Bacteria 1265
209 Ga0163162_10734439 3300013306 Bacteria 1107
210 Ga0157375_10003831 3300013308 Bacteria 13044
211 Ga0157375_10589018 3300013308 Bacteria 1272
212 Ga0163163_10019009 3300014325 Bacteria 6446
213 Ga0163163_11385304 3300014325 Bacteria 765
214 Ga0157380_10005520 3300014326 Bacteria 8841
215 Ga0157380_10014950 3300014326 Bacteria 5692
216 Ga0157380_12159454 3300014326 Bacteria 620
217 Ga0182008_10225474 3300014497 Bacteria 960
218 Ga0157377_10096494 3300014745 Bacteria 1754
219 Ga0157379_11082766 3300014968 Unclassified 767
220 Ga0157376_10008139 3300014969 Bacteria 7538
221 Ga0157376_10619876 3300014969 Bacteria 1079
222 Ga0182006_1049364 3300015261 Bacteria 1624
223 Ga0163161_10505097 3300017792 Bacteria 985
224 Ga0209565_1011023 3300025263 Bacteria 2219
225 Ga0207673_1032552 3300025290 Bacteria 724
226 Ga0209675_1001039 3300025291 Bacteria 17298
227 Ga0209676_1000118 3300025292 Bacteria 201939
228 Ga0209676_1000372 3300025292 Bacteria 83114
229 Ga0209758_1125750 3300025297 Bacteria 685
230 Ga0209050_1000115 3300025298 Bacteria 204622
231 Ga0209050_1005056 3300025298 Bacteria 8533
232 Ga0209050_1012871 3300025298 Bacteria 3785
233 Ga0209257_1000445 3300025304 Bacteria 77902
234 Ga0209257_1001251 3300025304 Bacteria 31407
235 Ga0209257_1001681 3300025304 Bacteria 24922
236 Ga0207656_10005190 3300025321 Bacteria 4582
237 Ga0207656_10147063 3300025321 Bacteria 1114
238 Ga0207692_10288302 3300025898 Bacteria 995
239 Ga0207642_10107324 3300025899 Bacteria 1414
240 Ga0207710_10252917 3300025900 Bacteria 881
241 Ga0207688_10024322 3300025901 Bacteria 3321
242 Ga0207688_10388842 3300025901 Bacteria 864
243 Ga0207688_10451510 3300025901 Bacteria 801
244 Ga0207680_10001402 3300025903 Bacteria 11401
245 Ga0207680_10051721 3300025903 Bacteria 2458
246 Ga0207680_10290773 3300025903 Bacteria 1137
247 Ga0207645_10131348 3300025907 Bacteria 1630
248 Ga0207705_10060698 3300025909 Bacteria 2731
249 Ga0207705_10093269 3300025909 Bacteria 2207
250 Ga0207705_10645642 3300025909 Bacteria 823
251 Ga0207705_11060407 3300025909 Bacteria 625
252 Ga0207705_11185497 3300025909 Bacteria 586
253 Ga0207654_10161836 3300025911 Bacteria 1447
254 Ga0207654_10928242 3300025911 Bacteria 632
255 Ga0207707_10005151 3300025912 Bacteria 11458
256 Ga0207707_10492913 3300025912 Bacteria 1046
257 Ga0207693_10053189 3300025915 Bacteria 3177
258 Ga0207657_10003573 3300025919 Bacteria 16589
259 Ga0207657_10006575 3300025919 Bacteria 12036
260 Ga0207657_10013241 3300025919 Bacteria 8094
261 Ga0207657_10015543 3300025919 Bacteria 7372
262 Ga0207657_10027790 3300025919 Bacteria 5174
263 Ga0207657_10248672 3300025919 Bacteria 1418
264 Ga0207657_10288413 3300025919 Bacteria 1302
265 Ga0207649_10008713 3300025920 Bacteria 5538
266 Ga0207649_10021606 3300025920 Bacteria 3708
267 Ga0207649_10021844 3300025920 Bacteria 3692
268 Ga0207649_10024149 3300025920 Bacteria 3530
269 Ga0207649_10332694 3300025920 Bacteria 1119
270 Ga0207652_10353849 3300025921 Bacteria 1325
271 Ga0207652_10536883 3300025921 Bacteria 1052
272 Ga0207681_10472614 3300025923 Bacteria 1023
273 Ga0207694_10021141 3300025924 Bacteria 4928
274 Ga0207694_10087852 3300025924 Bacteria 2450
275 Ga0207694_10221842 3300025924 Bacteria 1542
276 Ga0207694_10646868 3300025924 Bacteria 891
277 Ga0207694_11180665 3300025924 Bacteria 648
278 Ga0207650_10073467 3300025925 Bacteria 2576
279 Ga0207659_10007798 3300025926 Bacteria 6614
280 Ga0207659_10016588 3300025926 Bacteria 4796
281 Ga0207687_10894246 3300025927 Bacteria 760
282 Ga0207644_10000274 3300025931 Bacteria 34175
283 Ga0207644_10005961 3300025931 Bacteria 7946
