F458936

General Info

Members Datasets Scaffolds Average Seq Length
523 201 1046 122

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_101745112|Ga0068869_1017451121
Length 125
Sequence MTMSKNCLVVDDSRVLRTVARRIFEELQFQVAEAEDGMSALRACHEKMPDIILFDGNLPSMKGVEFLRSVRGQQGGDRPVILVCTTESDATEITNVINAGANEYLLKPFDRGSLRAKLSEIGVRL

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
102 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
156 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
157 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
158 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
159 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
172 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
173 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
177 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.57
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 26.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_101745112 3300005334 Unclassified 556
2 MRS1b_contig_4074188 2162886011 Bacteria 835
3 JGI24746J21847_1004807 3300001977 Bacteria 2120
4 Ga0065704_10419098 3300005289 Unclassified 734
5 Ga0065712_10009058 3300005290 Bacteria 2780
6 Ga0065712_10010673 3300005290 Unclassified 3442
7 Ga0065712_10153998 3300005290 Bacteria 1348
8 Ga0065715_10098234 3300005293 Bacteria 3576
9 Ga0065715_10108307 3300005293 Bacteria 2726
10 Ga0065715_10195364 3300005293 Unclassified 1390
11 Ga0065715_10374991 3300005293 Bacteria 905
12 Ga0065707_10001477 3300005295 Bacteria 9224
13 Ga0065707_10112335 3300005295 Unclassified 2364
14 Ga0065707_10408157 3300005295 Bacteria 844
15 Ga0070658_10764198 3300005327 Bacteria 839
16 Ga0070658_11074424 3300005327 Bacteria 700
17 Ga0070676_10012106 3300005328 Bacteria 4703
18 Ga0070676_10014923 3300005328 Bacteria 4275
19 Ga0070676_10092650 3300005328 Bacteria 1854
20 Ga0070676_10364711 3300005328 Bacteria 996
21 Ga0070690_100025457 3300005330 Unclassified 3645
22 Ga0070690_100096865 3300005330 Unclassified 1950
23 Ga0070690_100131940 3300005330 Bacteria 1688
24 Ga0070690_101318187 3300005330 Bacteria 579
25 Ga0070670_100125526 3300005331 Bacteria 2215
26 Ga0070670_100240869 3300005331 Bacteria 1575
27 Ga0070670_100652607 3300005331 Unclassified 944
28 Ga0070670_101571842 3300005331 Unclassified 604
29 Ga0070677_10003130 3300005333 Bacteria 5321
30 Ga0070677_10003564 3300005333 Bacteria 5023
31 Ga0068869_100022515 3300005334 Bacteria 4343
32 Ga0068869_100025240 3300005334 Bacteria 4125
33 Ga0068869_100036403 3300005334 Bacteria 3494
34 Ga0068869_100179941 3300005334 Unclassified 1657
35 Ga0068869_101884108 3300005334 Bacteria 536
36 Ga0070666_10130576 3300005335 Bacteria 1745
37 Ga0070680_100359512 3300005336 Unclassified 1238
38 Ga0070682_101896458 3300005337 Bacteria 522
39 Ga0068868_100114153 3300005338 Bacteria 2197
40 Ga0068868_100288802 3300005338 Unclassified 1390
41 Ga0068868_100356400 3300005338 Bacteria 1254
42 Ga0068868_101030033 3300005338 Unclassified 754
43 Ga0070660_100226011 3300005339 Bacteria 1522
44 Ga0070689_100005544 3300005340 Bacteria 8631
45 Ga0070689_100148978 3300005340 Unclassified 1886
46 Ga0070689_100314537 3300005340 Bacteria 1306
47 Ga0070689_102031977 3300005340 Bacteria 526
48 Ga0070687_100002304 3300005343 Bacteria 7097
49 Ga0070687_100023299 3300005343 Bacteria 2941
50 Ga0070687_101096635 3300005343 Unclassified 582
51 Ga0070661_100017441 3300005344 Bacteria 5094
52 Ga0070661_101016076 3300005344 Bacteria 688
53 Ga0070692_10066748 3300005345 Bacteria 1908
54 Ga0070692_10301780 3300005345 Unclassified 978
55 Ga0070692_10665374 3300005345 Unclassified 697
56 Ga0070668_100116591 3300005347 Unclassified 2130
57 Ga0070668_100440869 3300005347 Bacteria 1118
58 Ga0070668_101359768 3300005347 Unclassified 647
59 Ga0070669_100000771 3300005353 Bacteria 23293
60 Ga0070669_100002356 3300005353 Bacteria 13655
61 Ga0070669_100024082 3300005353 Bacteria 4363
62 Ga0070669_100078211 3300005353 Bacteria 2458
63 Ga0070669_100094205 3300005353 Bacteria 2250
64 Ga0070675_100018217 3300005354 Bacteria 5589
65 Ga0070675_100037750 3300005354 Unclassified 3937
66 Ga0070675_100039211 3300005354 Bacteria 3864
67 Ga0070675_100064972 3300005354 Bacteria 3016
68 Ga0070675_100238635 3300005354 Unclassified 1588
69 Ga0070675_101194699 3300005354 Bacteria 700
70 Ga0070671_100086476 3300005355 Bacteria 2623
71 Ga0070671_100209820 3300005355 Bacteria 1652
72 Ga0070674_100001555 3300005356 Bacteria 12298
73 Ga0070674_100010107 3300005356 Bacteria 5686
74 Ga0070674_100142102 3300005356 Bacteria 1802
75 Ga0070674_100809531 3300005356 Unclassified 810
76 Ga0070674_102144935 3300005356 Unclassified 510
77 Ga0070673_100014001 3300005364 Bacteria 5570
78 Ga0070673_100036316 3300005364 Bacteria 3744
79 Ga0070673_100037983 3300005364 Bacteria 3674
80 Ga0070673_102099581 3300005364 Unclassified 537
81 Ga0070688_100075359 3300005365 Bacteria 2168
82 Ga0070688_100252147 3300005365 Bacteria 1257
83 Ga0070659_100036337 3300005366 Bacteria 3840
84 Ga0070659_100105266 3300005366 Bacteria 2273
85 Ga0070659_100249044 3300005366 Bacteria 1472
