F458907

General Info

Members Datasets Scaffolds Average Seq Length
522 183 519 226

Family's Representative Sequence

Representative Sequence 3300049667|Ga0501230_003102|Ga0501230_003102_603_1340
Length 245
Sequence MMKKPVLAVALLAAIPMGAASAADIDLVEQARDGGVALLAILALSVLMLAVALERLLHLRPRHVVPPGLADAVLPLWRAGEFARTELELTGQDSTLARIIAYLAAHRHLDYARVSSGAADIASLELRRHQQKFYALSIVATVAPIVGLLGTVLGMIEAFHVIAFADGMGNPALLAGGISKALVNTAAGLCVALPALGMHHFLKHRTAMLALALEQDVNRLLQACFPPRAPGQASQPGLQVVPHAH

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
28 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
29 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
30 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
33 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
63 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
64 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
65 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
66 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
67 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
68 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
69 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
70 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
75 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
76 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
77 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
78 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
79 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
80 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
81 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
82 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
83 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
87 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
88 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
89 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
90 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
91 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
92 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
93 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
94 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
104 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
105 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
106 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
107 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
108 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
111 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
114 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
115 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
116 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
117 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
118 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
119 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
120 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
121 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
122 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
123 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
124 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
125 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
126 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
133 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
134 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
135 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
136 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
142 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
145 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
146 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
159 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
174 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
175 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
176 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
177 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
178 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
179 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
183 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.43
Metatranscriptomes 0
Isolates 0.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.49
Nodule 0
Rhizoplane 5.17
Rhizosphere 89.27
Stem 0
Stem Tuber 0
Unclassified 3.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10014334 3300003316 Bacteria 20021
2 rootL2_10003893 3300003322 Bacteria 19760
3 rootL2_10024668 3300003322 Bacteria 3611
4 Ga0055525_1000006 3300003759 Bacteria 642912
5 Ga0055525_1000028 3300003759 Bacteria 331683
6 Ga0055530_10029897 3300003791 Bacteria 1450
7 Ga0055531_10000381 3300003794 Bacteria 42797
8 Ga0065165_1011896 3300005262 Bacteria 3582
9 Ga0065165_1022592 3300005262 Bacteria 2153
10 Ga0070658_10026667 3300005327 Bacteria 4637
11 Ga0070658_10042494 3300005327 Bacteria 3671
12 Ga0070658_10133909 3300005327 Bacteria 2067
13 Ga0070682_100235410 3300005337 Bacteria 1312
14 Ga0070660_100001131 3300005339 Bacteria 17999
15 Ga0070660_100099096 3300005339 Bacteria 2307
16 Ga0070660_100486769 3300005339 Bacteria 1025
17 Ga0070659_100014912 3300005366 Bacteria 5813
18 Ga0070659_100054413 3300005366 Bacteria 3152
19 Ga0070659_100086321 3300005366 Bacteria 2511
20 Ga0070662_100080773 3300005457 Bacteria 2421
21 Ga0070662_100173360 3300005457 Bacteria 1696
22 Ga0070662_100240484 3300005457 Bacteria 1452
23 Ga0070679_100605407 3300005530 Bacteria 1039
24 Ga0068855_100012116 3300005563 Bacteria 10419
25 Ga0068855_100360955 3300005563 Bacteria 1598
26 Ga0070664_100002839 3300005564 Bacteria 14014
27 Ga0070664_100055972 3300005564 Bacteria 3351
28 Ga0070664_100069110 3300005564 Bacteria 3021
29 Ga0070664_100275872 3300005564 Bacteria 1515
30 Ga0070664_100358493 3300005564 Bacteria 1328
31 Ga0070664_100571080 3300005564 Bacteria 1047
32 Ga0068852_100063749 3300005616 Bacteria 3210
33 Ga0068852_100710427 3300005616 Bacteria 1016
34 Ga0097621_100380705 3300006237 Bacteria 1260
35 Ga0068871_100322306 3300006358 Bacteria 1361
36 Ga0105244_10001057 3300009036 Bacteria 23037
37 Ga0105245_10487020 3300009098 Bacteria 1247
38 Ga0105243_10060322 3300009148 Bacteria 3030
39 Ga0105243_10167199 3300009148 Bacteria 1902
40 Ga0105242_10026891 3300009176 Bacteria 4563
41 Ga0105237_10388936 3300009545 Bacteria 1400
42 Ga0105238_10381757 3300009551 Bacteria 1400
43 Ga0105239_10116292 3300010375 Bacteria 2968
44 Ga0105246_10108918 3300011119 Bacteria 2031
45 Ga0105246_10827440 3300011119 Bacteria 824
46 Ga0157369_10997828 3300013105 Bacteria 857
47 Ga0157372_10203018 3300013307 Bacteria 2296
48 Ga0157372_10288261 3300013307 Bacteria 1909
49 Ga0157372_10338393 3300013307 Bacteria 1753
50 Ga0157376_10372945 3300014969 Bacteria 1372
51 Ga0182007_10107836 3300015262 Bacteria 925
52 Ga0213872_10000018 3300021361 Bacteria 175951
53 Ga0213872_10077866 3300021361 Bacteria 1490
54 Ga0209563_100011 3300025230 Bacteria 1187808
55 Ga0209563_100022 3300025230 Bacteria 643318
56 Ga0209677_101675 3300025253 Bacteria 9273
57 Ga0209677_103102 3300025253 Bacteria 5653
58 Ga0209148_1000585 3300025254 Bacteria 33334
59 Ga0209050_1005124 3300025298 Bacteria 8422
60 Ga0209257_1000117 3300025304 Bacteria 227328
61 Ga0207655_1001365 3300025728 Bacteria 22873
62 Ga0207705_10000223 3300025909 Bacteria 56633
63 Ga0207705_10088477 3300025909 Bacteria 2266
64 Ga0207705_10160197 3300025909 Bacteria 1690
65 Ga0207695_10434172 3300025913 Bacteria 1197
66 Ga0207657_10004042 3300025919 Bacteria 15582
67 Ga0207657_10011356 3300025919 Bacteria 8847
68 Ga0207657_10028267 3300025919 Bacteria 5118
69 Ga0207649_10296175 3300025920 Bacteria 1181
70 Ga0207652_10724460 3300025921 Bacteria 886
71 Ga0207694_10524844 3300025924 Bacteria 992
72 Ga0207690_10033805 3300025932 Bacteria 3290
73 Ga0207690_10065047 3300025932 Bacteria 2492
74 Ga0207690_10069123 3300025932 Bacteria 2429
75 Ga0207706_10082359 3300025933 Bacteria 2828
76 Ga0207706_10102626 3300025933 Bacteria 2516