284 Ga0207644_10128975 3300025931 Bacteria 1934
285 Ga0207644_10207927 3300025931 Bacteria 1546
286 Ga0207644_10698527 3300025931 Unclassified 846
287 Ga0207690_10000001 3300025932 Bacteria 807539
288 Ga0207690_10000002 3300025932 Bacteria 807473
289 Ga0207690_10000003 3300025932 Bacteria 783011
290 Ga0207690_10000004 3300025932 Bacteria 746138
291 Ga0207690_10001599 3300025932 Bacteria 14135
292 Ga0207690_10019884 3300025932 Bacteria 4139
293 Ga0207690_10042210 3300025932 Bacteria 2994
294 Ga0207690_10094476 3300025932 Bacteria 2121
295 Ga0207690_10095293 3300025932 Bacteria 2114
296 Ga0207690_10310447 3300025932 Bacteria 1237
297 Ga0207690_10399077 3300025932 Bacteria 1096
298 Ga0207706_10002630 3300025933 Bacteria 17485
299 Ga0207706_10003797 3300025933 Bacteria 14399
300 Ga0207706_10013628 3300025933 Bacteria 7383
301 Ga0207706_10035916 3300025933 Bacteria 4403
302 Ga0207706_10185016 3300025933 Bacteria 1829
303 Ga0207706_10188100 3300025933 Bacteria 1813
304 Ga0207706_10896554 3300025933 Bacteria 749
305 Ga0207686_10052676 3300025934 Bacteria 2541
306 Ga0207686_11364999 3300025934 Bacteria 583
307 Ga0207709_10929919 3300025935 Bacteria 708
308 Ga0207670_10237049 3300025936 Bacteria 1404
309 Ga0207669_10004579 3300025937 Bacteria 6099
310 Ga0207669_10121298 3300025937 Bacteria 1775
311 Ga0207704_10002170 3300025938 Bacteria 8793
312 Ga0207665_10875923 3300025939 Bacteria 712
313 Ga0207691_10003446 3300025940 Bacteria 15387
314 Ga0207691_10003584 3300025940 Bacteria 15103
315 Ga0207691_10054017 3300025940 Bacteria 3665
316 Ga0207711_10121930 3300025941 Bacteria 2328
317 Ga0207711_10662623 3300025941 Bacteria 973
318 Ga0207679_10003846 3300025945 Bacteria 9310
319 Ga0207679_10006436 3300025945 Bacteria 7420
320 Ga0207679_10116303 3300025945 Bacteria 2120
321 Ga0207679_10149364 3300025945 Unclassified 1900
322 Ga0207679_10288587 3300025945 Bacteria 1410
323 Ga0207667_12082461 3300025949 Bacteria 526
324 Ga0207651_10042757 3300025960 Bacteria 3018
325 Ga0207651_10052334 3300025960 Bacteria 2783
326 Ga0207651_10460583 3300025960 Bacteria 1092
327 Ga0207651_10696659 3300025960 Bacteria 895
328 Ga0207651_11694665 3300025960 Unclassified 569
329 Ga0207640_10012258 3300025981 Bacteria 4878
330 Ga0207640_10198499 3300025981 Bacteria 1518
331 Ga0207640_10530920 3300025981 Bacteria 985
332 Ga0207640_12103453 3300025981 Bacteria 512
333 Ga0207658_10005211 3300025986 Bacteria 8947
334 Ga0207658_10037924 3300025986 Bacteria 3467
335 Ga0207658_10257990 3300025986 Bacteria 1484
336 Ga0207658_10745549 3300025986 Bacteria 887
337 Ga0207677_10000061 3300026023 Bacteria 93104
338 Ga0207677_10105037 3300026023 Bacteria 2089
339 Ga0207677_10119855 3300026023 Bacteria 1977
340 Ga0207677_11594163 3300026023 Bacteria 604
341 Ga0207703_10002986 3300026035 Bacteria 14344
342 Ga0207639_10031990 3300026041 Bacteria 3870
343 Ga0207639_11230054 3300026041 Bacteria 703
344 Ga0207678_10000587 3300026067 Bacteria 33282
345 Ga0207678_10051314 3300026067 Bacteria 3561
346 Ga0207678_10106231 3300026067 Bacteria 2395
347 Ga0207678_11484176 3300026067 Bacteria 599
348 Ga0207708_10415791 3300026075 Bacteria 1114
349 Ga0207641_10002978 3300026088 Bacteria 15327
350 Ga0207648_10002810 3300026089 Bacteria 18461
351 Ga0207676_10017558 3300026095 Bacteria 5188
352 Ga0207676_10021524 3300026095 Bacteria 4730
353 Ga0207676_10052069 3300026095 Bacteria 3198
354 Ga0207674_10427263 3300026116 Bacteria 1280
355 Ga0207674_10472278 3300026116 Unclassified 1212
356 Ga0207674_10710336 3300026116 Bacteria 970
357 Ga0207674_10773813 3300026116 Bacteria 926