86 Ga0070659_101508190 3300005366 Bacteria 599
87 Ga0070667_100035393 3300005367 Bacteria 4182
88 Ga0070667_100053291 3300005367 Bacteria 3414
89 Ga0070667_100819625 3300005367 Unclassified 864
90 Ga0070701_10018502 3300005438 Bacteria 3276
91 Ga0070701_10047222 3300005438 Unclassified 2217
92 Ga0070701_10093776 3300005438 Bacteria 1650
93 Ga0070705_100000931 3300005440 Bacteria 16395
94 Ga0070705_100007664 3300005440 Bacteria 5324
95 Ga0070705_100146840 3300005440 Unclassified 1559
96 Ga0070705_100478563 3300005440 Unclassified 940
97 Ga0070700_100006944 3300005441 Bacteria 6080
98 Ga0070700_100057547 3300005441 Bacteria 2440
99 Ga0070700_100626341 3300005441 Bacteria 846
100 Ga0070694_100001049 3300005444 Bacteria 15779
101 Ga0070694_100048743 3300005444 Bacteria 2850
102 Ga0070694_100291649 3300005444 Bacteria 1247
103 Ga0070694_100689391 3300005444 Bacteria 830
104 Ga0070663_100220584 3300005455 Unclassified 1488
105 Ga0070678_100030372 3300005456 Bacteria 3714
106 Ga0070678_100087667 3300005456 Bacteria 2377
107 Ga0070678_100101427 3300005456 Unclassified 2231
108 Ga0070678_100211599 3300005456 Unclassified 1607
109 Ga0070678_100925156 3300005456 Bacteria 798
110 Ga0070678_101154566 3300005456 Unclassified 717
111 Ga0070678_101505215 3300005456 Bacteria 630
112 Ga0070662_100004368 3300005457 Bacteria 8935
113 Ga0070662_100041257 3300005457 Bacteria 3291
114 Ga0070662_100162621 3300005457 Unclassified 1747
115 Ga0070681_10895386 3300005458 Bacteria 806
116 Ga0068867_100007614 3300005459 Bacteria 7660
117 Ga0068867_100020091 3300005459 Bacteria 4759
118 Ga0068867_100102085 3300005459 Bacteria 2192
119 Ga0068867_100167585 3300005459 Unclassified 1737
120 Ga0068867_100284444 3300005459 Bacteria 1357
121 Ga0068867_100406536 3300005459 Bacteria 1150
122 Ga0068867_100638031 3300005459 Bacteria 933
123 Ga0070685_10112928 3300005466 Bacteria 1676
124 Ga0070685_10380477 3300005466 Unclassified 972
125 Ga0070698_100148646 3300005471 Unclassified 2291
126 Ga0070699_100550080 3300005518 Unclassified 1050
127 Ga0070679_100200261 3300005530 Bacteria 1963
128 Ga0070684_100218634 3300005535 Bacteria 1738
129 Ga0068853_100711724 3300005539 Unclassified 958
130 Ga0070672_100027177 3300005543 Unclassified 4266
131 Ga0070672_100271820 3300005543 Bacteria 1431
132 Ga0070672_100299783 3300005543 Unclassified 1362
133 Ga0070672_100763411 3300005543 Bacteria 849
134 Ga0070686_100018545 3300005544 Bacteria 4087
135 Ga0070686_100028113 3300005544 Bacteria 3408
136 Ga0070695_100002594 3300005545 Bacteria 10435
137 Ga0070695_100618742 3300005545 Bacteria 852
138 Ga0070695_101426951 3300005545 Bacteria 575
139 Ga0070696_100002040 3300005546 Bacteria 13249
140 Ga0070696_100022639 3300005546 Bacteria 4271
141 Ga0070696_100036013 3300005546 Bacteria 3410
142 Ga0070665_100356532 3300005548 Bacteria 1468
143 Ga0070665_100817682 3300005548 Bacteria 945
144 Ga0070704_100035015 3300005549 Unclassified 3410
145 Ga0070704_100090558 3300005549 Bacteria 2278
146 Ga0070704_100197055 3300005549 Bacteria 1623
147 Ga0070704_101532612 3300005549 Bacteria 613
148 Ga0070664_100000927 3300005564 Bacteria 22924
149 Ga0070664_100118305 3300005564 Bacteria 2318
150 Ga0070664_100147139 3300005564 Bacteria 2078
151 Ga0070664_100527102 3300005564 Bacteria 1091
152 Ga0068857_100017545 3300005577 Bacteria 6275
153 Ga0068857_100252585 3300005577 Bacteria 1617
154 Ga0068857_100452891 3300005577 Bacteria 1200
155 Ga0068857_100630559 3300005577 Bacteria 1015
156 Ga0068854_100268497 3300005578 Bacteria 1369
157 Ga0068854_101764774 3300005578 Archaea 567
158 Ga0068854_101902486 3300005578 Bacteria 547
159 Ga0068856_102167044 3300005614 Unclassified 565
160 Ga0070702_100015296 3300005615 Bacteria 3916
161 Ga0070702_101564667 3300005615 Unclassified 544
162 Ga0068852_100261415 3300005616 Bacteria 1662
163 Ga0068852_102371293 3300005616 Bacteria 551
164 Ga0068852_102538699 3300005616 Bacteria 532
165 Ga0068859_100002122 3300005617 Bacteria 20181
166 Ga0068859_100012255 3300005617 Bacteria 8624
167 Ga0068859_100330368 3300005617 Bacteria 1619
168 Ga0068859_102065184 3300005617 Bacteria 629
169 Ga0068864_100015198 3300005618 Bacteria 6402
170 Ga0068864_100015789 3300005618 Bacteria 6283
171 Ga0068864_100334168 3300005618 Unclassified 1426
172 Ga0068866_10178688 3300005718 Bacteria 1252
173 Ga0068861_100012212 3300005719 Bacteria 5988
174 Ga0068861_100042722 3300005719 Bacteria 3398
175 Ga0068861_100330932 3300005719 Bacteria 1330
176 Ga0068861_100392315 3300005719 Unclassified 1230
177 Ga0068870_10004292 3300005840 Bacteria 6134
178 Ga0068870_10016881 3300005840 Unclassified 3500
179 Ga0068863_100546508 3300005841 Unclassified 1143
180 Ga0068863_100608567 3300005841 Bacteria 1082
181 Ga0068863_102047910 3300005841 Unclassified 582
182 Ga0068858_100087354 3300005842 Unclassified 2900
183 Ga0068860_100112285 3300005843 Unclassified 2606
184 Ga0068860_100893135 3300005843 Unclassified 904
185 Ga0068862_100010160 3300005844 Bacteria 7766
186 Ga0068862_100015379 3300005844 Bacteria 6357
187 Ga0068862_100020009 3300005844 Bacteria 5587