77 Ga0207706_10124924 3300025933 Bacteria 2263
78 Ga0207706_10130199 3300025933 Bacteria 2213
79 Ga0207706_10197186 3300025933 Bacteria 1766
80 Ga0207686_10013226 3300025934 Bacteria 4563
81 Ga0207686_10207439 3300025934 Bacteria 1407
82 Ga0207686_10490247 3300025934 Bacteria 952
83 Ga0207709_10101567 3300025935 Bacteria 1902
84 Ga0207679_10101077 3300025945 Bacteria 2255
85 Ga0207679_10117391 3300025945 Bacteria 2111
86 Ga0207679_10128465 3300025945 Bacteria 2029
87 Ga0207679_10270406 3300025945 Bacteria 1453
88 Ga0207679_10571212 3300025945 Bacteria 1016
89 Ga0207667_10006615 3300025949 Bacteria 14011
90 Ga0207702_10480140 3300026078 Bacteria 1209
91 Ga0207648_10391250 3300026089 Bacteria 1258
92 Ga0207674_10362160 3300026116 Bacteria 1402
93 Ga0207698_10085401 3300026142 Bacteria 2563
94 Ga0207698_10420763 3300026142 Bacteria 1282
95 Ga0265331_10001540 3300031250 Bacteria 16957
96 Ga0265327_10000012 3300031251 Bacteria 530403
97 Ga0395899_0001188 3300037312 Bacteria 22947
98 Ga0395899_0007019 3300037312 Bacteria 8716
99 Ga0395899_0009427 3300037312 Bacteria 7498
100 Ga0395899_0013898 3300037312 Bacteria 6149
101 Ga0395899_0028424 3300037312 Bacteria 4210
102 Ga0395899_0085535 3300037312 Bacteria 2291
103 Ga0395900_0000307 3300037418 Bacteria 72665
104 Ga0395900_0000497 3300037418 Bacteria 55302
105 Ga0395900_0000600 3300037418 Bacteria 49320
106 Ga0395900_0001987 3300037418 Bacteria 23090
107 Ga0395900_0002248 3300037418 Bacteria 21475
108 Ga0395900_0012205 3300037418 Bacteria 8782
109 Ga0395900_0013824 3300037418 Bacteria 8237
110 Ga0395900_0022519 3300037418 Bacteria 6445
111 Ga0395900_0071136 3300037418 Bacteria 3575
112 Ga0395900_0175798 3300037418 Bacteria 2177
113 Ga0395900_0209857 3300037418 Bacteria 1967
114 Ga0395900_0224154 3300037418 Bacteria 1893
115 Ga0395900_0270906 3300037418 Bacteria 1692
116 Ga0395900_0798256 3300037418 Bacteria 872
117 Ga0395898_0005084 3300037466 Bacteria 14256
118 Ga0395898_0025962 3300037466 Bacteria 5899
119 Ga0395898_0141584 3300037466 Bacteria 2302
120 Ga0395898_0618811 3300037466 Bacteria 1025
121 Ga0395905_0016771 3300037471 Bacteria 6961
122 Ga0395905_0039956 3300037471 Bacteria 4401
123 Ga0395905_0049473 3300037471 Bacteria 3939
124 Ga0395905_0085717 3300037471 Bacteria 2951
125 Ga0395905_0102436 3300037471 Bacteria 2687
126 Ga0395905_0216512 3300037471 Bacteria 1793
127 Ga0395905_0571161 3300037471 Bacteria 1032
128 Ga0395905_0613985 3300037471 Bacteria 989
129 Ga0395901_0000527 3300038443 Bacteria 44065
130 Ga0395901_0020093 3300038443 Bacteria 6835
131 Ga0395901_0025173 3300038443 Bacteria 6109
132 Ga0395901_0039956 3300038443 Bacteria 4856
133 Ga0395901_0044346 3300038443 Bacteria 4612
134 Ga0395901_0216779 3300038443 Bacteria 2001
135 Ga0395901_0550353 3300038443 Bacteria 1169
136 Ga0436361_0677882 3300039447 Bacteria 228834
137 Ga0436361_0726241 3300039447 Bacteria 1197
138 Ga0436361_1008129 3300039447 Bacteria 10091
139 Ga0451793_1621807 3300041452 Bacteria 1344
140 Ga0439448_0000130 3300042005 Bacteria 14231
141 Ga0439448_0000705 3300042005 Bacteria 8020
142 Ga0439448_0016699 3300042005 Bacteria 2236
143 Ga0439448_0045872 3300042005 Bacteria 1423
144 Ga0439448_0159174 3300042005 Bacteria 785
145 Ga0439449_0053979 3300042007 Bacteria 1485
146 Ga0439450_048737 3300042008 Bacteria 1001
147 Ga0439455_0002445 3300042012 Bacteria 3379
148 Ga0439455_0007397 3300042012 Bacteria 2321
149 Ga0439455_0082935 3300042012 Bacteria 873
150 Ga0439458_0007751 3300042157 Bacteria 2391
151 Ga0439458_0010382 3300042157 Bacteria 2077
152 Ga0466969_0000007 3300044656 Bacteria 152114
153 Ga0466972_0005938 3300044658 Bacteria 6130
154 Ga0466965_0006317 3300044683 Bacteria 5370
155 Ga0466966_0004210 3300044684 Bacteria 9492
156 Ga0466966_0019471 3300044684 Bacteria 4465
157 Ga0466966_0023372 3300044684 Bacteria 4047
158 Ga0466966_0078300 3300044684 Bacteria 2061
159 Ga0466966_0203483 3300044684 Bacteria 1197
160 Ga0466961_0263541 3300044693 Bacteria 1056
161 Ga0466963_0003457 3300044694 Bacteria 9048
162 Ga0466963_0284196 3300044694 Bacteria 1163
163 Ga0466964_0000759 3300044706 Bacteria 10500
164 Ga0466964_0063789 3300044706 Bacteria 1539
165 Ga0466964_0104969 3300044706 Bacteria 1252
166 Ga0466971_0165469 3300044719 Bacteria 1036
167 Ga0466968_0000954 3300044735 Bacteria 10180
168 Ga0466968_0216447 3300044735 Bacteria 901
169 Ga0466970_0472202 3300044765 Bacteria 720
170 Ga0466957_0000005 3300044842 Bacteria 102026
171 Ga0466957_0003769 3300044842 Bacteria 8379
172 Ga0466957_0017236 3300044842 Bacteria 4228
173 Ga0466957_0174227 3300044842 Bacteria 1402
174 Ga0466960_0013823 3300044901 Bacteria 3439
175 Ga0466959_0019207 3300045049 Bacteria 5025
176 Ga0466959_0036851 3300045049 Bacteria 3613
177 Ga0466959_0064019 3300045049 Bacteria 2670
178 Ga0466959_0221346 3300045049 Bacteria 1312
179 Ga0466958_0035281 3300045836 Bacteria 2987
180 Ga0466958_0071792 3300045836 Bacteria 2120
181 Ga0466958_0104601 3300045836 Bacteria 1763
182 Ga0466958_0411393 3300045836 Bacteria 874
183 Ga0466967_0026590 3300045976 Bacteria 4795
184 Ga0466967_0037968 3300045976 Bacteria 4127
185 Ga0466967_0144204 3300045976 Bacteria 2220
186 Ga0495617_000014 3300046452 Bacteria 286979
187 Ga0495627_000780 3300046453 Bacteria 23533
188 Ga0495627_008384 3300046453 Bacteria 3880
189 Ga0495627_017772 3300046453 Bacteria 2409
190 Ga0495603_0087722 3300046455 Bacteria 1820
191 Ga0495590_0000006 3300046457 Bacteria 372949
192 Ga0495590_0001082 3300046457 Bacteria 11989
193 Ga0495590_0019679 3300046457 Bacteria 2402
194 Ga0495591_009562 3300046458 Bacteria 3838
195 Ga0495629_0096104 3300046459 Bacteria 2066
196 Ga0495638_0261994 3300046460 Bacteria 948
197 Ga0495653_0001765 3300046463 Bacteria 17044
198 Ga0495653_0094383 3300046463 Bacteria 2180
199 Ga0495650_0000108 3300046471 Bacteria 200369
200 Ga0495582_0000427 3300046473 Bacteria 23024
201 Ga0495582_0032136 3300046473 Bacteria 2887
202 Ga0495605_0000110 3300046474 Bacteria 104425
203 Ga0495605_0000118 3300046474 Bacteria 102724
204 Ga0495605_0009889 3300046474 Bacteria 5348
205 Ga0495605_0014861 3300046474 Bacteria 4249
206 Ga0495605_0024258 3300046474 Bacteria 3176
207 Ga0495605_0024452 3300046474 Bacteria 3160
208 Ga0495605_0046885 3300046474 Bacteria 2122
209 Ga0495584_0001874 3300046491 Bacteria 12156
210 Ga0495584_0002423 3300046491 Bacteria 10576
211 Ga0495584_0009021 3300046491 Bacteria 5153
212 Ga0495584_0009274 3300046491 Bacteria 5072
213 Ga0495584_0038870 3300046491 Bacteria 2404
214 Ga0495584_0109197 3300046491 Bacteria 1399
215 Ga0495585_0009918 3300046492 Bacteria 5690
216 Ga0495585_0013227 3300046492 Bacteria 4834
217 Ga0495585_0013625 3300046492 Bacteria 4753
218 Ga0495585_0018244 3300046492 Bacteria 4049
219 Ga0495585_0041458 3300046492 Bacteria 2581
220 Ga0495585_0059188 3300046492 Bacteria 2111
221 Ga0495585_0284440 3300046492 Bacteria 816
222 Ga0495585_0312795 3300046492 Bacteria 769
223 Ga0495594_0019250 3300046499 Bacteria 3626
224 Ga0495594_0072680 3300046499 Bacteria 1913
225 Ga0495596_0004363 3300046500 Bacteria 6910
226 Ga0495596_0008387 3300046500 Bacteria 4602
227 Ga0495596_0009330 3300046500 Bacteria 4318
228 Ga0495596_0011518 3300046500 Bacteria 3811
229 Ga0495596_0011795 3300046500 Bacteria 3753
230 Ga0495596_0015447 3300046500 Bacteria 3196
231 Ga0495596_0016613 3300046500 Bacteria 3054
232 Ga0495596_0031492 3300046500 Bacteria 2118
233 Ga0495596_0042755 3300046500 Bacteria 1785
234 Ga0495596_0104747 3300046500 Bacteria 1098
235 Ga0495607_0004432 3300046501 Bacteria 10324
236 Ga0495607_0004748 3300046501 Bacteria 9936
237 Ga0495607_0005340 3300046501 Bacteria 9231
238 Ga0495607_0005448 3300046501 Bacteria 9106
239 Ga0495607_0015621 3300046501 Bacteria 4917
240 Ga0495607_0015663 3300046501 Bacteria 4908
241 Ga0495607_0020231 3300046501 Bacteria 4212
242 Ga0495607_0020905 3300046501 Bacteria 4125
243 Ga0495607_0032073 3300046501 Bacteria 3210
244 Ga0495607_0060957 3300046501 Bacteria 2145
245 Ga0495607_0227282 3300046501 Bacteria 909