358 Ga0207675_100898340 3300026118 Bacteria 902
359 Ga0207683_10001980 3300026121 Bacteria 18118
360 Ga0207683_10014479 3300026121 Bacteria 6716
361 Ga0207683_10042104 3300026121 Bacteria 3989
362 Ga0207698_10039791 3300026142 Bacteria 3486
363 Ga0207698_10122075 3300026142 Bacteria 2207
364 Ga0207698_10485334 3300026142 Bacteria 1199
365 Ga0268266_10023826 3300028379 Bacteria 5209
366 Ga0268266_10075513 3300028379 Bacteria 2928
367 Ga0268266_10338964 3300028379 Bacteria 1411
368 Ga0268265_10935545 3300028380 Unclassified 853
369 Ga0268264_10073176 3300028381 Bacteria 2907
370 Ga0268264_10116050 3300028381 Bacteria 2353
371 Ga0268264_10567165 3300028381 Bacteria 1115
372 Ga0268264_10697516 3300028381 Bacteria 1008
373 Ga0307408_100016927 3300031548 Bacteria 4873
374 Ga0307408_100124578 3300031548 Bacteria 2001
375 Ga0307405_10281777 3300031731 Bacteria 1251
376 Ga0307413_10107456 3300031824 Bacteria 1859
377 Ga0307413_10143694 3300031824 Bacteria 1652
378 Ga0307413_10325755 3300031824 Bacteria 1175
379 Ga0307413_10713637 3300031824 Bacteria 834
380 Ga0307410_10073175 3300031852 Bacteria 2382
381 Ga0307410_10077641 3300031852 Bacteria 2322
382 Ga0307410_10108357 3300031852 Bacteria 2005
383 Ga0307406_10025155 3300031901 Bacteria 3562
384 Ga0307406_10047211 3300031901 Bacteria 2713
385 Ga0307406_10090194 3300031901 Unclassified 2062
386 Ga0307406_10241550 3300031901 Bacteria 1355
387 Ga0307406_10386074 3300031901 Bacteria 1105
388 Ga0307406_10610909 3300031901 Bacteria 900
389 Ga0307406_11147086 3300031901 Bacteria 673
390 Ga0307407_10031369 3300031903 Bacteria 2877
391 Ga0307407_10729845 3300031903 Bacteria 748
392 Ga0307407_10747006 3300031903 Bacteria 740
393 Ga0307412_10058377 3300031911 Bacteria 2580
394 Ga0307412_10116180 3300031911 Bacteria 1919
395 Ga0307412_10159621 3300031911 Bacteria 1673
396 Ga0307412_10334068 3300031911 Bacteria 1210
397 Ga0307412_10421974 3300031911 Bacteria 1091
398 Ga0307412_11473937 3300031911 Bacteria 618
399 Ga0307409_100027854 3300031995 Bacteria 4013
400 Ga0307409_100442745 3300031995 Bacteria 1252
401 Ga0307409_100579765 3300031995 Bacteria 1105
402 Ga0307416_100041138 3300032002 Bacteria 3597
403 Ga0307416_100121541 3300032002 Bacteria 2329
404 Ga0307416_100159472 3300032002 Bacteria 2082
405 Ga0307416_100727443 3300032002 Bacteria 1083
406 Ga0307414_10051444 3300032004 Bacteria 2860
407 Ga0307414_10159610 3300032004 Bacteria 1789
408 Ga0307414_11437898 3300032004 Bacteria 641
409 Ga0307411_10030755 3300032005 Bacteria 3295
410 Ga0307411_10119285 3300032005 Bacteria 1905
411 Ga0307411_10380065 3300032005 Bacteria 1161
412 Ga0307411_10407812 3300032005 Bacteria 1125
413 Ga0307415_100077141 3300032126 Unclassified 2365
414 Ga0307415_100152573 3300032126 Bacteria 1780
415 Ga0307415_100190874 3300032126 Bacteria 1616
416 Ga0373930_0069448 3300034816 Bacteria 799
417 Ga0373928_0043131 3300035084 Bacteria 1043
418 Ga0373939_0222125 3300035114 Bacteria 724
419 Ga0373945_0349404 3300035116 Bacteria 641
420 Ga0373931_0109565 3300035691 Bacteria 1565
421 Ga0373931_0494181 3300035691 Bacteria 788
422 Ga0395899_0074072 3300037312 Bacteria 2488
423 Ga0395899_0160291 3300037312 Bacteria 1590
424 Ga0395900_0007973 3300037418 Bacteria 10899
425 Ga0395900_0029097 3300037418 Bacteria 5666
426 Ga0395900_0030153 3300037418 Bacteria 5568
427 Ga0395900_0323987 3300037418 Bacteria 1520
428 Ga0395905_0000458 3300037471 Bacteria 57029
429 Ga0395905_0055532 3300037471 Bacteria 3706
430 Ga0395905_0464802 3300037471 Bacteria 1164
431 Ga0395905_0470732 3300037471 Bacteria 1155