188 Ga0068862_100113104 3300005844 Bacteria 2385
189 Ga0068862_100319059 3300005844 Unclassified 1434
190 Ga0068862_100410236 3300005844 Bacteria 1269
191 Ga0068862_101168302 3300005844 Unclassified 767
192 Ga0097621_100070669 3300006237 Bacteria 2883
193 Ga0097621_100122759 3300006237 Bacteria 2205
194 Ga0068871_100071004 3300006358 Unclassified 2863
195 Ga0068871_100327099 3300006358 Unclassified 1351
196 Ga0075428_100072070 3300006844 Bacteria 3775
197 Ga0075428_100202946 3300006844 Unclassified 2143
198 Ga0075428_100213011 3300006844 Bacteria 2088
199 Ga0075428_100390830 3300006844 Bacteria 1491
200 Ga0075428_100605671 3300006844 Bacteria 1170
201 Ga0075428_100720427 3300006844 Unclassified 1062
202 Ga0075430_100002996 3300006846 Bacteria 14135
203 Ga0075430_100003373 3300006846 Bacteria 13371
204 Ga0075430_100034213 3300006846 Bacteria 4313
205 Ga0075430_101460499 3300006846 Unclassified 562
206 Ga0075431_100002691 3300006847 Bacteria 17223
207 Ga0075431_100008155 3300006847 Bacteria 10468
208 Ga0075431_100041430 3300006847 Bacteria 4748
209 Ga0075431_100079491 3300006847 Bacteria 3385
210 Ga0075431_100084691 3300006847 Bacteria 3273
211 Ga0075431_100445987 3300006847 Bacteria 1290
212 Ga0075431_100759086 3300006847 Bacteria 945
213 Ga0075433_10010801 3300006852 Bacteria 7343
214 Ga0075433_10100436 3300006852 Unclassified 2562
215 Ga0075433_11147549 3300006852 Unclassified 675
216 Ga0075434_100017640 3300006871 Bacteria 6881
217 Ga0075434_100044996 3300006871 Bacteria 4379
218 Ga0075434_100064091 3300006871 Bacteria 3659
219 Ga0075429_100013146 3300006880 Bacteria 7182
220 Ga0075429_100023375 3300006880 Bacteria 5364
221 Ga0075429_100036651 3300006880 Bacteria 4267
222 Ga0075429_100103012 3300006880 Bacteria 2492
223 Ga0075429_100307529 3300006880 Bacteria 1388
224 Ga0075429_100444960 3300006880 Unclassified 1135
225 Ga0068865_100021472 3300006881 Bacteria 4198
226 Ga0068865_100053852 3300006881 Unclassified 2793
227 Ga0068865_102138461 3300006881 Unclassified 509
228 Ga0097620_100002122 3300006931 Bacteria 20181
229 Ga0097620_100012255 3300006931 Bacteria 8624
230 Ga0097620_100330374 3300006931 Bacteria 1619
231 Ga0097620_102065648 3300006931 Bacteria 629
232 Ga0111539_10006423 3300009094 Bacteria 15158
233 Ga0111539_10015636 3300009094 Bacteria 9435
234 Ga0111539_10093309 3300009094 Bacteria 3536
235 Ga0111539_10139283 3300009094 Bacteria 2841
236 Ga0111539_10225730 3300009094 Bacteria 2181
237 Ga0111539_10290849 3300009094 Unclassified 1901
238 Ga0111539_10405524 3300009094 Unclassified 1588
239 Ga0105247_10464952 3300009101 Bacteria 915
240 Ga0114129_10047926 3300009147 Bacteria 6003
241 Ga0114129_10068116 3300009147 Unclassified 4963
242 Ga0114129_10189518 3300009147 Bacteria 2794
243 Ga0105243_10020504 3300009148 Bacteria 5011
244 Ga0105243_10291761 3300009148 Bacteria 1474
245 Ga0105243_10458019 3300009148 Bacteria 1198
246 Ga0105243_10644991 3300009148 Unclassified 1025
247 Ga0105242_10029485 3300009176 Bacteria 4377
248 Ga0105242_10238774 3300009176 Bacteria 1633
249 Ga0105242_10922602 3300009176 Bacteria 875
250 Ga0105249_10002617 3300009553 Bacteria 15593
251 Ga0105249_10014235 3300009553 Bacteria 7033
252 Ga0105249_10192949 3300009553 Bacteria 1989
253 Ga0105246_10013480 3300011119 Bacteria 5127
254 Ga0105246_10311187 3300011119 Bacteria 1276
255 Ga0105246_10625197 3300011119 Unclassified 934
256 Ga0157342_1022757 3300012507 Unclassified 739
257 Ga0157371_10059263 3300013102 Bacteria 2714
258 Ga0157370_10017940 3300013104 Bacteria 7127
259 Ga0157369_10387174 3300013105 Bacteria 1451
260 Ga0157374_10592761 3300013296 Unclassified 1118
261 Ga0157378_10218146 3300013297 Bacteria 1812
262 Ga0157378_11774672 3300013297 Unclassified 665
263 Ga0163162_10016744 3300013306 Bacteria 7165
264 Ga0163162_10683564 3300013306 Unclassified 1149
265 Ga0163162_10781052 3300013306 Bacteria 1073
266 Ga0163162_12140286 3300013306 Unclassified 642
267 Ga0157372_10802922 3300013307 Bacteria 1093
268 Ga0157375_10001047 3300013308 Bacteria 23871
269 Ga0157375_10020925 3300013308 Bacteria 5987
270 Ga0157375_11611815 3300013308 Bacteria 767
271 Ga0157375_12380091 3300013308 Bacteria 632
272 Ga0163163_10076371 3300014325 Bacteria 3344
273 Ga0163163_10639988 3300014325 Unclassified 1127
274 Ga0157380_10014457 3300014326 Bacteria 5774
275 Ga0157380_10022089 3300014326 Bacteria 4783
276 Ga0157380_10038544 3300014326 Bacteria 3711
277 Ga0157380_10675369 3300014326 Unclassified 1034
278 Ga0157377_10033450 3300014745 Bacteria 2807
279 Ga0157377_10097023 3300014745 Bacteria 1750
280 Ga0157377_11159876 3300014745 Unclassified 596
281 Ga0157379_10045068 3300014968 Bacteria 3937
282 Ga0157376_10190360 3300014969 Bacteria 1881
283 Ga0157376_10267083 3300014969 Unclassified 1605
284 Ga0157376_11412686 3300014969 Bacteria 728
285 Ga0157376_12296287 3300014969 Unclassified 579
286 Ga0163161_10230071 3300017792 Bacteria 1438
287 Ga0163161_10311904 3300017792 Bacteria 1241
288 Ga0163161_10933819 3300017792 Bacteria 737
289 Ga0213876_10021477 3300021384 Unclassified 3413
290 Ga0207666_1030336 3300025271 Unclassified 827