246 Ga0495583_0001075 3300046506 Bacteria 30534
247 Ga0495583_0006145 3300046506 Bacteria 7913
248 Ga0495583_0126594 3300046506 Bacteria 1071
249 Ga0495583_0199109 3300046506 Bacteria 814
250 Ga0495606_0000046 3300046507 Bacteria 210855
251 Ga0495606_0000458 3300046507 Bacteria 66935
252 Ga0495606_0012627 3300046507 Bacteria 6751
253 Ga0495606_0017427 3300046507 Bacteria 5432
254 Ga0495606_0027196 3300046507 Bacteria 4061
255 Ga0495606_0088103 3300046507 Bacteria 1914
256 Ga0495610_0001713 3300046512 Bacteria 19221
257 Ga0495616_0000088 3300046513 Bacteria 77629
258 Ga0495616_0001119 3300046513 Bacteria 19010
259 Ga0495616_0003638 3300046513 Bacteria 9845
260 Ga0495616_0004891 3300046513 Bacteria 8375
261 Ga0495616_0010672 3300046513 Bacteria 5306
262 Ga0495616_0011234 3300046513 Bacteria 5140
263 Ga0495616_0024955 3300046513 Bacteria 3199
264 Ga0495616_0028096 3300046513 Bacteria 2980
265 Ga0495616_0076819 3300046513 Bacteria 1604
266 Ga0495616_0085839 3300046513 Bacteria 1498
267 Ga0495616_0303873 3300046513 Bacteria 673
268 Ga0495630_0060588 3300046517 Bacteria 2841
269 Ga0495631_0002058 3300046518 Bacteria 11722
270 Ga0495631_0006518 3300046518 Bacteria 6021
271 Ga0495631_0012507 3300046518 Bacteria 4142
272 Ga0495631_0016260 3300046518 Bacteria 3552
273 Ga0495631_0018775 3300046518 Bacteria 3251
274 Ga0495631_0020790 3300046518 Bacteria 3061
275 Ga0495631_0045182 3300046518 Bacteria 1939
276 Ga0495631_0050182 3300046518 Bacteria 1825
277 Ga0495631_0057090 3300046518 Bacteria 1699
278 Ga0495632_0000041 3300046519 Bacteria 145509
279 Ga0495632_0002462 3300046519 Bacteria 14088
280 Ga0495632_0002478 3300046519 Bacteria 14021
281 Ga0495632_0002700 3300046519 Bacteria 13248
282 Ga0495637_0054178 3300046520 Bacteria 1667
283 Ga0495637_0089855 3300046520 Bacteria 1213
284 Ga0495643_0003305 3300046522 Bacteria 11911
285 Ga0495643_0033227 3300046522 Bacteria 2856
286 Ga0495643_0036268 3300046522 Bacteria 2710
287 Ga0495643_0043812 3300046522 Bacteria 2433
288 Ga0495644_0011479 3300046523 Bacteria 3410
289 Ga0495644_0094592 3300046523 Bacteria 1128
290 Ga0495648_0003276 3300046524 Bacteria 14328
291 Ga0495648_0006050 3300046524 Bacteria 9928
292 Ga0495648_0006756 3300046524 Bacteria 9276
293 Ga0495648_0016175 3300046524 Bacteria 5383
294 Ga0495648_0058121 3300046524 Bacteria 2314
295 Ga0495648_0058134 3300046524 Bacteria 2314
296 Ga0495663_0037801 3300046525 Bacteria 1457
297 Ga0495666_0061475 3300046526 Bacteria 1794
298 Ga0495642_0000017 3300046528 Bacteria 111313
299 Ga0495642_0003740 3300046528 Bacteria 5959
300 Ga0495642_0004962 3300046528 Bacteria 5127
301 Ga0495642_0017269 3300046528 Bacteria 2819
302 Ga0495642_0027271 3300046528 Bacteria 2272
303 Ga0495642_0092936 3300046528 Bacteria 1278
304 Ga0495642_0160874 3300046528 Bacteria 973
305 Ga0495652_0052272 3300046529 Bacteria 3485
306 Ga0495654_0086512 3300046530 Bacteria 1460
307 Ga0495587_0053278 3300046536 Bacteria 2385
308 Ga0495609_0000009 3300046538 Bacteria 354860
309 Ga0495609_0001192 3300046538 Bacteria 17878
310 Ga0495609_0001988 3300046538 Bacteria 12927
311 Ga0495609_0007091 3300046538 Bacteria 5639
312 Ga0495609_0016345 3300046538 Bacteria 3457
313 Ga0495609_0018109 3300046538 Bacteria 3267
314 Ga0495609_0023270 3300046538 Bacteria 2848
315 Ga0495597_0000653 3300046542 Bacteria 28153
316 Ga0495597_0003227 3300046542 Bacteria 9693
317 Ga0495597_0004627 3300046542 Bacteria 7498
318 Ga0495597_0021151 3300046542 Bacteria 3025
319 Ga0495597_0023065 3300046542 Bacteria 2880
320 Ga0495622_0003590 3300046557 Bacteria 7284
321 Ga0495622_0069456 3300046557 Bacteria 1626
322 Ga0495633_0009542 3300046558 Bacteria 5350
323 Ga0495633_0094473 3300046558 Bacteria 1389
324 Ga0495656_0012666 3300046615 Bacteria 3118
325 Ga0495656_0048550 3300046615 Bacteria 1804
326 Ga0495656_0103944 3300046615 Bacteria 1318
327 Ga0495656_0132386 3300046615 Bacteria 1188
328 Ga0495668_0000148 3300046616 Bacteria 105875
329 Ga0495668_0000243 3300046616 Bacteria 77845
330 Ga0495668_0003115 3300046616 Bacteria 12811
331 Ga0495668_0003304 3300046616 Bacteria 12205
332 Ga0495668_0005025 3300046616 Bacteria 9120
333 Ga0495668_0006221 3300046616 Bacteria 7883
334 Ga0495668_0009838 3300046616 Bacteria 5836
335 Ga0495668_0011495 3300046616 Bacteria 5300
336 Ga0495668_0075398 3300046616 Bacteria 1852
337 Ga0495668_0450278 3300046616 Bacteria 708
338 Ga0495611_0012589 3300046648 Bacteria 3596
339 Ga0495611_0050159 3300046648 Bacteria 1879
340 Ga0495611_0135526 3300046648 Bacteria 1149
341 Ga0495625_0007902 3300046660 Bacteria 9152
342 Ga0495625_0014424 3300046660 Bacteria 6308
343 Ga0495625_0016754 3300046660 Bacteria 5756
344 Ga0495625_0209937 3300046660 Bacteria 1280
345 Ga0495661_0000032 3300046665 Bacteria 170076
346 Ga0495661_0000823 3300046665 Bacteria 29101
347 Ga0495661_0002650 3300046665 Bacteria 13699
348 Ga0495661_0004591 3300046665 Bacteria 9939
349 Ga0495661_0007893 3300046665 Bacteria 7392
350 Ga0495661_0015139 3300046665 Bacteria 5152
351 Ga0495661_0016705 3300046665 Bacteria 4857
352 Ga0495661_0034514 3300046665 Bacteria 3182
353 Ga0495661_0044558 3300046665 Bacteria 2718
354 Ga0495661_0048296 3300046665 Bacteria 2586
355 Ga0495661_0069716 3300046665 Bacteria 2059
356 Ga0495661_0078143 3300046665 Bacteria 1915
357 Ga0495661_0115786 3300046665 Bacteria 1488
358 Ga0495661_0148578 3300046665 Bacteria 1267
359 Ga0495588_0000126 3300046674 Bacteria 128815
360 Ga0495588_0005310 3300046674 Bacteria 5729
361 Ga0495588_0119401 3300046674 Bacteria 1390
362 Ga0495623_0014452 3300046679 Bacteria 5109
363 Ga0495646_0097728 3300046680 Bacteria 1687
364 Ga0495669_0002258 3300046684 Bacteria 7902
365 Ga0495669_0009259 3300046684 Bacteria 4149
366 Ga0495669_0061648 3300046684 Bacteria 1698
367 Ga0495613_0191216 3300046689 Bacteria 1446
368 Ga0495670_0006150 3300046691 Bacteria 5895
369 Ga0495670_0006449 3300046691 Bacteria 5762
370 Ga0495670_0007477 3300046691 Bacteria 5366
371 Ga0495670_0008376 3300046691 Bacteria 5085
372 Ga0495670_0029328 3300046691 Bacteria 2730
373 Ga0495670_0063835 3300046691 Bacteria 1854
374 Ga0495670_0106328 3300046691 Bacteria 1449
375 Ga0495670_0135666 3300046691 Bacteria 1285
376 Ga0495671_0002017 3300046692 Bacteria 13033
377 Ga0495671_0002196 3300046692 Bacteria 12422
378 Ga0495671_0003766 3300046692 Bacteria 9215
379 Ga0495671_0036337 3300046692 Bacteria 2496
380 Ga0495649_0003290 3300046694 Bacteria 11003
381 Ga0495649_0008451 3300046694 Bacteria 6194
382 Ga0495649_0012116 3300046694 Bacteria 5031
383 Ga0495649_0030172 3300046694 Bacteria 2995
384 Ga0495649_0069214 3300046694 Bacteria 1893
385 Ga0495649_0095505 3300046694 Bacteria 1582
386 Ga0495649_0109994 3300046694 Bacteria 1461
387 Ga0495589_0000049 3300046794 Bacteria 116553
388 Ga0495589_0000136 3300046794 Bacteria 67764
389 Ga0495589_0001860 3300046794 Bacteria 11959
390 Ga0495589_0008867 3300046794 Bacteria 5231
391 Ga0495589_0011402 3300046794 Bacteria 4616
392 Ga0495589_0022637 3300046794 Bacteria 3206
393 Ga0495589_0080434 3300046794 Bacteria 1585
394 Ga0495589_0085195 3300046794 Bacteria 1535
395 Ga0495589_0137136 3300046794 Bacteria 1173
396 Ga0495600_0233881 3300046809 Bacteria 1172
397 Ga0495660_0000068 3300046810 Bacteria 119060
398 Ga0495660_0009293 3300046810 Bacteria 5737
399 Ga0495660_0022073 3300046810 Bacteria 3637
400 Ga0495660_0022723 3300046810 Bacteria 3579
401 Ga0495660_0033085 3300046810 Bacteria 2901
402 Ga0495660_0036752 3300046810 Bacteria 2730
403 Ga0495660_0118582 3300046810 Bacteria 1341
404 Ga0495660_0167086 3300046810 Bacteria 1074
405 Ga0495660_0186420 3300046810 Bacteria 1000
406 Ga0495660_0243899 3300046810 Bacteria 836
407 Ga0495581_0080588 3300047315 Bacteria 1884
408 Ga0495604_0027158 3300047317 Bacteria 4554
409 Ga0495636_0215854 3300047318 Bacteria 879
410 Ga0495672_0000530 3300047320 Bacteria 43361
411 Ga0495672_0000631 3300047320 Bacteria 39335
412 Ga0495672_0000870 3300047320 Bacteria 31792
413 Ga0495672_0006431 3300047320 Bacteria 9101