432 Ga0395905_0535460 3300037471 Bacteria 1072
433 Ga0395905_0826087 3300037471 Bacteria 829
434 Ga0395905_0949890 3300037471 Bacteria 763
435 Ga0395905_1058152 3300037471 Bacteria 714
436 Ga0395901_0006083 3300038443 Bacteria 12226
437 Ga0395901_1180913 3300038443 Bacteria 732
438 Ga0439436_0200042 3300041404 Bacteria 571
439 Ga0451787_215351 3300041441 Bacteria 1706
440 Ga0451791_0183648 3300041451 Bacteria 3311
441 Ga0451797_0038140 3300041453 Bacteria 1484
442 Ga0451807_1752761 3300041486 Bacteria 3781
443 Ga0451833_0408336 3300041491 Bacteria 1365
444 Ga0451837_1124357 3300041494 Bacteria 3335
445 Ga0439433_0050870 3300041999 Bacteria 977
446 Ga0439437_002957 3300042000 Bacteria 1832
447 Ga0439448_0277220 3300042005 Bacteria 594
448 Ga0439432_053978 3300042006 Bacteria 1249
449 Ga0439457_059288 3300042014 Bacteria 866
450 Ga0439462_0023918 3300042015 Bacteria 1602
451 Ga0439458_0007291 3300042157 Unclassified 2460
452 Ga0439434_0017120 3300042435 Bacteria 2168
453 Ga0466969_0434967 3300044656 Bacteria 596
454 Ga0466972_0131824 3300044658 Bacteria 1177
455 Ga0466960_0139864 3300044901 Bacteria 1285
456 Ga0495616_0031650 3300046513 Bacteria 2768
457 Ga0495616_0357539 3300046513 Bacteria 607
458 Ga0495648_0010126 3300046524 Bacteria 7220
459 Ga0495668_0271285 3300046616 Bacteria 929
460 Ga0495625_0051526 3300046660 Bacteria 2951
461 Ga0495686_0002000 3300047472 Bacteria 20212
462 Ga0496100_0000539 3300048903 Bacteria 17954
463 Ga0496101_0000345 3300048904 Bacteria 31342
464 Ga0496102_0522401 3300048905 Bacteria 1110
465 Ga0496103_0046723 3300048906 Bacteria 2674
466 Ga0496104_0124421 3300048907 Bacteria 2476
467 Ga0496105_0098582 3300048908 Bacteria 2413
468 Ga0496107_0000744 3300048910 Bacteria 18671
469 Ga0496107_0215234 3300048910 Bacteria 1429
470 Ga0496108_0003683 3300048911 Bacteria 12292
471 Ga0496108_0007034 3300048911 Bacteria 9111
472 Ga0496108_0105915 3300048911 Bacteria 2401
473 Ga0496109_0005615 3300048912 Bacteria 10497
474 Ga0496109_0094687 3300048912 Bacteria 2764
475 Ga0496110_0014915 3300048913 Bacteria 6458
476 Ga0496110_0213772 3300048913 Bacteria 1753
477 Ga0496110_0967569 3300048913 Bacteria 758
478 Ga0496111_0000536 3300048914 Bacteria 19644
479 Ga0496111_0027369 3300048914 Bacteria 4033
480 Ga0496111_0155455 3300048914 Bacteria 1697
481 Ga0496112_0001133 3300048915 Bacteria 19825
482 Ga0496112_0020281 3300048915 Bacteria 6297
483 Ga0496113_0000703 3300048916 Bacteria 17113
484 Ga0496113_0315629 3300048916 Bacteria 1252
485 Ga0496125_0378497 3300048928 Bacteria 835
486 Ga0501032_0011940 3300049569 Bacteria 6220
487 Ga0501033_0014513 3300049570 Bacteria 5980
488 Ga0501033_0135646 3300049570 Bacteria 1781
489 Ga0501034_0086865 3300049571 Bacteria 3128
490 Ga0501036_0056886 3300049572 Bacteria 3313
491 Ga0501037_0024847 3300049573 Bacteria 4429
492 Ga0501037_0063643 3300049573 Bacteria 2688
493 Ga0501038_0088592 3300049574 Bacteria 2598
494 Ga0501039_0029447 3300049575 Bacteria 4229
495 Ga0501043_0068970 3300049579 Bacteria 2777
496 Ga0501047_0052254 3300049581 Bacteria 3949
497 Ga0501047_0255576 3300049581 Bacteria 1600
498 Ga0501070_0096200 3300049586 Bacteria 2450
499 Ga0501207_015996 3300049654 Bacteria 1160
500 Ga0501209_056717 3300049656 Bacteria 1083
501 Ga0501217_052045 3300049661 Bacteria 1073
502 Ga0501223_093321 3300049663 Bacteria 613
503 Ga0501233_077794 3300049668 Bacteria 850
504 Ga0501225_0102543 3300049705 Bacteria 837
505 Ga0501262_033243 3300049759 Bacteria 749
506 Ga0501270_006402 3300049767 Bacteria 1412
507 Ga0501272_051288 3300049769 Bacteria 573
508 Ga0501035_0008030 3300049822 Bacteria 9836