291 Ga0207673_1038585 3300025290 Bacteria 669
292 Ga0207697_10003458 3300025315 Bacteria 7800
293 Ga0207697_10029941 3300025315 Bacteria 2228
294 Ga0207697_10054458 3300025315 Bacteria 1657
295 Ga0207682_10000967 3300025893 Bacteria 13301
296 Ga0207682_10006193 3300025893 Bacteria 4834
297 Ga0207682_10098107 3300025893 Bacteria 1278
298 Ga0207642_10030154 3300025899 Bacteria 2256
299 Ga0207688_10003039 3300025901 Bacteria 9144
300 Ga0207688_10026236 3300025901 Unclassified 3202
301 Ga0207680_10039075 3300025903 Unclassified 2751
302 Ga0207680_10145477 3300025903 Unclassified 1575
303 Ga0207680_10341887 3300025903 Unclassified 1050
304 Ga0207645_10005932 3300025907 Bacteria 8800
305 Ga0207645_10006164 3300025907 Bacteria 8609
306 Ga0207645_10059774 3300025907 Bacteria 2434
307 Ga0207645_10092652 3300025907 Bacteria 1944
308 Ga0207645_10182277 3300025907 Bacteria 1378
309 Ga0207643_10000265 3300025908 Bacteria 36501
310 Ga0207643_10014427 3300025908 Unclassified 4292
311 Ga0207643_10034648 3300025908 Unclassified 2829
312 Ga0207705_11109754 3300025909 Bacteria 609
313 Ga0207660_10446015 3300025917 Bacteria 1046
314 Ga0207660_10628545 3300025917 Bacteria 875
315 Ga0207662_10005915 3300025918 Bacteria 6566
316 Ga0207662_10008840 3300025918 Bacteria 5525
317 Ga0207657_10219830 3300025919 Bacteria 1522
318 Ga0207649_11583832 3300025920 Unclassified 518
319 Ga0207652_10157917 3300025921 Bacteria 2032
320 Ga0207681_10007566 3300025923 Bacteria 6656
321 Ga0207681_10021744 3300025923 Bacteria 4082
322 Ga0207681_10035449 3300025923 Bacteria 3288
323 Ga0207681_10298684 3300025923 Bacteria 1273
324 Ga0207681_10567675 3300025923 Bacteria 935
325 Ga0207681_11152790 3300025923 Bacteria 651
326 Ga0207650_10223089 3300025925 Bacteria 1517
327 Ga0207650_10244944 3300025925 Bacteria 1449
328 Ga0207650_10449435 3300025925 Bacteria 1072
329 Ga0207659_10036343 3300025926 Bacteria 3411
330 Ga0207659_10043033 3300025926 Bacteria 3169
331 Ga0207659_10137236 3300025926 Bacteria 1894
332 Ga0207659_10216107 3300025926 Unclassified 1539
333 Ga0207659_10453336 3300025926 Bacteria 1080
334 Ga0207659_11003457 3300025926 Bacteria 718
335 Ga0207659_11657351 3300025926 Bacteria 545
336 Ga0207687_10429735 3300025927 Bacteria 1091
337 Ga0207644_10083238 3300025931 Unclassified 2369
338 Ga0207644_10196100 3300025931 Unclassified 1590
339 Ga0207644_11300137 3300025931 Unclassified 611
340 Ga0207690_10033108 3300025932 Bacteria 3321
341 Ga0207690_10079300 3300025932 Bacteria 2288
342 Ga0207690_10354066 3300025932 Bacteria 1162
343 Ga0207706_10012917 3300025933 Bacteria 7600
344 Ga0207706_10034946 3300025933 Bacteria 4471
345 Ga0207706_10061144 3300025933 Unclassified 3317
346 Ga0207686_10021512 3300025934 Bacteria 3703
347 Ga0207709_10062105 3300025935 Bacteria 2337
348 Ga0207709_10166680 3300025935 Unclassified 1542
349 Ga0207709_10207266 3300025935 Bacteria 1404
350 Ga0207709_11330284 3300025935 Unclassified 594
351 Ga0207670_10053453 3300025936 Bacteria 2721
352 Ga0207670_10074512 3300025936 Unclassified 2357
353 Ga0207669_10001490 3300025937 Bacteria 9994
354 Ga0207669_10262567 3300025937 Bacteria 1292
355 Ga0207669_10542417 3300025937 Bacteria 937
356 Ga0207669_11294099 3300025937 Unclassified 619
357 Ga0207704_10126057 3300025938 Unclassified 1763
358 Ga0207704_10162187 3300025938 Bacteria 1592
359 Ga0207704_11261834 3300025938 Unclassified 631
360 Ga0207704_11746617 3300025938 Bacteria 535
361 Ga0207665_10972296 3300025939 Bacteria 675
362 Ga0207691_10003545 3300025940 Bacteria 15177
363 Ga0207691_10021809 3300025940 Bacteria 6046
364 Ga0207691_10628874 3300025940 Bacteria 908
365 Ga0207689_10001787 3300025942 Bacteria 20324
366 Ga0207689_10029924 3300025942 Bacteria 4541
367 Ga0207689_10053941 3300025942 Unclassified 3311
368 Ga0207689_10104536 3300025942 Bacteria 2327
369 Ga0207689_10149736 3300025942 Bacteria 1924
370 Ga0207661_10063654 3300025944 Bacteria 2988
371 Ga0207679_10001147 3300025945 Bacteria 16879
372 Ga0207679_10455050 3300025945 Bacteria 1136
373 Ga0207679_10654531 3300025945 Bacteria 950
374 Ga0207679_10993132 3300025945 Unclassified 769
375 Ga0207651_10040556 3300025960 Bacteria 3081
376 Ga0207651_10056871 3300025960 Bacteria 2695
377 Ga0207651_10145651 3300025960 Bacteria 1836
378 Ga0207651_10167367 3300025960 Bacteria 1730
379 Ga0207712_10075125 3300025961 Bacteria 2442
380 Ga0207712_10552478 3300025961 Unclassified 991
381 Ga0207712_10995773 3300025961 Unclassified 744
382 Ga0207668_10137295 3300025972 Unclassified 1875
383 Ga0207668_10335525 3300025972 Unclassified 1259
384 Ga0207640_10009405 3300025981 Bacteria 5472
385 Ga0207658_10211432 3300025986 Bacteria 1626
386 Ga0207677_10273056 3300026023 Unclassified 1384
387 Ga0207677_10288821 3300026023 Bacteria 1350
388 Ga0207677_10992711 3300026023 Unclassified 761
389 Ga0207703_11583411 3300026035 Bacteria 630
390 Ga0207639_10664550 3300026041 Unclassified 965
391 Ga0207639_11435309 3300026041 Bacteria 648
392 Ga0207678_10154208 3300026067 Bacteria 1961
393 Ga0207678_11447420 3300026067 Bacteria 607