414 Ga0495672_0010146 3300047320 Bacteria 6735
415 Ga0495672_0018223 3300047320 Bacteria 4671
416 Ga0495672_0048405 3300047320 Bacteria 2521
417 Ga0495683_0001825 3300047323 Bacteria 13389
418 Ga0495683_0005255 3300047323 Bacteria 7195
419 Ga0495683_0009365 3300047323 Bacteria 5218
420 Ga0495683_0012643 3300047323 Bacteria 4432
421 Ga0495683_0058284 3300047323 Bacteria 1918
422 Ga0495683_0066209 3300047323 Bacteria 1780
423 Ga0495683_0154024 3300047323 Bacteria 1067
424 Ga0495687_000024 3300047443 Bacteria 316676
425 Ga0495687_000052 3300047443 Bacteria 199186
426 Ga0495687_000085 3300047443 Bacteria 145052
427 Ga0495687_001246 3300047443 Bacteria 24247
428 Ga0495687_001382 3300047443 Bacteria 22442
429 Ga0495687_001520 3300047443 Bacteria 21151
430 Ga0495687_001746 3300047443 Bacteria 19234
431 Ga0495687_004137 3300047443 Bacteria 9996
432 Ga0495687_052342 3300047443 Bacteria 1727
433 Ga0495675_0078123 3300047444 Bacteria 2084
434 Ga0495677_0000018 3300047445 Bacteria 120412
435 Ga0495677_0001467 3300047445 Bacteria 9453
436 Ga0495677_0002172 3300047445 Bacteria 7769
437 Ga0495677_0009674 3300047445 Bacteria 3555
438 Ga0495677_0011299 3300047445 Bacteria 3268
439 Ga0495677_0013988 3300047445 Bacteria 2922
440 Ga0495677_0014000 3300047445 Bacteria 2921
441 Ga0495679_013706 3300047446 Bacteria 3030
442 Ga0495679_021904 3300047446 Bacteria 2196
443 Ga0495679_025502 3300047446 Bacteria 1975
444 Ga0495679_026872 3300047446 Bacteria 1905
445 Ga0495685_002912 3300047447 Bacteria 5413
446 Ga0495685_011151 3300047447 Bacteria 3027
447 Ga0495681_0002830 3300047470 Bacteria 12266
448 Ga0495681_0010387 3300047470 Bacteria 5636
449 Ga0495681_0013779 3300047470 Bacteria 4675
450 Ga0495681_0032029 3300047470 Bacteria 2651
451 Ga0495686_0000203 3300047472 Bacteria 110612
452 Ga0495593_0087535 3300047673 Bacteria 1606
453 Ga0495602_0001574 3300048088 Bacteria 22715
454 Ga0495614_0001855 3300048089 Bacteria 9257
455 Ga0495626_0000637 3300048091 Bacteria 34040
456 Ga0495626_0000962 3300048091 Bacteria 24986
457 Ga0495626_0003457 3300048091 Bacteria 10119
458 Ga0495626_0003520 3300048091 Bacteria 10023
459 Ga0495626_0005968 3300048091 Bacteria 7007
460 Ga0495626_0013908 3300048091 Bacteria 4168
461 Ga0495626_0018410 3300048091 Bacteria 3507
462 Ga0495626_0018875 3300048091 Bacteria 3453
463 Ga0495626_0056791 3300048091 Bacteria 1791
464 Ga0495626_0070339 3300048091 Bacteria 1574
465 Ga0496100_0100286 3300048903 Bacteria 1994
466 Ga0496101_0039684 3300048904 Bacteria 3350
467 Ga0496101_0136381 3300048904 Bacteria 1868
468 Ga0496102_0000712 3300048905 Bacteria 32911
469 Ga0496102_0043805 3300048905 Bacteria 4059
470 Ga0496102_0075891 3300048905 Bacteria 3090
471 Ga0496102_0096917 3300048905 Bacteria 2735
472 Ga0496102_0219976 3300048905 Bacteria 1790
473 Ga0496102_0447611 3300048905 Bacteria 1212
474 Ga0496103_0089480 3300048906 Bacteria 1942
475 Ga0496103_0118386 3300048906 Bacteria 1686
476 Ga0496103_0232619 3300048906 Bacteria 1186
477 Ga0496103_0317299 3300048906 Bacteria 1002
478 Ga0496103_0488804 3300048906 Bacteria 788
479 Ga0496105_0454200 3300048908 Bacteria 1011
480 Ga0496106_0012765 3300048909 Bacteria 6203
481 Ga0496107_0007741 3300048910 Bacteria 7422
482 Ga0496107_0112654 3300048910 Bacteria 2000
483 Ga0496109_0005686 3300048912 Bacteria 10435
484 Ga0496110_0000767 3300048913 Bacteria 22265
485 Ga0496112_0301939 3300048915 Bacteria 1546
486 Ga0496113_0006326 3300048916 Bacteria 7494
487 Ga0496113_0012906 3300048916 Bacteria 5634
488 Ga0496113_0164545 3300048916 Bacteria 1755
489 Ga0496115_0053756 3300048918 Bacteria 3233
490 Ga0496115_0869340 3300048918 Bacteria 697
491 Ga0496122_0000629 3300048925 Bacteria 71906
492 Ga0496122_0011703 3300048925 Bacteria 8842
493 Ga0496122_0017669 3300048925 Bacteria 6650
494 Ga0496123_0000099 3300048926 Bacteria 170756
495 Ga0496123_0002457 3300048926 Bacteria 22948
496 Ga0496124_0023465 3300048927 Bacteria 5631
497 Ga0496124_0037702 3300048927 Bacteria 4202
498 Ga0496124_0053693 3300048927 Bacteria 3414
499 Ga0496125_0010809 3300048928 Bacteria 9192
500 Ga0496125_0030806 3300048928 Bacteria 4792
501 Ga0496125_0454540 3300048928 Bacteria 733
502 Ga0495678_003171 3300049459 Bacteria 10366
503 Ga0495678_003430 3300049459 Bacteria 9823
504 Ga0495678_005043 3300049459 Bacteria 7429
505 Ga0495678_006039 3300049459 Bacteria 6523
506 Ga0495682_0001323 3300049460 Bacteria 13761
507 Ga0495682_0001764 3300049460 Bacteria 10927
508 Ga0501036_0032768 3300049572 Bacteria 4393
509 Ga0501042_0327635 3300049578 Bacteria 1107
510 Ga0501207_006248 3300049654 Bacteria 1667
511 Ga0501222_002662 3300049662 Bacteria 2471
512 Ga0501230_003102 3300049667 Bacteria 2178
513 Ga0501233_033191 3300049668 Bacteria 1178
514 Ga0501221_000900 3300049704 Bacteria 4870
515 Ga0501229_000252 3300049706 Bacteria 6033
516 Ga0501035_0001375 3300049822 Bacteria 25010
517 Ga0501044_0119946 3300049823 Bacteria 2632
518 Ga0501084_0684558 3300054114 Bacteria 865
519 Ga0466962_0103437 3300061719 Bacteria 1368

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049654 Ga0501207_006248 Ga0501207_006248_800_1396 194
2 3300046648 Ga0495611_0135526 Ga0495611_0135526_490_1119 197
3 3300005616 Ga0068852_100063749 Ga0068852_1000637493 198
4 3300026142 Ga0207698_10085401 Ga0207698_100854012 198
5 3300046457 Ga0495590_0000006 Ga0495590_0000006_261705_262433 198
6 3300046538 Ga0495609_0007091 Ga0495609_0007091_3384_4112 198
7 3300046616 Ga0495668_0000243 Ga0495668_0000243_3961_4689 198
8 3300046691 Ga0495670_0135666 Ga0495670_0135666_206_934 198
9 3300049459 Ga0495678_005043 Ga0495678_005043_3749_4477 198
10 3300047443 Ga0495687_001382 Ga0495687_001382_16036_16764 199
11 3300046528 Ga0495642_0000017 Ga0495642_0000017_18871_19506 200
12 3300046692 Ga0495671_0002017 Ga0495671_0002017_5747_6382 200
13 3300047445 Ga0495677_0009674 Ga0495677_0009674_341_976 200
14 3300046513 Ga0495616_0303873 Ga0495616_0303873_25_645 201
15 3300046616 Ga0495668_0450278 Ga0495668_0450278_76_681 201
16 3300046471 Ga0495650_0000108 Ga0495650_0000108_90521_91180 204
17 3300046500 Ga0495596_0104747 Ga0495596_0104747_234_893 204
18 3300046524 Ga0495648_0006050 Ga0495648_0006050_7844_8503 204
19 3300046538 Ga0495609_0001192 Ga0495609_0001192_10857_11516 204
20 3300046542 Ga0495597_0023065 Ga0495597_0023065_839_1486 204
21 3300047320 Ga0495672_0000530 Ga0495672_0000530_40285_40944 204
22 3300047323 Ga0495683_0009365 Ga0495683_0009365_3982_4641 204
23 3300047443 Ga0495687_052342 Ga0495687_052342_738_1385 204
24 3300046680 Ga0495646_0097728 Ga0495646_0097728_927_1673 205
25 3300031250 Ga0265331_10001540 Ga0265331_1000154011 207
26 3300031251 Ga0265327_10000012 Ga0265327_10000012245 207
27 3300039447 Ga0436361_1008129 Ga0436361_1008129_7253_7906 207
28 3300046458 Ga0495591_009562 Ga0495591_009562_364_987 207
29 3300046474 Ga0495605_0009889 Ga0495605_0009889_3521_4144 207
30 3300046491 Ga0495584_0038870 Ga0495584_0038870_439_1062 207
31 3300046492 Ga0495585_0284440 Ga0495585_0284440_26_649 207
32 3300046500 Ga0495596_0042755 Ga0495596_0042755_1137_1760 207
33 3300046501 Ga0495607_0004748 Ga0495607_0004748_5685_6353 207
34 3300046501 Ga0495607_0060957 Ga0495607_0060957_1343_1966 207
35 3300046507 Ga0495606_0000458 Ga0495606_0000458_62152_62820 207
36 3300046507 Ga0495606_0027196 Ga0495606_0027196_1585_2208 207
37 3300046513 Ga0495616_0028096 Ga0495616_0028096_1272_1895 207
38 3300046518 Ga0495631_0045182 Ga0495631_0045182_762_1385 207
39 3300046520 Ga0495637_0054178 Ga0495637_0054178_33_656 207
40 3300046523 Ga0495644_0011479 Ga0495644_0011479_614_1237 207
41 3300046538 Ga0495609_0023270 Ga0495609_0023270_1086_1709 207
42 3300046615 Ga0495656_0103944 Ga0495656_0103944_568_1191 207
43 3300046665 Ga0495661_0048296 Ga0495661_0048296_1938_2561 207
44 3300046684 Ga0495669_0061648 Ga0495669_0061648_520_1143 207
45 3300046691 Ga0495670_0029328 Ga0495670_0029328_362_985 207
46 3300046691 Ga0495670_0106328 Ga0495670_0106328_231_854 207
47 3300046694 Ga0495649_0012116 Ga0495649_0012116_75_698 207