509 Ga0501035_0091510 3300049822 Bacteria 2677
510 Ga0501044_0008443 3300049823 Bacteria 11290
511 Ga0501044_0015747 3300049823 Bacteria 8144
512 Ga0501044_0795218 3300049823 Bacteria 825
513 Ga0501212_048508 3300049851 Bacteria 715
514 Ga0500644_0146363 3300053088 Bacteria 943
515 Ga0500592_004258 3300053116 Bacteria 2284
516 Ga0500658_0314242 3300053134 Bacteria 720
517 Ga0500568_0003124 3300053139 Bacteria 9439
518 2538834671 2537561836 Bacteria 3910579
519 2643829804 2643221562 Bacteria 4048635
520 2643833969 2643221563 Bacteria 4726935
521 2644054895 2643221608 Bacteria 4724829
522 2852654577 2852653556 Bacteria 4050083
523 2852684078 2852680915 Bacteria 4100189
524 Ga0182008_10040797
525 MBSR1b_contig_10418494
526 JGI24740J21852_10006952
527 JGI24739J22299_10004812
528 JGI24737J22298_10006099
529 JGI24735J21928_10024348
530 JGI24744J21845_10003054
531 Ga0055536_1001698
532 Ga0055536_1002016
533 Ga0055534_1016268
534 Ga0055530_10005728
535 Ga0055530_10039861
536 Ga0055531_10002077
537 Ga0055531_10003205
538 Ga0055531_10034241
539 Ga0065715_10149513
540 Ga0070658_10042210
541 Ga0070658_10047533
542 Ga0070658_10102756
543 Ga0070658_10398897
544 Ga0070658_11154731
545 Ga0070676_10158394
546 Ga0070676_10173832
547 Ga0070676_11173893
548 Ga0070683_100052489
549 Ga0070690_100005982
550 Ga0070670_100000807
551 Ga0070670_100013118
552 Ga0070670_100423644
553 Ga0070670_100679626
554 Ga0070666_10002373
555 Ga0070666_10002658
556 Ga0070682_100001349
557 Ga0070682_100011369
558 Ga0070682_101427837
559 Ga0068868_100000007
560 Ga0068868_100221026
561 Ga0068868_100483146
562 Ga0068868_100571614
563 Ga0068868_101839682
564 Ga0070660_100002348
565 Ga0070660_100018261
566 Ga0070660_100029903
567 Ga0070660_100034146
568 Ga0070660_100416609
569 Ga0070660_100585155
570 Ga0070660_100618299
571 Ga0070689_100271613
572 Ga0070661_100009704
573 Ga0070661_100012197
574 Ga0070661_100013551
575 Ga0070661_100044204
576 Ga0070661_100094950
577 Ga0070661_100264398
578 Ga0070669_101928447
579 Ga0070675_100450668
580 Ga0070671_100008387
581 Ga0070671_100031788
582 Ga0070671_100248195
583 Ga0070671_100310670
584 Ga0070674_100009580
585 Ga0070674_100054825
586 Ga0070673_100070204
587 Ga0070673_100071965
588 Ga0070673_101669540
589 Ga0070673_101955500
590 Ga0070659_100000004
591 Ga0070659_100000593
592 Ga0070659_100034685
593 Ga0070659_100076361
594 Ga0070659_100119348
595 Ga0070659_100275969
596 Ga0070659_101403803
597 Ga0070667_100008431
598 Ga0070667_100021218
599 Ga0070667_100023846
600 Ga0070667_102253448
601 Ga0070709_10050461
602 Ga0070714_100048635
603 Ga0070714_100262111
604 Ga0070713_100125548
605 Ga0070705_101202440
606 Ga0070700_100341593
607 Ga0070708_100227692
608 Ga0070663_100005821
609 Ga0070663_100200994
610 Ga0070678_100009697
611 Ga0070678_100042578
612 Ga0070678_100107805
613 Ga0070678_100899666
614 Ga0070662_100034885
615 Ga0070662_100042403
616 Ga0070662_100297799
617 Ga0070681_10003684
618 Ga0070681_10164084
619 Ga0068867_100012473
620 Ga0068867_100278245
621 Ga0068867_100381752
622 Ga0070685_10266186
623 Ga0070706_100145962
624 Ga0070698_100223214
625 Ga0070699_100213307
626 Ga0070679_100168452
627 Ga0070679_100387085
628 Ga0070684_100384968
629 Ga0068853_100129281
630 Ga0068853_100262360
631 Ga0068853_100635422
632 Ga0070672_100015078
633 Ga0070672_100053549
634 Ga0070672_100106406
635 Ga0070672_100132185
636 Ga0070686_100117135
637 Ga0070665_100022554
638 Ga0070665_100034005
639 Ga0070665_100263905
640 Ga0070664_100000446
641 Ga0070664_100002469
642 Ga0070664_100012179
643 Ga0070664_100626461
644 Ga0070664_101414428