394 Ga0207708_10001721 3300026075 Bacteria 16183
395 Ga0207708_10064289 3300026075 Unclassified 2802
396 Ga0207708_10094453 3300026075 Bacteria 2308
397 Ga0207702_10532401 3300026078 Unclassified 1148
398 Ga0207641_10007746 3300026088 Bacteria 8926
399 Ga0207641_10930176 3300026088 Unclassified 864
400 Ga0207648_10000784 3300026089 Bacteria 35793
401 Ga0207648_10030677 3300026089 Bacteria 4758
402 Ga0207648_10041555 3300026089 Unclassified 4037
403 Ga0207648_10108638 3300026089 Bacteria 2435
404 Ga0207648_10131975 3300026089 Bacteria 2199
405 Ga0207648_10213334 3300026089 Bacteria 1714
406 Ga0207648_10305206 3300026089 Bacteria 1428
407 Ga0207648_11761248 3300026089 Bacteria 581
408 Ga0207676_10012739 3300026095 Bacteria 6033
409 Ga0207676_10094102 3300026095 Bacteria 2468
410 Ga0207676_10122616 3300026095 Bacteria 2195
411 Ga0207674_10015435 3300026116 Bacteria 8392
412 Ga0207674_10078464 3300026116 Bacteria 3307
413 Ga0207674_10333239 3300026116 Bacteria 1467
414 Ga0207674_10393101 3300026116 Bacteria 1340
415 Ga0207675_100000123 3300026118 Bacteria 63809
416 Ga0207675_100006998 3300026118 Bacteria 10669
417 Ga0207675_100007846 3300026118 Bacteria 10071
418 Ga0207675_100092129 3300026118 Bacteria 2850
419 Ga0207675_100473944 3300026118 Bacteria 1243
420 Ga0207675_100492890 3300026118 Bacteria 1219
421 Ga0207675_100681214 3300026118 Bacteria 1036
422 Ga0207683_10014361 3300026121 Bacteria 6746
423 Ga0207683_10018300 3300026121 Bacteria 5977
424 Ga0207683_10475646 3300026121 Bacteria 1153
425 Ga0207683_10701454 3300026121 Bacteria 938
426 Ga0207698_10176194 3300026142 Unclassified 1889
427 Ga0207698_10658061 3300026142 Unclassified 1038
428 Ga0210002_1027323 3300027617 Bacteria 939
429 Ga0207428_10012409 3300027907 Bacteria 7488
430 Ga0207428_10054780 3300027907 Bacteria 3175
431 Ga0207428_10397287 3300027907 Unclassified 1010
432 Ga0207428_10399781 3300027907 Bacteria 1006
433 Ga0207428_10538889 3300027907 Bacteria 845
434 Ga0268266_11180110 3300028379 Bacteria 740
435 Ga0268265_10000593 3300028380 Bacteria 36472
436 Ga0268265_10009710 3300028380 Bacteria 6496
437 Ga0268265_10020890 3300028380 Bacteria 4576
438 Ga0268265_10057613 3300028380 Bacteria 2962
439 Ga0268265_10568011 3300028380 Bacteria 1079
440 Ga0268265_10843710 3300028380 Bacteria 896
441 Ga0268264_11481010 3300028381 Unclassified 689
442 Ga0265330_10167380 3300031235 Unclassified 932
443 Ga0265325_10003338 3300031241 Bacteria 10544
444 Ga0265339_10019981 3300031249 Bacteria 3920
445 Ga0265331_10050114 3300031250 Bacteria 2003
446 Ga0265316_10073790 3300031344 Bacteria 2627
447 Ga0265313_10009901 3300031595 Bacteria 6124
448 Ga0265314_10063729 3300031711 Bacteria 2499
449 Ga0265342_10030383 3300031712 Bacteria 3348
450 Ga0307410_10761438 3300031852 Bacteria 821
451 Ga0307406_10683898 3300031901 Bacteria 855
452 Ga0307407_10103987 3300031903 Unclassified 1769
453 Ga0307416_100960548 3300032002 Unclassified 957
454 Ga0307416_102872467 3300032002 Bacteria 576
455 Ga0373942_0277807 3300035207 Bacteria 576
456 Ga0373961_0146126 3300035241 Unclassified 802
457 Ga0373931_0194944 3300035691 Unclassified 1207
458 Ga0436365_0669497 3300039437 Bacteria 7257
459 Ga0439441_106199 3300042001 Unclassified 633
460 Ga0439459_0138949 3300042438 Bacteria 626
461 Ga0466972_0158357 3300044658 Unclassified 1064
462 Ga0466957_0716975 3300044842 Unclassified 707
463 Ga0451576_0085334 3300045051 Bacteria 3284
464 Ga0451576_0258249 3300045051 Bacteria 1821
465 Ga0466967_0293104 3300045976 Bacteria 1564
466 Ga0495591_106510 3300046458 Unclassified 691
467 Ga0495580_0439673 3300046472 Unclassified 876
468 Ga0495656_0101464 3300046615 Bacteria 1331
469 Ga0495635_0958671 3300046663 Bacteria 546
470 Ga0495670_0193155 3300046691 Bacteria 1077
471 Ga0495636_0648307 3300047318 Unclassified 519
472 Ga0496109_0770549 3300048912 Bacteria 900
473 Ga0496113_1214668 3300048916 Bacteria 588
474 Ga0496114_1386172 3300048917 Bacteria 590
475 Ga0501033_0016240 3300049570 Bacteria 5639
476 Ga0501033_0079119 3300049570 Bacteria 2412
477 Ga0501037_0013315 3300049573 Bacteria 6062
478 Ga0501042_0638515 3300049578 Unclassified 774
479 Ga0501043_0320523 3300049579 Bacteria 1182
480 Ga0501047_0028760 3300049581 Bacteria 5360
481 Ga0501047_0396237 3300049581 Unclassified 1214
482 Ga0501083_0171822 3300049744 Bacteria 1416
483 Ga0501035_1302330 3300049822 Bacteria 560
484 Ga0501044_0007087 3300049823 Bacteria 12338
485 Ga0501044_0447888 3300049823 Bacteria 1198
486 Ga0501044_0563524 3300049823 Bacteria 1035
487 nmdc:mga05p37_103029_c1 3300050507 Unclassified 3514
488 nmdc:mga05p37_119330_c1 3300050507 Bacteria 3240
489 nmdc:mga05p37_182096_c1 3300050507 Unclassified 2555
490 nmdc:mga05p37_95119_c1 3300050507 Unclassified 3670
491 nmdc:mga09592_121109_c1 3300050508 Unclassified 2248
492 nmdc:mga09592_191723_c1 3300050508 Bacteria 1769
493 nmdc:mga09592_262363_c1 3300050508 Bacteria 1498
494 nmdc:mga09592_27412_c1 3300050508 Bacteria 4727
495 nmdc:mga09592_373211_c1 3300050508 Bacteria 1234
496 nmdc:mga09592_635257_c1 3300050508 Unclassified 912
497 nmdc:mga0qj67_1106_c1 3300050509 Bacteria 18695