48 3300046794 Ga0495589_0085195 Ga0495589_0085195_470_1093 207
49 3300046810 Ga0495660_0022073 Ga0495660_0022073_2572_3195 207
50 3300046810 Ga0495660_0186420 Ga0495660_0186420_137_760 207
51 3300047320 Ga0495672_0018223 Ga0495672_0018223_3632_4255 207
52 3300047323 Ga0495683_0066209 Ga0495683_0066209_443_1066 207
53 3300047443 Ga0495687_001246 Ga0495687_001246_7538_8266 207
54 3300047446 Ga0495679_025502 Ga0495679_025502_1012_1635 207
55 3300047447 Ga0495685_011151 Ga0495685_011151_1176_1799 207
56 3300047470 Ga0495681_0010387 Ga0495681_0010387_3613_4236 207
57 3300048091 Ga0495626_0070339 Ga0495626_0070339_472_1095 207
58 3300048906 Ga0496103_0118386 Ga0496103_0118386_758_1381 207
59 3300048916 Ga0496113_0164545 Ga0496113_0164545_20_643 207
60 3300048918 Ga0496115_0053756 Ga0496115_0053756_2348_2971 207
61 3300021361 Ga0213872_10000018 Ga0213872_10000018107 208
62 3300039447 Ga0436361_0677882 Ga0436361_0677882_116555_117205 208
63 3300044656 Ga0466969_0000007 Ga0466969_0000007_15270_15911 209
64 3300044684 Ga0466966_0023372 Ga0466966_0023372_58_699 209
65 3300044693 Ga0466961_0263541 Ga0466961_0263541_131_772 209
66 3300044765 Ga0466970_0472202 Ga0466970_0472202_36_677 209
67 3300046691 Ga0495670_0007477 Ga0495670_0007477_1049_1708 209
68 3300047443 Ga0495687_000052 Ga0495687_000052_173822_174475 209
69 3300048913 Ga0496110_0000767 Ga0496110_0000767_3789_4418 209
70 3300045049 Ga0466959_0221346 Ga0466959_0221346_213_845 210
71 3300037418 Ga0395900_0209857 Ga0395900_0209857_789_1424 211
72 3300037471 Ga0395905_0216512 Ga0395905_0216512_351_986 211
73 3300037471 Ga0395905_0613985 Ga0395905_0613985_330_965 211
74 3300046452 Ga0495617_000014 Ga0495617_000014_95663_96298 211
75 3300046453 Ga0495627_000780 Ga0495627_000780_5104_5739 211
76 3300046457 Ga0495590_0019679 Ga0495590_0019679_749_1384 211
77 3300046460 Ga0495638_0261994 Ga0495638_0261994_106_741 211
78 3300046474 Ga0495605_0000110 Ga0495605_0000110_78126_78761 211
79 3300046474 Ga0495605_0024258 Ga0495605_0024258_1474_2109 211
80 3300046500 Ga0495596_0004363 Ga0495596_0004363_2290_2925 211
81 3300046500 Ga0495596_0015447 Ga0495596_0015447_723_1358 211
82 3300046501 Ga0495607_0015621 Ga0495607_0015621_1349_1984 211
83 3300046501 Ga0495607_0015663 Ga0495607_0015663_86_721 211
84 3300046513 Ga0495616_0001119 Ga0495616_0001119_14278_14913 211
85 3300046513 Ga0495616_0085839 Ga0495616_0085839_740_1375 211
86 3300046518 Ga0495631_0006518 Ga0495631_0006518_4809_5444 211
87 3300046519 Ga0495632_0002478 Ga0495632_0002478_4935_5570 211
88 3300046520 Ga0495637_0089855 Ga0495637_0089855_278_913 211
89 3300046523 Ga0495644_0094592 Ga0495644_0094592_197_832 211
90 3300046524 Ga0495648_0003276 Ga0495648_0003276_4833_5468 211
91 3300046524 Ga0495648_0016175 Ga0495648_0016175_2546_3181 211
92 3300046525 Ga0495663_0037801 Ga0495663_0037801_306_941 211
93 3300046530 Ga0495654_0086512 Ga0495654_0086512_660_1295 211
94 3300046538 Ga0495609_0001988 Ga0495609_0001988_10331_10966 211
95 3300046538 Ga0495609_0016345 Ga0495609_0016345_36_671 211
96 3300046542 Ga0495597_0000653 Ga0495597_0000653_3477_4112 211
97 3300046542 Ga0495597_0003227 Ga0495597_0003227_2371_3006 211
98 3300046616 Ga0495668_0003115 Ga0495668_0003115_4827_5462 211
99 3300046665 Ga0495661_0007893 Ga0495661_0007893_2833_3468 211
100 3300046665 Ga0495661_0034514 Ga0495661_0034514_1393_2028 211
101 3300046665 Ga0495661_0115786 Ga0495661_0115786_351_986 211
102 3300046684 Ga0495669_0002258 Ga0495669_0002258_3562_4197 211
103 3300046794 Ga0495589_0001860 Ga0495589_0001860_3927_4562 211
104 3300046794 Ga0495589_0011402 Ga0495589_0011402_3074_3709 211
105 3300046810 Ga0495660_0022723 Ga0495660_0022723_1198_1833 211
106 3300047318 Ga0495636_0215854 Ga0495636_0215854_114_749 211
107 3300047323 Ga0495683_0058284 Ga0495683_0058284_112_747 211
108 3300047443 Ga0495687_004137 Ga0495687_004137_4934_5581 211
109 3300047446 Ga0495679_026872 Ga0495679_026872_122_757 211
110 3300047470 Ga0495681_0002830 Ga0495681_0002830_6145_6780 211
111 3300048905 Ga0496102_0000712 Ga0496102_0000712_27692_28327 211
112 3300048906 Ga0496103_0232619 Ga0496103_0232619_369_1004 211
113 3300048918 Ga0496115_0869340 Ga0496115_0869340_51_686 211
114 3300049459 Ga0495678_006039 Ga0495678_006039_1573_2208 211
115 3300005262 Ga0065165_1011896 Ga0065165_10118963 212
116 3300047472 Ga0495686_0000203 Ga0495686_0000203_23843_24490 212
117 3300049460 Ga0495682_0001764 Ga0495682_0001764_5848_6495 212
118 3300046453 Ga0495627_008384 Ga0495627_008384_1171_1818 213
119 3300046491 Ga0495584_0001874 Ga0495584_0001874_11373_12020 213
120 3300046492 Ga0495585_0013227 Ga0495585_0013227_3125_3772 213
121 3300046492 Ga0495585_0041458 Ga0495585_0041458_71_718 213
122 3300046500 Ga0495596_0008387 Ga0495596_0008387_725_1372 213
123 3300046507 Ga0495606_0017427 Ga0495606_0017427_4396_5043 213
124 3300046513 Ga0495616_0003638 Ga0495616_0003638_7535_8182 213
125 3300046518 Ga0495631_0018775 Ga0495631_0018775_1372_2019 213
126 3300046528 Ga0495642_0160874 Ga0495642_0160874_152_799 213
127 3300046542 Ga0495597_0004627 Ga0495597_0004627_3331_3978 213
128 3300046616 Ga0495668_0009838 Ga0495668_0009838_2906_3553 213
129 3300046660 Ga0495625_0209937 Ga0495625_0209937_563_1258 213
130 3300046665 Ga0495661_0016705 Ga0495661_0016705_3582_4277 213
131 3300046665 Ga0495661_0044558 Ga0495661_0044558_803_1450 213
132 3300046691 Ga0495670_0006150 Ga0495670_0006150_4047_4694 213
133 3300046692 Ga0495671_0003766 Ga0495671_0003766_3395_4066 213
134 3300046692 Ga0495671_0036337 Ga0495671_0036337_594_1241 213
135 3300047323 Ga0495683_0001825 Ga0495683_0001825_2405_3052 213
136 3300047445 Ga0495677_0011299 Ga0495677_0011299_1456_2103 213
137 3300026078 Ga0207702_10480140 Ga0207702_104801402 214
138 3300048927 Ga0496124_0053693 Ga0496124_0053693_657_1307 214
139 3300039447 Ga0436361_0726241 Ga0436361_0726241_149_820 215
140 3300046453 Ga0495627_017772 Ga0495627_017772_1124_1783 215
141 3300046491 Ga0495584_0109197 Ga0495584_0109197_565_1212 215
142 3300046492 Ga0495585_0013625 Ga0495585_0013625_2958_3617 215
143 3300046492 Ga0495585_0018244 Ga0495585_0018244_168_815 215
144 3300046500 Ga0495596_0011518 Ga0495596_0011518_2936_3595 215
145 3300046500 Ga0495596_0031492 Ga0495596_0031492_470_1129 215
146 3300046501 Ga0495607_0032073 Ga0495607_0032073_536_1183 215
147 3300046506 Ga0495583_0006145 Ga0495583_0006145_2886_3533 215
148 3300046513 Ga0495616_0004891 Ga0495616_0004891_3635_4294 215
149 3300046513 Ga0495616_0011234 Ga0495616_0011234_982_1629 215
150 3300046518 Ga0495631_0002058 Ga0495631_0002058_7812_8459 215
151 3300046518 Ga0495631_0012507 Ga0495631_0012507_2161_2820 215
152 3300046518 Ga0495631_0020790 Ga0495631_0020790_541_1200 215
153 3300046518 Ga0495631_0057090 Ga0495631_0057090_118_765 215
154 3300046519 Ga0495632_0002462 Ga0495632_0002462_6164_6823 215
155 3300046522 Ga0495643_0036268 Ga0495643_0036268_515_1174 215
156 3300046524 Ga0495648_0058121 Ga0495648_0058121_1414_2061 215
157 3300046524 Ga0495648_0058134 Ga0495648_0058134_925_1584 215
158 3300046542 Ga0495597_0021151 Ga0495597_0021151_1882_2529 215
159 3300046558 Ga0495633_0009542 Ga0495633_0009542_3287_3934 215
160 3300046616 Ga0495668_0003304 Ga0495668_0003304_8538_9197 215
161 3300046616 Ga0495668_0006221 Ga0495668_0006221_4270_4917 215
162 3300046616 Ga0495668_0011495 Ga0495668_0011495_3105_3764 215
163 3300046616 Ga0495668_0075398 Ga0495668_0075398_544_1191 215
164 3300046648 Ga0495611_0012589 Ga0495611_0012589_2709_3368 215
165 3300046648 Ga0495611_0050159 Ga0495611_0050159_233_880 215
166 3300046660 Ga0495625_0007902 Ga0495625_0007902_4308_4955 215
167 3300046665 Ga0495661_0000823 Ga0495661_0000823_6442_7089 215
168 3300046665 Ga0495661_0002650 Ga0495661_0002650_7007_7654 215
169 3300046691 Ga0495670_0006449 Ga0495670_0006449_1881_2528 215
170 3300046692 Ga0495671_0002196 Ga0495671_0002196_5191_5850 215
171 3300046694 Ga0495649_0030172 Ga0495649_0030172_1154_1813 215