645 Ga0068857_100475728
646 Ga0068857_101046341
647 Ga0068854_100011091
648 Ga0068854_100294634
649 Ga0068854_100402796
650 Ga0068856_100229698
651 Ga0070702_100453230
652 Ga0070702_101120062
653 Ga0068852_100007528
654 Ga0068852_100126481
655 Ga0068852_100313765
656 Ga0068852_100554783
657 Ga0068852_101657455
658 Ga0068864_100041312
659 Ga0068864_100041811
660 Ga0068866_10146917
661 Ga0068866_10209001
662 Ga0068866_10349325
663 Ga0068851_10004531
664 Ga0068851_10125784
665 Ga0068863_100003487
666 Ga0068863_100009175
667 Ga0068863_100125153
668 Ga0068858_100017583
669 Ga0068858_100448941
670 Ga0068858_101679645
671 Ga0068860_100132199
672 Ga0068860_100241808
673 Ga0068860_100792851
674 Ga0068860_101312906
675 Ga0068860_101788684
676 Ga0068862_100240818
677 Ga0070716_100547998
678 Ga0070712_100029285
679 Ga0097621_100003754
680 Ga0068871_100039095
681 Ga0068871_100165372
682 Ga0068871_101861190
683 Ga0068865_100014815
684 Ga0105240_10629134
685 Ga0111539_10846806
686 Ga0105245_10005749
687 Ga0105245_10033128
688 Ga0105245_10642931
689 Ga0105245_11105329
690 Ga0105247_10241365
691 Ga0105243_10239042
692 Ga0105241_11251097
693 Ga0105242_10016587
694 Ga0105242_11830404
695 Ga0105248_10002658
696 Ga0105248_10051378
697 Ga0105248_11528662
698 Ga0105248_12152984
699 Ga0105238_10009673
700 Ga0105238_10015503
701 Ga0105238_10025107
702 Ga0105249_10825642
703 Ga0105239_10310123
704 Ga0105239_11645185
705 Ga0105246_10004544
706 Ga0157373_10109749
707 Ga0157373_10121646
708 Ga0157373_10304068
709 Ga0157373_10394862
710 Ga0157373_10550163
711 Ga0157373_11554706
712 Ga0157371_10013415
713 Ga0157371_10037322
714 Ga0157371_10061242
715 Ga0157371_10098035
716 Ga0157371_10132648
717 Ga0157371_10196086
718 Ga0157371_10489654
719 Ga0157370_10536683
720 Ga0157369_10049778
721 Ga0157369_10484776
722 Ga0157374_10035946
723 Ga0157374_11728532
724 Ga0157378_10023762
725 Ga0157378_10097308
726 Ga0157378_10823953
727 Ga0157378_11076549
728 Ga0157378_11544511
729 Ga0163162_10053636
730 Ga0163162_10181955
731 Ga0163162_10565098
732 Ga0163162_10734439
733 Ga0157375_10003831
734 Ga0157375_10589018
735 Ga0163163_10019009
736 Ga0163163_11385304
737 Ga0157380_10005520
738 Ga0157380_10014950
739 Ga0157380_12159454
740 Ga0182008_10225474
741 Ga0157377_10096494
742 Ga0157379_11082766
743 Ga0157376_10008139
744 Ga0157376_10619876
745 Ga0182006_1049364
746 Ga0163161_10505097
747 Ga0209565_1011023
748 Ga0207673_1032552
749 Ga0209675_1001039
750 Ga0209676_1000118
751 Ga0209676_1000372
752 Ga0209758_1125750
753 Ga0209050_1000115
754 Ga0209050_1005056
755 Ga0209050_1012871
756 Ga0209257_1000445
757 Ga0209257_1001251
758 Ga0209257_1001681
759 Ga0207656_10005190
760 Ga0207656_10147063
761 Ga0207692_10288302
762 Ga0207642_10107324
763 Ga0207710_10252917
764 Ga0207688_10024322
765 Ga0207688_10388842
766 Ga0207688_10451510
767 Ga0207680_10001402
768 Ga0207680_10051721
769 Ga0207680_10290773
770 Ga0207645_10131348
771 Ga0207705_10060698
772 Ga0207705_10093269
773 Ga0207705_10645642
774 Ga0207705_11060407
775 Ga0207705_11185497
776 Ga0207654_10161836
777 Ga0207654_10928242
778 Ga0207707_10005151
779 Ga0207707_10492913
780 Ga0207693_10053189
781 Ga0207657_10003573
782 Ga0207657_10006575
783 Ga0207657_10013241
784 Ga0207657_10015543
785 Ga0207657_10027790
786 Ga0207657_10248672
787 Ga0207657_10288413
788 Ga0207649_10008713
789 Ga0207649_10021606
790 Ga0207649_10021844
791 Ga0207649_10024149
792 Ga0207649_10332694
793 Ga0207652_10353849
794 Ga0207652_10536883
795 Ga0207681_10472614
796 Ga0207694_10021141
797 Ga0207694_10087852
798 Ga0207694_10221842