498 nmdc:mga0qj67_2977_c1 3300050509 Bacteria 12158
499 nmdc:mga0qj67_32645_c1 3300050509 Unclassified 4061
500 nmdc:mga0qj67_44405_c1 3300050509 Bacteria 3502
501 nmdc:mga0qj67_570594_c1 3300050509 Unclassified 907
502 nmdc:mga0qj67_682089_c1 3300050509 Bacteria 818
503 nmdc:mga06r32_12751_c1 3300050510 Bacteria 7599
504 nmdc:mga06r32_5229_c1 3300050510 Bacteria 11668
505 nmdc:mga06r32_543137_c1 3300050510 Unclassified 1137
506 nmdc:mga06r32_690_c1 3300050510 Bacteria 29444
507 nmdc:mga06r32_72707_c1 3300050510 Bacteria 3329
508 nmdc:mga06r32_74061_c1 3300050510 Bacteria 3300
509 nmdc:mga06r32_943600_c1 3300050510 Unclassified 817
510 nmdc:mga08y16_2099618_c1 3300050511 Unclassified 513
511 nmdc:mga08y16_21757_c1 3300050511 Bacteria 6768
512 nmdc:mga08y16_388852_c1 3300050511 Unclassified 1429
513 nmdc:mga08y16_41335_c1 3300050511 Bacteria 4830
514 nmdc:mga08y16_494832_c1 3300050511 Bacteria 1243
515 nmdc:mga08y16_593431_c1 3300050511 Bacteria 1117
516 nmdc:mga08y16_602933_c1 3300050511 Bacteria 1107
517 nmdc:mga08y16_92757_c1 3300050511 Bacteria 3146
518 nmdc:mga08y16_955590_c1 3300050511 Bacteria 840
519 nmdc:mga0n895_16809_c1 3300050512 Bacteria 6724
520 nmdc:mga0n895_187961_c1 3300050512 Bacteria 2097
521 nmdc:mga0a205_199074_c1 3300050515 Bacteria 1894
522 nmdc:mga0a205_2694_c1 3300050515 Bacteria 15697
523 Ga0590075_073149 3300059424 Bacteria 886
524 Ga0068869_101745112
525 MRS1b_contig_4074188
526 JGI24746J21847_1004807
527 Ga0065704_10419098
528 Ga0065712_10009058
529 Ga0065712_10010673
530 Ga0065712_10153998
531 Ga0065715_10098234
532 Ga0065715_10108307
533 Ga0065715_10195364
534 Ga0065715_10374991
535 Ga0065707_10001477
536 Ga0065707_10112335
537 Ga0065707_10408157
538 Ga0070658_10764198
539 Ga0070658_11074424
540 Ga0070676_10012106
541 Ga0070676_10014923
542 Ga0070676_10092650
543 Ga0070676_10364711
544 Ga0070690_100025457
545 Ga0070690_100096865
546 Ga0070690_100131940
547 Ga0070690_101318187
548 Ga0070670_100125526
549 Ga0070670_100240869
550 Ga0070670_100652607
551 Ga0070670_101571842
552 Ga0070677_10003130
553 Ga0070677_10003564
554 Ga0068869_100022515
555 Ga0068869_100025240
556 Ga0068869_100036403
557 Ga0068869_100179941
558 Ga0068869_101884108
559 Ga0070666_10130576
560 Ga0070680_100359512
561 Ga0070682_101896458
562 Ga0068868_100114153
563 Ga0068868_100288802
564 Ga0068868_100356400
565 Ga0068868_101030033
566 Ga0070660_100226011
567 Ga0070689_100005544
568 Ga0070689_100148978
569 Ga0070689_100314537
570 Ga0070689_102031977
571 Ga0070687_100002304
572 Ga0070687_100023299
573 Ga0070687_101096635
574 Ga0070661_100017441
575 Ga0070661_101016076
576 Ga0070692_10066748
577 Ga0070692_10301780
578 Ga0070692_10665374
579 Ga0070668_100116591
580 Ga0070668_100440869
581 Ga0070668_101359768
582 Ga0070669_100000771
583 Ga0070669_100002356
584 Ga0070669_100024082
585 Ga0070669_100078211
586 Ga0070669_100094205
587 Ga0070675_100018217
588 Ga0070675_100037750
589 Ga0070675_100039211
590 Ga0070675_100064972
591 Ga0070675_100238635
592 Ga0070675_101194699
593 Ga0070671_100086476
594 Ga0070671_100209820
595 Ga0070674_100001555
596 Ga0070674_100010107
597 Ga0070674_100142102
598 Ga0070674_100809531
599 Ga0070674_102144935
600 Ga0070673_100014001
601 Ga0070673_100036316
602 Ga0070673_100037983
603 Ga0070673_102099581
604 Ga0070688_100075359
605 Ga0070688_100252147
606 Ga0070659_100036337
607 Ga0070659_100105266
608 Ga0070659_100249044
609 Ga0070659_101508190
610 Ga0070667_100035393
611 Ga0070667_100053291
612 Ga0070667_100819625
613 Ga0070701_10018502
614 Ga0070701_10047222
615 Ga0070701_10093776
616 Ga0070705_100000931
617 Ga0070705_100007664
618 Ga0070705_100146840
619 Ga0070705_100478563
620 Ga0070700_100006944
621 Ga0070700_100057547
622 Ga0070700_100626341
623 Ga0070694_100001049
624 Ga0070694_100048743
625 Ga0070694_100291649
626 Ga0070694_100689391
627 Ga0070663_100220584
628 Ga0070678_100030372
629 Ga0070678_100087667
630 Ga0070678_100101427
631 Ga0070678_100211599
632 Ga0070678_100925156
633 Ga0070678_101154566
634 Ga0070678_101505215
635 Ga0070662_100004368
636 Ga0070662_100041257
637 Ga0070662_100162621
638 Ga0070681_10895386
639 Ga0068867_100007614
640 Ga0068867_100020091
641 Ga0068867_100102085
642 Ga0068867_100167585
643 Ga0068867_100284444
644 Ga0068867_100406536
645 Ga0068867_100638031
646 Ga0070685_10112928
647 Ga0070685_10380477
648 Ga0070698_100148646
649 Ga0070699_100550080
650 Ga0070679_100200261
651 Ga0070684_100218634
652 Ga0068853_100711724
653 Ga0070672_100027177
654 Ga0070672_100271820
655 Ga0070672_100299783
656 Ga0070672_100763411
657 Ga0070686_100018545
658 Ga0070686_100028113
659 Ga0070695_100002594
660 Ga0070695_100618742
661 Ga0070695_101426951
662 Ga0070696_100002040
663 Ga0070696_100022639
664 Ga0070696_100036013
665 Ga0070665_100356532
666 Ga0070665_100817682
667 Ga0070704_100035015
668 Ga0070704_100090558
669 Ga0070704_100197055
670 Ga0070704_101532612
671 Ga0070664_100000927
672 Ga0070664_100118305
673 Ga0070664_100147139
674 Ga0070664_100527102
675 Ga0068857_100017545
676 Ga0068857_100252585
677 Ga0068857_100452891