172 3300046694 Ga0495649_0109994 Ga0495649_0109994_496_1155 215
173 3300046794 Ga0495589_0022637 Ga0495589_0022637_944_1603 215
174 3300046794 Ga0495589_0137136 Ga0495589_0137136_13_681 215
175 3300046810 Ga0495660_0009293 Ga0495660_0009293_3580_4239 215
176 3300046810 Ga0495660_0118582 Ga0495660_0118582_543_1190 215
177 3300046810 Ga0495660_0167086 Ga0495660_0167086_315_974 215
178 3300046810 Ga0495660_0243899 Ga0495660_0243899_137_805 215
179 3300047445 Ga0495677_0013988 Ga0495677_0013988_689_1336 215
180 3300047446 Ga0495679_013706 Ga0495679_013706_263_910 215
181 3300047447 Ga0495685_002912 Ga0495685_002912_1156_1803 215
182 3300047470 Ga0495681_0013779 Ga0495681_0013779_513_1160 215
183 3300047470 Ga0495681_0032029 Ga0495681_0032029_1966_2625 215
184 3300048091 Ga0495626_0003457 Ga0495626_0003457_7496_8155 215
185 3300048091 Ga0495626_0013908 Ga0495626_0013908_83_742 215
186 3300048903 Ga0496100_0100286 Ga0496100_0100286_1096_1743 215
187 3300048904 Ga0496101_0039684 Ga0496101_0039684_1186_1833 215
188 3300048905 Ga0496102_0219976 Ga0496102_0219976_998_1657 215
189 3300048912 Ga0496109_0005686 Ga0496109_0005686_5732_6379 215
190 3300048915 Ga0496112_0301939 Ga0496112_0301939_39_686 215
191 3300048916 Ga0496113_0012906 Ga0496113_0012906_1338_1985 215
192 3300048925 Ga0496122_0000629 Ga0496122_0000629_46235_46882 215
193 3300048926 Ga0496123_0000099 Ga0496123_0000099_163102_163749 215
194 3300048928 Ga0496125_0010809 Ga0496125_0010809_7586_8233 215
195 3300049459 Ga0495678_003171 Ga0495678_003171_5449_6108 215
196 3300049459 Ga0495678_003430 Ga0495678_003430_6271_6930 215
197 3300049460 Ga0495682_0001323 Ga0495682_0001323_7569_8228 215
198 3300046463 Ga0495653_0094383 Ga0495653_0094383_1405_2103 217
199 3300049823 Ga0501044_0119946 Ga0501044_0119946_1493_2146 217
200 3300054114 Ga0501084_0684558 Ga0501084_0684558_31_684 217
201 3300046492 Ga0495585_0009918 Ga0495585_0009918_3693_4388 218
202 3300046500 Ga0495596_0016613 Ga0495596_0016613_1406_2077 218
203 3300046506 Ga0495583_0126594 Ga0495583_0126594_272_967 218
204 3300046522 Ga0495643_0043812 Ga0495643_0043812_1085_1780 218
205 3300046528 Ga0495642_0027271 Ga0495642_0027271_1472_2167 218
206 3300046684 Ga0495669_0009259 Ga0495669_0009259_1290_1961 218
207 3300047443 Ga0495687_000085 Ga0495687_000085_117433_118128 218
208 3300048091 Ga0495626_0005968 Ga0495626_0005968_4795_5457 218
209 3300003791 Ga0055530_10029897 Ga0055530_100298972 219
210 3300003794 Ga0055531_10000381 Ga0055531_100003819 219
211 3300025298 Ga0209050_1005124 Ga0209050_10051243 219
212 3300025304 Ga0209257_1000117 Ga0209257_1000117102 219
213 3300044658 Ga0466972_0005938 Ga0466972_0005938_4926_5588 219
214 3300044706 Ga0466964_0063789 Ga0466964_0063789_462_1124 219
215 3300044735 Ga0466968_0000954 Ga0466968_0000954_5637_6299 219
216 3300044842 Ga0466957_0003769 Ga0466957_0003769_7047_7709 219
217 3300044901 Ga0466960_0013823 Ga0466960_0013823_1113_1775 219
218 3300046615 Ga0495656_0048550 Ga0495656_0048550_450_1130 219
219 3300046665 Ga0495661_0078143 Ga0495661_0078143_765_1445 219
220 3300046674 Ga0495588_0005310 Ga0495588_0005310_4017_4694 219
221 3300046691 Ga0495670_0008376 Ga0495670_0008376_1376_2056 219
222 3300047320 Ga0495672_0048405 Ga0495672_0048405_1358_2026 220
223 3300048928 Ga0496125_0030806 Ga0496125_0030806_3905_4573 221
224 3300021361 Ga0213872_10077866 Ga0213872_100778662 222
225 3300046507 Ga0495606_0088103 Ga0495606_0088103_587_1324 223
226 3300046536 Ga0495587_0053278 Ga0495587_0053278_176_910 223
227 3300046674 Ga0495588_0119401 Ga0495588_0119401_234_968 223
228 3300009036 Ga0105244_10001057 Ga0105244_100010578 224
229 3300025728 Ga0207655_1001365 Ga0207655_10013657 224
230 3300046507 Ga0495606_0000046 Ga0495606_0000046_146253_146930 224
231 3300046512 Ga0495610_0001713 Ga0495610_0001713_3780_4457 224
232 3300046519 Ga0495632_0000041 Ga0495632_0000041_135886_136581 224
233 3300046616 Ga0495668_0000148 Ga0495668_0000148_12517_13194 224
234 3300046665 Ga0495661_0015139 Ga0495661_0015139_3690_4385 224
235 3300046694 Ga0495649_0095505 Ga0495649_0095505_461_1138 224
236 3300046474 Ga0495605_0014861 Ga0495605_0014861_600_1307 225
237 3300046491 Ga0495584_0009274 Ga0495584_0009274_3555_4262 225
238 3300046492 Ga0495585_0312795 Ga0495585_0312795_11_718 225
239 3300046500 Ga0495596_0009330 Ga0495596_0009330_2624_3331 225
240 3300046501 Ga0495607_0020231 Ga0495607_0020231_2063_2770 225
241 3300046506 Ga0495583_0001075 Ga0495583_0001075_22295_23002 225
242 3300046518 Ga0495631_0016260 Ga0495631_0016260_702_1409 225
243 3300046519 Ga0495632_0002700 Ga0495632_0002700_9041_9748 225
244 3300046694 Ga0495649_0069214 Ga0495649_0069214_51_758 225
245 3300046794 Ga0495589_0080434 Ga0495589_0080434_705_1412 225
246 3300046810 Ga0495660_0036752 Ga0495660_0036752_769_1476 225
247 3300047320 Ga0495672_0010146 Ga0495672_0010146_3415_4122 225
248 3300047323 Ga0495683_0154024 Ga0495683_0154024_260_967 225
249 3300047446 Ga0495679_021904 Ga0495679_021904_1192_1899 225
250 3300046455 Ga0495603_0087722 Ga0495603_0087722_629_1360 226
251 3300046459 Ga0495629_0096104 Ga0495629_0096104_1052_1783 226
252 3300046473 Ga0495582_0000427 Ga0495582_0000427_6892_7623 226
253 3300046474 Ga0495605_0046885 Ga0495605_0046885_763_1494 226
254 3300046499 Ga0495594_0072680 Ga0495594_0072680_1052_1783 226
255 3300046506 Ga0495583_0199109 Ga0495583_0199109_38_769 226
256 3300046518 Ga0495631_0050182 Ga0495631_0050182_801_1532 226
257 3300046538 Ga0495609_0018109 Ga0495609_0018109_1160_1855 226
258 3300046557 Ga0495622_0069456 Ga0495622_0069456_140_871 226
259 3300046689 Ga0495613_0191216 Ga0495613_0191216_569_1300 226
260 3300046691 Ga0495670_0063835 Ga0495670_0063835_617_1348 226
261 3300047315 Ga0495581_0080588 Ga0495581_0080588_1138_1869 226
262 3300047673 Ga0495593_0087535 Ga0495593_0087535_180_911 226
263 3300048089 Ga0495614_0001855 Ga0495614_0001855_7475_8206 226
264 3300046474 Ga0495605_0024452 Ga0495605_0024452_701_1414 227
265 3300046694 Ga0495649_0003290 Ga0495649_0003290_6249_6962 227
266 3300047445 Ga0495677_0002172 Ga0495677_0002172_3799_4512 227
267 3300048091 Ga0495626_0018410 Ga0495626_0018410_509_1222 227
268 3300048091 Ga0495626_0018875 Ga0495626_0018875_218_931 227
269 3300048091 Ga0495626_0056791 Ga0495626_0056791_420_1133 227
270 iso_pu_bacteria 2643221556 2643796776 227
271 iso_pu_bacteria 2643221684 2644470119 227
272 iso_pu_bacteria 8047673197 8047676964 227
273 3300003322 rootL2_10024668 rootL2_100246683 228
274 3300003759 Ga0055525_1000006 Ga0055525_1000006324 228
275 3300005262 Ga0065165_1022592 Ga0065165_10225923 228
276 3300005327 Ga0070658_10042494 Ga0070658_100424943 228
277 3300005339 Ga0070660_100486769 Ga0070660_1004867691 228
278 3300005366 Ga0070659_100014912 Ga0070659_1000149124 228
279 3300005366 Ga0070659_100054413 Ga0070659_1000544131 228
280 3300005457 Ga0070662_100240484 Ga0070662_1002404841 228
281 3300005563 Ga0068855_100360955 Ga0068855_1003609553 228
282 3300005564 Ga0070664_100069110 Ga0070664_1000691104 228
283 3300005564 Ga0070664_100275872 Ga0070664_1002758722 228
284 3300009098 Ga0105245_10487020 Ga0105245_104870202 228
285 3300009148 Ga0105243_10167199 Ga0105243_101671992 228
286 3300009551 Ga0105238_10381757 Ga0105238_103817572 228
287 3300010375 Ga0105239_10116292 Ga0105239_101162924 228
288 3300011119 Ga0105246_10108918 Ga0105246_101089182 228
289 3300013105 Ga0157369_10997828 Ga0157369_109978281 228
290 3300013307 Ga0157372_10338393 Ga0157372_103383932 228
291 3300025230 Ga0209563_100022 Ga0209563_100022322 228
292 3300025253 Ga0209677_101675 Ga0209677_1016757 228
293 3300025909 Ga0207705_10160197 Ga0207705_101601972 228
294 3300025913 Ga0207695_10434172 Ga0207695_104341722 228
295 3300025919 Ga0207657_10028267 Ga0207657_100282674 228
296 3300025920 Ga0207649_10296175 Ga0207649_102961752 228
297 3300025932 Ga0207690_10033805 Ga0207690_100338051 228
298 3300025932 Ga0207690_10065047 Ga0207690_100650471 228
299 3300025933 Ga0207706_10082359 Ga0207706_100823593 228