799 Ga0207694_10646868
800 Ga0207694_11180665
801 Ga0207650_10073467
802 Ga0207659_10007798
803 Ga0207659_10016588
804 Ga0207687_10894246
805 Ga0207644_10000274
806 Ga0207644_10005961
807 Ga0207644_10128975
808 Ga0207644_10207927
809 Ga0207644_10698527
810 Ga0207690_10000001
811 Ga0207690_10000002
812 Ga0207690_10000003
813 Ga0207690_10000004
814 Ga0207690_10001599
815 Ga0207690_10019884
816 Ga0207690_10042210
817 Ga0207690_10094476
818 Ga0207690_10095293
819 Ga0207690_10310447
820 Ga0207690_10399077
821 Ga0207706_10002630
822 Ga0207706_10003797
823 Ga0207706_10013628
824 Ga0207706_10035916
825 Ga0207706_10185016
826 Ga0207706_10188100
827 Ga0207706_10896554
828 Ga0207686_10052676
829 Ga0207686_11364999
830 Ga0207709_10929919
831 Ga0207670_10237049
832 Ga0207669_10004579
833 Ga0207669_10121298
834 Ga0207704_10002170
835 Ga0207665_10875923
836 Ga0207691_10003446
837 Ga0207691_10003584
838 Ga0207691_10054017
839 Ga0207711_10121930
840 Ga0207711_10662623
841 Ga0207679_10003846
842 Ga0207679_10006436
843 Ga0207679_10116303
844 Ga0207679_10149364
845 Ga0207679_10288587
846 Ga0207667_12082461
847 Ga0207651_10042757
848 Ga0207651_10052334
849 Ga0207651_10460583
850 Ga0207651_10696659
851 Ga0207651_11694665
852 Ga0207640_10012258
853 Ga0207640_10198499
854 Ga0207640_10530920
855 Ga0207640_12103453
856 Ga0207658_10005211
857 Ga0207658_10037924
858 Ga0207658_10257990
859 Ga0207658_10745549
860 Ga0207677_10000061
861 Ga0207677_10105037
862 Ga0207677_10119855
863 Ga0207677_11594163
864 Ga0207703_10002986
865 Ga0207639_10031990
866 Ga0207639_11230054
867 Ga0207678_10000587
868 Ga0207678_10051314
869 Ga0207678_10106231
870 Ga0207678_11484176
871 Ga0207708_10415791
872 Ga0207641_10002978
873 Ga0207648_10002810
874 Ga0207676_10017558
875 Ga0207676_10021524
876 Ga0207676_10052069
877 Ga0207674_10427263
878 Ga0207674_10472278
879 Ga0207674_10710336
880 Ga0207674_10773813
881 Ga0207675_100898340
882 Ga0207683_10001980
883 Ga0207683_10014479
884 Ga0207683_10042104
885 Ga0207698_10039791
886 Ga0207698_10122075
887 Ga0207698_10485334
888 Ga0268266_10023826
889 Ga0268266_10075513
890 Ga0268266_10338964
891 Ga0268265_10935545
892 Ga0268264_10073176
893 Ga0268264_10116050
894 Ga0268264_10567165
895 Ga0268264_10697516
896 Ga0307408_100016927
897 Ga0307408_100124578
898 Ga0307405_10281777
899 Ga0307413_10107456
900 Ga0307413_10143694
901 Ga0307413_10325755
902 Ga0307413_10713637
903 Ga0307410_10073175
904 Ga0307410_10077641
905 Ga0307410_10108357
906 Ga0307406_10025155
907 Ga0307406_10047211
908 Ga0307406_10090194
909 Ga0307406_10241550
910 Ga0307406_10386074
911 Ga0307406_10610909
912 Ga0307406_11147086
913 Ga0307407_10031369
914 Ga0307407_10729845
915 Ga0307407_10747006
916 Ga0307412_10058377
917 Ga0307412_10116180
918 Ga0307412_10159621
919 Ga0307412_10334068
920 Ga0307412_10421974
921 Ga0307412_11473937
922 Ga0307409_100027854
923 Ga0307409_100442745
924 Ga0307409_100579765
925 Ga0307416_100041138
926 Ga0307416_100121541
927 Ga0307416_100159472
928 Ga0307416_100727443
929 Ga0307414_10051444
930 Ga0307414_10159610
931 Ga0307414_11437898
932 Ga0307411_10030755
933 Ga0307411_10119285
934 Ga0307411_10380065
935 Ga0307411_10407812
936 Ga0307415_100077141
937 Ga0307415_100152573
938 Ga0307415_100190874
939 Ga0373930_0069448
940 Ga0373928_0043131
941 Ga0373939_0222125
942 Ga0373945_0349404
943 Ga0373931_0109565
944 Ga0373931_0494181
945 Ga0395899_0074072
946 Ga0395899_0160291
947 Ga0395900_0007973
948 Ga0395900_0029097
949 Ga0395900_0030153
950 Ga0395900_0323987
951 Ga0395905_0000458
952 Ga0395905_0055532
953 Ga0395905_0464802
954 Ga0395905_0470732