678 Ga0068857_100630559
679 Ga0068854_100268497
680 Ga0068854_101764774
681 Ga0068854_101902486
682 Ga0068856_102167044
683 Ga0070702_100015296
684 Ga0070702_101564667
685 Ga0068852_100261415
686 Ga0068852_102371293
687 Ga0068852_102538699
688 Ga0068859_100002122
689 Ga0068859_100012255
690 Ga0068859_100330368
691 Ga0068859_102065184
692 Ga0068864_100015198
693 Ga0068864_100015789
694 Ga0068864_100334168
695 Ga0068866_10178688
696 Ga0068861_100012212
697 Ga0068861_100042722
698 Ga0068861_100330932
699 Ga0068861_100392315
700 Ga0068870_10004292
701 Ga0068870_10016881
702 Ga0068863_100546508
703 Ga0068863_100608567
704 Ga0068863_102047910
705 Ga0068858_100087354
706 Ga0068860_100112285
707 Ga0068860_100893135
708 Ga0068862_100010160
709 Ga0068862_100015379
710 Ga0068862_100020009
711 Ga0068862_100113104
712 Ga0068862_100319059
713 Ga0068862_100410236
714 Ga0068862_101168302
715 Ga0097621_100070669
716 Ga0097621_100122759
717 Ga0068871_100071004
718 Ga0068871_100327099
719 Ga0075428_100072070
720 Ga0075428_100202946
721 Ga0075428_100213011
722 Ga0075428_100390830
723 Ga0075428_100605671
724 Ga0075428_100720427
725 Ga0075430_100002996
726 Ga0075430_100003373
727 Ga0075430_100034213
728 Ga0075430_101460499
729 Ga0075431_100002691
730 Ga0075431_100008155
731 Ga0075431_100041430
732 Ga0075431_100079491
733 Ga0075431_100084691
734 Ga0075431_100445987
735 Ga0075431_100759086
736 Ga0075433_10010801
737 Ga0075433_10100436
738 Ga0075433_11147549
739 Ga0075434_100017640
740 Ga0075434_100044996
741 Ga0075434_100064091
742 Ga0075429_100013146
743 Ga0075429_100023375
744 Ga0075429_100036651
745 Ga0075429_100103012
746 Ga0075429_100307529
747 Ga0075429_100444960
748 Ga0068865_100021472
749 Ga0068865_100053852
750 Ga0068865_102138461
751 Ga0097620_100002122
752 Ga0097620_100012255
753 Ga0097620_100330374
754 Ga0097620_102065648
755 Ga0111539_10006423
756 Ga0111539_10015636
757 Ga0111539_10093309
758 Ga0111539_10139283
759 Ga0111539_10225730
760 Ga0111539_10290849
761 Ga0111539_10405524
762 Ga0105247_10464952
763 Ga0114129_10047926
764 Ga0114129_10068116
765 Ga0114129_10189518
766 Ga0105243_10020504
767 Ga0105243_10291761
768 Ga0105243_10458019
769 Ga0105243_10644991
770 Ga0105242_10029485
771 Ga0105242_10238774
772 Ga0105242_10922602
773 Ga0105249_10002617
774 Ga0105249_10014235
775 Ga0105249_10192949
776 Ga0105246_10013480
777 Ga0105246_10311187
778 Ga0105246_10625197
779 Ga0157342_1022757
780 Ga0157371_10059263
781 Ga0157370_10017940
782 Ga0157369_10387174
783 Ga0157374_10592761
784 Ga0157378_10218146
785 Ga0157378_11774672
786 Ga0163162_10016744
787 Ga0163162_10683564
788 Ga0163162_10781052
789 Ga0163162_12140286
790 Ga0157372_10802922
791 Ga0157375_10001047
792 Ga0157375_10020925
793 Ga0157375_11611815
794 Ga0157375_12380091
795 Ga0163163_10076371
796 Ga0163163_10639988
797 Ga0157380_10014457
798 Ga0157380_10022089
799 Ga0157380_10038544
800 Ga0157380_10675369
801 Ga0157377_10033450
802 Ga0157377_10097023
803 Ga0157377_11159876
804 Ga0157379_10045068
805 Ga0157376_10190360
806 Ga0157376_10267083
807 Ga0157376_11412686
808 Ga0157376_12296287
809 Ga0163161_10230071
810 Ga0163161_10311904
811 Ga0163161_10933819
812 Ga0213876_10021477
813 Ga0207666_1030336
814 Ga0207673_1038585
815 Ga0207697_10003458
816 Ga0207697_10029941
817 Ga0207697_10054458
818 Ga0207682_10000967
819 Ga0207682_10006193
820 Ga0207682_10098107
821 Ga0207642_10030154
822 Ga0207688_10003039
823 Ga0207688_10026236
824 Ga0207680_10039075
825 Ga0207680_10145477
826 Ga0207680_10341887
827 Ga0207645_10005932
828 Ga0207645_10006164
829 Ga0207645_10059774
830 Ga0207645_10092652
831 Ga0207645_10182277
832 Ga0207643_10000265
833 Ga0207643_10014427
834 Ga0207643_10034648
835 Ga0207705_11109754
836 Ga0207660_10446015
837 Ga0207660_10628545
838 Ga0207662_10005915
839 Ga0207662_10008840
840 Ga0207657_10219830
841 Ga0207649_11583832
842 Ga0207652_10157917
843 Ga0207681_10007566
844 Ga0207681_10021744
845 Ga0207681_10035449
846 Ga0207681_10298684
847 Ga0207681_10567675
848 Ga0207681_11152790
849 Ga0207650_10223089
850 Ga0207650_10244944
851 Ga0207650_10449435
852 Ga0207659_10036343
853 Ga0207659_10043033
854 Ga0207659_10137236
855 Ga0207659_10216107
856 Ga0207659_10453336
857 Ga0207659_11003457
858 Ga0207659_11657351
859 Ga0207687_10429735
860 Ga0207644_10083238
861 Ga0207644_10196100
862 Ga0207644_11300137
863 Ga0207690_10033108
864 Ga0207690_10079300
865 Ga0207690_10354066
866 Ga0207706_10012917
867 Ga0207706_10034946
868 Ga0207706_10061144
869 Ga0207686_10021512
870 Ga0207709_10062105
871 Ga0207709_10166680
872 Ga0207709_10207266
873 Ga0207709_11330284
874 Ga0207670_10053453
875 Ga0207670_10074512
876 Ga0207669_10001490
877 Ga0207669_10262567
878 Ga0207669_10542417
879 Ga0207669_11294099
880 Ga0207704_10126057
881 Ga0207704_10162187
882 Ga0207704_11261834
883 Ga0207704_11746617
884 Ga0207665_10972296
885 Ga0207691_10003545
886 Ga0207691_10021809
887 Ga0207691_10628874
888 Ga0207689_10001787
889 Ga0207689_10029924
890 Ga0207689_10053941
891 Ga0207689_10104536
892 Ga0207689_10149736
893 Ga0207661_10063654
894 Ga0207679_10001147
895 Ga0207679_10455050