300 3300025933 Ga0207706_10130199 Ga0207706_101301991 228
301 3300025934 Ga0207686_10207439 Ga0207686_102074392 228
302 3300025934 Ga0207686_10490247 Ga0207686_104902471 228
303 3300025935 Ga0207709_10101567 Ga0207709_101015673 228
304 3300025945 Ga0207679_10101077 Ga0207679_101010773 228
305 3300026089 Ga0207648_10391250 Ga0207648_103912502 228
306 3300037312 Ga0395899_0009427 Ga0395899_0009427_3234_3935 228
307 3300037312 Ga0395899_0013898 Ga0395899_0013898_3282_3983 228
308 3300037312 Ga0395899_0085535 Ga0395899_0085535_968_1669 228
309 3300037418 Ga0395900_0000600 Ga0395900_0000600_42459_43160 228
310 3300037418 Ga0395900_0002248 Ga0395900_0002248_6582_7274 228
311 3300037418 Ga0395900_0012205 Ga0395900_0012205_5323_6024 228
312 3300037418 Ga0395900_0013824 Ga0395900_0013824_4792_5493 228
313 3300037418 Ga0395900_0022519 Ga0395900_0022519_3428_4129 228
314 3300037418 Ga0395900_0175798 Ga0395900_0175798_438_1139 228
315 3300037418 Ga0395900_0270906 Ga0395900_0270906_952_1653 228
316 3300037418 Ga0395900_0798256 Ga0395900_0798256_106_807 228
317 3300037466 Ga0395898_0025962 Ga0395898_0025962_2060_2761 228
318 3300037466 Ga0395898_0618811 Ga0395898_0618811_158_859 228
319 3300037471 Ga0395905_0049473 Ga0395905_0049473_1070_1771 228
320 3300037471 Ga0395905_0571161 Ga0395905_0571161_290_991 228
321 3300038443 Ga0395901_0000527 Ga0395901_0000527_14872_15573 228
322 3300038443 Ga0395901_0020093 Ga0395901_0020093_4792_5493 228
323 3300038443 Ga0395901_0044346 Ga0395901_0044346_3782_4483 228
324 3300038443 Ga0395901_0216779 Ga0395901_0216779_161_862 228
325 3300038443 Ga0395901_0550353 Ga0395901_0550353_179_880 228
326 3300042005 Ga0439448_0000705 Ga0439448_0000705_5721_6425 228
327 3300042005 Ga0439448_0045872 Ga0439448_0045872_686_1387 228
328 3300042005 Ga0439448_0159174 Ga0439448_0159174_23_724 228
329 3300042008 Ga0439450_048737 Ga0439450_048737_209_910 228
330 3300042012 Ga0439455_0002445 Ga0439455_0002445_1269_1973 228
331 3300042012 Ga0439455_0007397 Ga0439455_0007397_148_849 228
332 3300042012 Ga0439455_0082935 Ga0439455_0082935_144_845 228
333 3300042157 Ga0439458_0007751 Ga0439458_0007751_1316_2017 228
334 3300042157 Ga0439458_0010382 Ga0439458_0010382_11_712 228
335 3300044684 Ga0466966_0004210 Ga0466966_0004210_1398_2099 228
336 3300044684 Ga0466966_0078300 Ga0466966_0078300_79_780 228
337 3300044684 Ga0466966_0203483 Ga0466966_0203483_98_799 228
338 3300044694 Ga0466963_0284196 Ga0466963_0284196_95_796 228
339 3300044706 Ga0466964_0000759 Ga0466964_0000759_5886_6587 228
340 3300044706 Ga0466964_0104969 Ga0466964_0104969_128_829 228
341 3300044719 Ga0466971_0165469 Ga0466971_0165469_194_895 228
342 3300044735 Ga0466968_0216447 Ga0466968_0216447_46_747 228
343 3300044842 Ga0466957_0174227 Ga0466957_0174227_475_1176 228
344 3300045049 Ga0466959_0036851 Ga0466959_0036851_777_1478 228
345 3300045049 Ga0466959_0064019 Ga0466959_0064019_1897_2598 228
346 3300045836 Ga0466958_0035281 Ga0466958_0035281_133_834 228
347 3300045836 Ga0466958_0071792 Ga0466958_0071792_1061_1762 228
348 3300045836 Ga0466958_0104601 Ga0466958_0104601_193_894 228
349 3300045836 Ga0466958_0411393 Ga0466958_0411393_53_754 228
350 3300045976 Ga0466967_0037968 Ga0466967_0037968_3393_4094 228
351 3300045976 Ga0466967_0144204 Ga0466967_0144204_941_1642 228
352 3300046463 Ga0495653_0001765 Ga0495653_0001765_15028_15762 228
353 3300046473 Ga0495582_0032136 Ga0495582_0032136_755_1495 228
354 3300046474 Ga0495605_0000118 Ga0495605_0000118_76838_77539 228
355 3300046491 Ga0495584_0002423 Ga0495584_0002423_7313_8014 228
356 3300046492 Ga0495585_0059188 Ga0495585_0059188_461_1192 228
357 3300046499 Ga0495594_0019250 Ga0495594_0019250_2209_2943 228
358 3300046500 Ga0495596_0011795 Ga0495596_0011795_1138_1869 228
359 3300046501 Ga0495607_0005340 Ga0495607_0005340_735_1466 228
360 3300046501 Ga0495607_0005448 Ga0495607_0005448_7411_8112 228
361 3300046501 Ga0495607_0020905 Ga0495607_0020905_995_1696 228
362 3300046501 Ga0495607_0227282 Ga0495607_0227282_44_745 228
363 3300046507 Ga0495606_0012627 Ga0495606_0012627_4152_4853 228
364 3300046513 Ga0495616_0010672 Ga0495616_0010672_1969_2670 228
365 3300046513 Ga0495616_0024955 Ga0495616_0024955_2025_2756 228
366 3300046513 Ga0495616_0076819 Ga0495616_0076819_109_810 228
367 3300046517 Ga0495630_0060588 Ga0495630_0060588_19_759 228
368 3300046522 Ga0495643_0003305 Ga0495643_0003305_4259_4960 228
369 3300046522 Ga0495643_0033227 Ga0495643_0033227_1234_1935 228
370 3300046524 Ga0495648_0006756 Ga0495648_0006756_7486_8187 228
371 3300046526 Ga0495666_0061475 Ga0495666_0061475_486_1220 228
372 3300046528 Ga0495642_0004962 Ga0495642_0004962_3437_4138 228
373 3300046529 Ga0495652_0052272 Ga0495652_0052272_2369_3109 228
374 3300046557 Ga0495622_0003590 Ga0495622_0003590_3679_4386 228
375 3300046558 Ga0495633_0094473 Ga0495633_0094473_365_1096 228
376 3300046615 Ga0495656_0132386 Ga0495656_0132386_445_1146 228
377 3300046665 Ga0495661_0004591 Ga0495661_0004591_7401_8102 228
378 3300046665 Ga0495661_0069716 Ga0495661_0069716_236_937 228
379 3300046665 Ga0495661_0148578 Ga0495661_0148578_407_1108 228
380 3300046674 Ga0495588_0000126 Ga0495588_0000126_94848_95549 228
381 3300046694 Ga0495649_0008451 Ga0495649_0008451_3789_4490 228
382 3300046794 Ga0495589_0000136 Ga0495589_0000136_57330_58031 228
383 3300046809 Ga0495600_0233881 Ga0495600_0233881_344_1084 228
384 3300046810 Ga0495660_0000068 Ga0495660_0000068_17504_18205 228
385 3300046810 Ga0495660_0033085 Ga0495660_0033085_1121_1822 228
386 3300047317 Ga0495604_0027158 Ga0495604_0027158_3599_4333 228
387 3300047320 Ga0495672_0000631 Ga0495672_0000631_4195_4896 228
388 3300047320 Ga0495672_0000870 Ga0495672_0000870_6254_6961 228
389 3300047323 Ga0495683_0005255 Ga0495683_0005255_5358_6059 228
390 3300047323 Ga0495683_0012643 Ga0495683_0012643_642_1373 228
391 3300047443 Ga0495687_001520 Ga0495687_001520_10716_11417 228
392 3300047443 Ga0495687_001746 Ga0495687_001746_5211_5912 228
393 3300047445 Ga0495677_0001467 Ga0495677_0001467_7010_7711 228
394 3300047445 Ga0495677_0014000 Ga0495677_0014000_504_1205 228
395 3300048091 Ga0495626_0000637 Ga0495626_0000637_6117_6833 228
396 3300048091 Ga0495626_0000962 Ga0495626_0000962_14573_15274 228
397 3300048904 Ga0496101_0136381 Ga0496101_0136381_530_1231 228
398 3300048905 Ga0496102_0075891 Ga0496102_0075891_2148_2849 228
399 3300048905 Ga0496102_0096917 Ga0496102_0096917_195_896 228
400 3300048905 Ga0496102_0447611 Ga0496102_0447611_152_853 228
401 3300048906 Ga0496103_0089480 Ga0496103_0089480_510_1211 228
402 3300048906 Ga0496103_0488804 Ga0496103_0488804_35_736 228
403 3300048909 Ga0496106_0012765 Ga0496106_0012765_2728_3429 228
404 3300048910 Ga0496107_0007741 Ga0496107_0007741_854_1555 228
405 3300048916 Ga0496113_0006326 Ga0496113_0006326_1129_1830 228
406 3300048925 Ga0496122_0011703 Ga0496122_0011703_5900_6601 228
407 3300048925 Ga0496122_0017669 Ga0496122_0017669_5937_6638 228
408 3300048926 Ga0496123_0002457 Ga0496123_0002457_15893_16594 228
409 3300048927 Ga0496124_0023465 Ga0496124_0023465_3369_4070 228
410 3300048927 Ga0496124_0037702 Ga0496124_0037702_1134_1835 228
411 3300048928 Ga0496125_0454540 Ga0496125_0454540_22_723 228
412 3300049822 Ga0501035_0001375 Ga0501035_0001375_21329_22030 228
413 3300025254 Ga0209148_1000585 Ga0209148_10005853 229
414 3300037418 Ga0395900_0071136 Ga0395900_0071136_870_1589 229
415 3300037471 Ga0395905_0085717 Ga0395905_0085717_1010_1729 229
416 3300041452 Ga0451793_1621807 Ga0451793_1621807_356_1054 230
417 3300042005 Ga0439448_0000130 Ga0439448_0000130_3488_4183 230
418 3300042007 Ga0439449_0053979 Ga0439449_0053979_564_1259 230
419 3300046491 Ga0495584_0009021 Ga0495584_0009021_230_931 230
420 3300046501 Ga0495607_0004432 Ga0495607_0004432_4412_5113 230
421 3300046513 Ga0495616_0000088 Ga0495616_0000088_5039_5740 230
422 3300046528 Ga0495642_0003740 Ga0495642_0003740_5139_5858 230
423 3300046528 Ga0495642_0017269 Ga0495642_0017269_2007_2708 230