955 Ga0395905_0535460
956 Ga0395905_0826087
957 Ga0395905_0949890
958 Ga0395905_1058152
959 Ga0395901_0006083
960 Ga0395901_1180913
961 Ga0439436_0200042
962 Ga0451787_215351
963 Ga0451791_0183648
964 Ga0451797_0038140
965 Ga0451807_1752761
966 Ga0451833_0408336
967 Ga0451837_1124357
968 Ga0439433_0050870
969 Ga0439437_002957
970 Ga0439448_0277220
971 Ga0439432_053978
972 Ga0439457_059288
973 Ga0439462_0023918
974 Ga0439458_0007291
975 Ga0439434_0017120
976 Ga0466969_0434967
977 Ga0466972_0131824
978 Ga0466960_0139864
979 Ga0495616_0031650
980 Ga0495616_0357539
981 Ga0495648_0010126
982 Ga0495668_0271285
983 Ga0495625_0051526
984 Ga0495686_0002000
985 Ga0496100_0000539
986 Ga0496101_0000345
987 Ga0496102_0522401
988 Ga0496103_0046723
989 Ga0496104_0124421
990 Ga0496105_0098582
991 Ga0496107_0000744
992 Ga0496107_0215234
993 Ga0496108_0003683
994 Ga0496108_0007034
995 Ga0496108_0105915
996 Ga0496109_0005615
997 Ga0496109_0094687
998 Ga0496110_0014915
999 Ga0496110_0213772
1000 Ga0496110_0967569
1001 Ga0496111_0000536
1002 Ga0496111_0027369
1003 Ga0496111_0155455
1004 Ga0496112_0001133
1005 Ga0496112_0020281
1006 Ga0496113_0000703
1007 Ga0496113_0315629
1008 Ga0496125_0378497
1009 Ga0501032_0011940
1010 Ga0501033_0014513
1011 Ga0501033_0135646
1012 Ga0501034_0086865
1013 Ga0501036_0056886
1014 Ga0501037_0024847
1015 Ga0501037_0063643
1016 Ga0501038_0088592
1017 Ga0501039_0029447
1018 Ga0501043_0068970
1019 Ga0501047_0052254
1020 Ga0501047_0255576
1021 Ga0501070_0096200
1022 Ga0501207_015996
1023 Ga0501209_056717
1024 Ga0501217_052045
1025 Ga0501223_093321
1026 Ga0501233_077794
1027 Ga0501225_0102543
1028 Ga0501262_033243
1029 Ga0501270_006402
1030 Ga0501272_051288
1031 Ga0501035_0008030
1032 Ga0501035_0091510
1033 Ga0501044_0008443
1034 Ga0501044_0015747
1035 Ga0501044_0795218
1036 Ga0501212_048508
1037 Ga0500644_0146363
1038 Ga0500592_004258
1039 Ga0500658_0314242
1040 Ga0500568_0003124
1041 2538834671
1042 2643829804
1043 2643833969
1044 2644054895
1045 2852654577
1046 2852684078

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08883

DOPA_dioxygen

Dopa 4,5-dioxygenase family

18

123

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.917 5 111
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.8874 5 113
2peb-assembly1.cif.gz_B crystal structure of a putative dioxygenase (npun_f1925) from nostoc punctiforme pcc 73102 at 1.46 a resolution 0.819 5 111
2p8i-assembly1.cif.gz_A crystal structure of putative dioxygenase (yp_555069.1) from burkholderia xenovorans lb400 at 1.40 a resolution 0.8108 5 113
4pcq-assembly1.cif.gz_B crystal structure of mtbaldr (rv2779c) 0.6784 2 87
ID Description Score Start End Superfamily
2pebB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.9214 5 111 3.30.70.1240
2p8iA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.8784 5 113 3.30.70.1240
af_Q59TT2_5_125_3.30.70.1240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.8665 3 112 3.30.70.1240
af_A0A1D8PEW7_24_150_3.30.70.1240 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.8629 5 115 3.30.70.1240
2pebB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;DOPA-like domains 0.8215 5 111 3.30.70.1240
ID Description Score Start End GO Terms
AF-A0A7C4ZMZ5-F1-model_v4 Aromatic ring-opening dioxygenase 0.938 1 129 GO:0051213
AF-Q1GVI7-F1-model_v4 Aromatic ring-cleaving dioxygenase-like protein 0.9335 1 129 GO:0051213
AF-A0A7C4ZMZ5-F1-model_v4 Aromatic ring-opening dioxygenase 0.931 1 129 GO:0051213
AF-A0A2E6RLZ1-F1-model_v4 4,5-dioxygenase 0.9223 6 113
AF-K9PD49-F1-model_v4 Dopa 45-dioxygenase 0.922 5 111 GO:0051213

Map