896 Ga0207679_10654531
897 Ga0207679_10993132
898 Ga0207651_10040556
899 Ga0207651_10056871
900 Ga0207651_10145651
901 Ga0207651_10167367
902 Ga0207712_10075125
903 Ga0207712_10552478
904 Ga0207712_10995773
905 Ga0207668_10137295
906 Ga0207668_10335525
907 Ga0207640_10009405
908 Ga0207658_10211432
909 Ga0207677_10273056
910 Ga0207677_10288821
911 Ga0207677_10992711
912 Ga0207703_11583411
913 Ga0207639_10664550
914 Ga0207639_11435309
915 Ga0207678_10154208
916 Ga0207678_11447420
917 Ga0207708_10001721
918 Ga0207708_10064289
919 Ga0207708_10094453
920 Ga0207702_10532401
921 Ga0207641_10007746
922 Ga0207641_10930176
923 Ga0207648_10000784
924 Ga0207648_10030677
925 Ga0207648_10041555
926 Ga0207648_10108638
927 Ga0207648_10131975
928 Ga0207648_10213334
929 Ga0207648_10305206
930 Ga0207648_11761248
931 Ga0207676_10012739
932 Ga0207676_10094102
933 Ga0207676_10122616
934 Ga0207674_10015435
935 Ga0207674_10078464
936 Ga0207674_10333239
937 Ga0207674_10393101
938 Ga0207675_100000123
939 Ga0207675_100006998
940 Ga0207675_100007846
941 Ga0207675_100092129
942 Ga0207675_100473944
943 Ga0207675_100492890
944 Ga0207675_100681214
945 Ga0207683_10014361
946 Ga0207683_10018300
947 Ga0207683_10475646
948 Ga0207683_10701454
949 Ga0207698_10176194
950 Ga0207698_10658061
951 Ga0210002_1027323
952 Ga0207428_10012409
953 Ga0207428_10054780
954 Ga0207428_10397287
955 Ga0207428_10399781
956 Ga0207428_10538889
957 Ga0268266_11180110
958 Ga0268265_10000593
959 Ga0268265_10009710
960 Ga0268265_10020890
961 Ga0268265_10057613
962 Ga0268265_10568011
963 Ga0268265_10843710
964 Ga0268264_11481010
965 Ga0265330_10167380
966 Ga0265325_10003338
967 Ga0265339_10019981
968 Ga0265331_10050114
969 Ga0265316_10073790
970 Ga0265313_10009901
971 Ga0265314_10063729
972 Ga0265342_10030383
973 Ga0307410_10761438
974 Ga0307406_10683898
975 Ga0307407_10103987
976 Ga0307416_100960548
977 Ga0307416_102872467
978 Ga0373942_0277807
979 Ga0373961_0146126
980 Ga0373931_0194944
981 Ga0436365_0669497
982 Ga0439441_106199
983 Ga0439459_0138949
984 Ga0466972_0158357
985 Ga0466957_0716975
986 Ga0451576_0085334
987 Ga0451576_0258249
988 Ga0466967_0293104
989 Ga0495591_106510
990 Ga0495580_0439673
991 Ga0495656_0101464
992 Ga0495635_0958671
993 Ga0495670_0193155
994 Ga0495636_0648307
995 Ga0496109_0770549
996 Ga0496113_1214668
997 Ga0496114_1386172
998 Ga0501033_0016240
999 Ga0501033_0079119
1000 Ga0501037_0013315
1001 Ga0501042_0638515
1002 Ga0501043_0320523
1003 Ga0501047_0028760
1004 Ga0501047_0396237
1005 Ga0501083_0171822
1006 Ga0501035_1302330
1007 Ga0501044_0007087
1008 Ga0501044_0447888
1009 Ga0501044_0563524
1010 nmdc:mga05p37_103029_c1
1011 nmdc:mga05p37_119330_c1
1012 nmdc:mga05p37_182096_c1
1013 nmdc:mga05p37_95119_c1
1014 nmdc:mga09592_121109_c1
1015 nmdc:mga09592_191723_c1
1016 nmdc:mga09592_262363_c1
1017 nmdc:mga09592_27412_c1
1018 nmdc:mga09592_373211_c1
1019 nmdc:mga09592_635257_c1
1020 nmdc:mga0qj67_1106_c1
1021 nmdc:mga0qj67_2977_c1
1022 nmdc:mga0qj67_32645_c1
1023 nmdc:mga0qj67_44405_c1
1024 nmdc:mga0qj67_570594_c1
1025 nmdc:mga0qj67_682089_c1
1026 nmdc:mga06r32_12751_c1
1027 nmdc:mga06r32_5229_c1
1028 nmdc:mga06r32_543137_c1
1029 nmdc:mga06r32_690_c1
1030 nmdc:mga06r32_72707_c1
1031 nmdc:mga06r32_74061_c1
1032 nmdc:mga06r32_943600_c1
1033 nmdc:mga08y16_2099618_c1
1034 nmdc:mga08y16_21757_c1
1035 nmdc:mga08y16_388852_c1
1036 nmdc:mga08y16_41335_c1
1037 nmdc:mga08y16_494832_c1
1038 nmdc:mga08y16_593431_c1
1039 nmdc:mga08y16_602933_c1
1040 nmdc:mga08y16_92757_c1
1041 nmdc:mga08y16_955590_c1
1042 nmdc:mga0n895_16809_c1
1043 nmdc:mga0n895_187961_c1
1044 nmdc:mga0a205_199074_c1
1045 nmdc:mga0a205_2694_c1
1046 Ga0590075_073149

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

7

119

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1nxt-assembly1.cif.gz_A-2 micarec ph 4.0 0.9717 3 118
1nxx-assembly1.cif.gz_A-2 micarec ph 5.5 0.9672 3 118
4kny-assembly1.cif.gz_A crystal structure of the response regulator kdpe complexed to dna in an active-like conformation 0.9658 1 118
2a9r-assembly1.cif.gz_A-2 rr02-rec phosphate in the active site 0.9657 3 118
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.9654 3 118
ID Description Score Start End Superfamily
af_Q2FWH6_1_124_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.976 1 118 3.40.50.2300
4d6yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9736 5 118 3.40.50.2300
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9678 1 118 3.40.50.2300
af_P21866_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9671 3 82 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9655 2 118 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A7V4MZ28-F1-model_v4 Response regulator 0.9947 3 118 GO:0000160
AF-A0A7X9AG88-F1-model_v4 Response regulator 0.9912 1 119 GO:0000160
AF-A0A7C1GVZ6-F1-model_v4 Response regulator 0.9885 1 119 GO:0000160
AF-A0A349JSH2-F1-model_v4 Fis family transcriptional regulator 0.988 3 118 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A399ELM7-F1-model_v4 Putative transcriptional regulatory protein TcrX 0.9874 3 120 GO:0000160

Map