424 3300046528 Ga0495642_0092936 Ga0495642_0092936_91_798 230
425 3300046538 Ga0495609_0000009 Ga0495609_0000009_39490_40191 230
426 3300046615 Ga0495656_0012666 Ga0495656_0012666_1838_2539 230
427 3300046616 Ga0495668_0005025 Ga0495668_0005025_5586_6305 230
428 3300046665 Ga0495661_0000032 Ga0495661_0000032_114205_114906 230
429 3300046679 Ga0495623_0014452 Ga0495623_0014452_1281_2003 230
430 3300046794 Ga0495589_0000049 Ga0495589_0000049_6394_7095 230
431 3300046794 Ga0495589_0008867 Ga0495589_0008867_1650_2369 230
432 3300047320 Ga0495672_0006431 Ga0495672_0006431_726_1445 230
433 3300047443 Ga0495687_000024 Ga0495687_000024_126541_127242 230
434 3300047444 Ga0495675_0078123 Ga0495675_0078123_1203_1931 230
435 3300047445 Ga0495677_0000018 Ga0495677_0000018_114259_114960 230
436 3300049578 Ga0501042_0327635 Ga0501042_0327635_292_987 230
437 3300046457 Ga0495590_0001082 Ga0495590_0001082_7876_8610 232
438 3300046660 Ga0495625_0014424 Ga0495625_0014424_975_1706 232
439 3300048088 Ga0495602_0001574 Ga0495602_0001574_15164_15898 232
440 3300049572 Ga0501036_0032768 Ga0501036_0032768_17_721 232
441 3300011119 Ga0105246_10827440 Ga0105246_108274401 235
442 3300046660 Ga0495625_0016754 Ga0495625_0016754_4998_5723 235
443 3300005327 Ga0070658_10026667 Ga0070658_100266673 236
444 3300005327 Ga0070658_10133909 Ga0070658_101339092 236
445 3300005339 Ga0070660_100001131 Ga0070660_1000011319 236
446 3300005366 Ga0070659_100086321 Ga0070659_1000863213 236
447 3300005457 Ga0070662_100173360 Ga0070662_1001733603 236
448 3300005563 Ga0068855_100012116 Ga0068855_10001211610 236
449 3300005564 Ga0070664_100002839 Ga0070664_1000028395 236
450 3300005564 Ga0070664_100055972 Ga0070664_1000559723 236
451 3300005564 Ga0070664_100358493 Ga0070664_1003584932 236
452 3300005616 Ga0068852_100710427 Ga0068852_1007104272 236
453 3300006237 Ga0097621_100380705 Ga0097621_1003807052 236
454 3300006358 Ga0068871_100322306 Ga0068871_1003223062 236
455 3300009148 Ga0105243_10060322 Ga0105243_100603223 236
456 3300009176 Ga0105242_10026891 Ga0105242_100268913 236
457 3300009545 Ga0105237_10388936 Ga0105237_103889361 236
458 3300014969 Ga0157376_10372945 Ga0157376_103729451 236
459 3300015262 Ga0182007_10107836 Ga0182007_101078361 236
460 3300025909 Ga0207705_10000223 Ga0207705_1000022333 236
461 3300025909 Ga0207705_10088477 Ga0207705_100884773 236
462 3300025919 Ga0207657_10011356 Ga0207657_100113563 236
463 3300025924 Ga0207694_10524844 Ga0207694_105248442 236
464 3300025932 Ga0207690_10069123 Ga0207690_100691233 236
465 3300025933 Ga0207706_10102626 Ga0207706_101026263 236
466 3300025933 Ga0207706_10197186 Ga0207706_101971862 236
467 3300025934 Ga0207686_10013226 Ga0207686_100132263 236
468 3300025945 Ga0207679_10117391 Ga0207679_101173912 236
469 3300025945 Ga0207679_10128465 Ga0207679_101284652 236
470 3300025945 Ga0207679_10571212 Ga0207679_105712122 236
471 3300025949 Ga0207667_10006615 Ga0207667_1000661510 236
472 3300026116 Ga0207674_10362160 Ga0207674_103621602 236
473 3300026142 Ga0207698_10420763 Ga0207698_104207632 236
474 3300037312 Ga0395899_0001188 Ga0395899_0001188_10555_11280 236
475 3300037312 Ga0395899_0007019 Ga0395899_0007019_5331_6056 236
476 3300037418 Ga0395900_0000497 Ga0395900_0000497_24296_25021 236
477 3300037418 Ga0395900_0001987 Ga0395900_0001987_15589_16314 236
478 3300037466 Ga0395898_0005084 Ga0395898_0005084_12256_12981 236
479 3300037466 Ga0395898_0141584 Ga0395898_0141584_1183_1908 236
480 3300037471 Ga0395905_0016771 Ga0395905_0016771_181_906 236
481 3300037471 Ga0395905_0102436 Ga0395905_0102436_509_1234 236
482 3300038443 Ga0395901_0025173 Ga0395901_0025173_3827_4552 236
483 3300038443 Ga0395901_0039956 Ga0395901_0039956_2052_2777 236
484 3300042005 Ga0439448_0016699 Ga0439448_0016699_445_1170 236
485 3300044683 Ga0466965_0006317 Ga0466965_0006317_109_834 236
486 3300044684 Ga0466966_0019471 Ga0466966_0019471_2830_3555 236
487 3300044694 Ga0466963_0003457 Ga0466963_0003457_5677_6402 236
488 3300044842 Ga0466957_0000005 Ga0466957_0000005_28894_29619 236
489 3300044842 Ga0466957_0017236 Ga0466957_0017236_3031_3756 236
490 3300045049 Ga0466959_0019207 Ga0466959_0019207_2349_3074 236
491 3300045976 Ga0466967_0026590 Ga0466967_0026590_1290_2015 236
492 3300048908 Ga0496105_0454200 Ga0496105_0454200_50_775 236
493 3300061719 Ga0466962_0103437 Ga0466962_0103437_88_813 236
494 3300003759 Ga0055525_1000028 Ga0055525_100002818 237
495 3300005339 Ga0070660_100099096 Ga0070660_1000990963 237
496 3300005457 Ga0070662_100080773 Ga0070662_1000807732 237
497 3300005530 Ga0070679_100605407 Ga0070679_1006054071 237
498 3300013307 Ga0157372_10288261 Ga0157372_102882612 237
499 3300025230 Ga0209563_100011 Ga0209563_100011292 237
500 3300025253 Ga0209677_103102 Ga0209677_1031025 237
501 3300025919 Ga0207657_10004042 Ga0207657_100040428 237
502 3300025921 Ga0207652_10724460 Ga0207652_107244602 237
503 3300025933 Ga0207706_10124924 Ga0207706_101249242 237
504 3300037312 Ga0395899_0028424 Ga0395899_0028424_1706_2434 237
505 3300037418 Ga0395900_0000307 Ga0395900_0000307_54058_54786 237
506 3300037418 Ga0395900_0224154 Ga0395900_0224154_297_1025 237
507 3300048091 Ga0495626_0003520 Ga0495626_0003520_4738_5472 237
508 3300048905 Ga0496102_0043805 Ga0496102_0043805_2338_3066 237
509 3300048906 Ga0496103_0317299 Ga0496103_0317299_39_767 237
510 3300048910 Ga0496107_0112654 Ga0496107_0112654_375_1103 237
511 3300003316 rootH1_10014334 rootH1_100143345 238
512 3300003322 rootL2_10003893 rootL2_1000389312 238
513 3300005337 Ga0070682_100235410 Ga0070682_1002354103 238
514 3300005564 Ga0070664_100571080 Ga0070664_1005710801 238
515 3300013307 Ga0157372_10203018 Ga0157372_102030183 238
516 3300025945 Ga0207679_10270406 Ga0207679_102704062 238
517 3300037471 Ga0395905_0039956 Ga0395905_0039956_2208_2933 238
518 3300049662 Ga0501222_002662 Ga0501222_002662_866_1582 238
519 3300049667 Ga0501230_003102 Ga0501230_003102_603_1340 238
520 3300049668 Ga0501233_033191 Ga0501233_033191_300_1016 238
521 3300049704 Ga0501221_000900 Ga0501221_000900_2826_3542 238
522 3300049706 Ga0501229_000252 Ga0501229_000252_3435_4151 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01618

MotA_ExbB

MotA/TolQ/ExbB proton channel family

92

215

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6tz4-assembly1.cif.gz_JB cryoem reconstruction of membrane-bound escrt-iii filament composed of chmp1b+ist1 (right-handed) 0.7894 122 220
8odt-assembly1.cif.gz_E structure of tolqr complex from e.coli 0.7769 20 222
5sv0-assembly2.cif.gz_J structure of the exbb/exbd complex from e. coli at ph 7.0 0.7156 34 221
6tyi-assembly1.cif.gz_D exbb-exbd complex in msp1e3d1 nanodisc 0.712 21 221
6ye4-assembly1.cif.gz_C structure of exbb pentamer from serratia marcescens by single particle cryo electron microscopy 0.6952 21 221
ID Description Score Start End Superfamily
1c0vA00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.6102 130 200 1.20.20.10
af_D3ZX38_7_121_1.10.287.370 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.6001 119 217 1.10.287.370
af_A0A2R8QSC2_1_189_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5714 126 194 1.20.140.150
af_P09348_118_240_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.5692 94 214 1.20.58.220
af_K7MIZ8_1_105_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.567 118 216 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A0Q5CR93-F1-model_v4 MotA/TolQ/ExbB proton channel domain-containing protein 0.9761 19 226 GO:0005886
GO:0017038
AF-A0A257SFI2-F1-model_v4 Flagellar motor protein MotA 0.9668 26 201 GO:0005886
GO:0017038
AF-A0A1V6DBH7-F1-model_v4 Biopolymer transport protein ExbB 0.9644 26 227 GO:0005886
GO:0017038
AF-A0A6J4YN35-F1-model_v4 MotA/TolQ/ExbB proton channel family protein 0.9609 31 218 GO:0005886
GO:0017038
AF-G0JMZ8-F1-model_v4 MotA/TolQ/ExbB proton channel 0.9606 26 222 GO:0005886
GO:0017038

Feature Viewer

pLDDT pTM Quality
80.04 0.71 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map