F458818

General Info

Members Datasets Scaffolds Average Seq Length
522 251 1044 155

Family's Representative Sequence

Representative Sequence 3300005546|Ga0070696_100159744|Ga0070696_1001597442
Length 157
Sequence MSKETLPLPLDYSAIERILPHRYPFLLVDRITEFEPDKRIVGVKNVSLNERNLAHPPEGGAPVLPPTILTEAVAQVGAIMILSKPENQQKLIFFMGIEKVRFRRPVHPGDVVVIEAEVKRLRSRMGVLRGVARVAGEVVVEGTMTFALGPRGSQPDE

Samples

Sample ID Description Type Environment
1 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
159 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
160 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
163 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
168 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
169 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
170 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
171 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
172 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
173 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
179 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
180 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
181 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
182 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
193 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
194 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
195 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
211 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
216 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
217 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
218 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
219 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
220 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
223 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
224 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
225 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
228 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
229 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
230 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
243 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
244 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
245 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
250 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.73
Nodule 0
Rhizoplane 4.98
Rhizosphere 83.91
Stem 0
Stem Tuber 0
Unclassified 5.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070696_100159744 3300005546 Bacteria 1660
2 Ga0065712_10234455 3300005290 Bacteria 1002
3 Ga0065715_10005177 3300005293 Bacteria 3420
4 Ga0065715_10059396 3300005293 Bacteria 1241
5 Ga0065715_10113613 3300005293 Bacteria 2469
6 Ga0065715_10151584 3300005293 Bacteria 1723
7 Ga0065715_10548209 3300005293 Bacteria 743
8 Ga0070676_10041032 3300005328 Bacteria 2682
9 Ga0070683_100021775 3300005329 Bacteria 5722
10 Ga0070690_100081056 3300005330 Bacteria 2123
11 Ga0070690_100290061 3300005330 Bacteria 1170
12 Ga0070670_100025533 3300005331 Bacteria 5082
13 Ga0070670_100027586 3300005331 Bacteria 4884
14 Ga0070677_10252756 3300005333 Bacteria 876
15 Ga0068869_100069903 3300005334 Bacteria 2597
16 Ga0068869_100667291 3300005334 Bacteria 884
17 Ga0068869_101091816 3300005334 Bacteria 698
18 Ga0070666_10059643 3300005335 Bacteria 2581
19 Ga0070666_10163941 3300005335 Bacteria 1554
20 Ga0070666_10209582 3300005335 Bacteria 1372
21 Ga0068868_100159056 3300005338 Bacteria 1864
22 Ga0068868_100289001 3300005338 Bacteria 1390
23 Ga0068868_100764578 3300005338 Bacteria 869
24 Ga0070660_101536541 3300005339 Bacteria 566
25 Ga0070687_100106176 3300005343 Bacteria 1581
26 Ga0070687_100359718 3300005343 Bacteria 942
27 Ga0070668_100301925 3300005347 Bacteria 1343
28 Ga0070669_100700667 3300005353 Bacteria 855
29 Ga0070669_100800260 3300005353 Bacteria 801
30 Ga0070675_100249104 3300005354 Bacteria 1554
31 Ga0070675_100329297 3300005354 Bacteria 1351
32 Ga0070671_100048718 3300005355 Bacteria 3524
33 Ga0070671_100059818 3300005355 Bacteria 3171
34 Ga0070671_100108083 3300005355 Bacteria 2336
35 Ga0070674_100315805 3300005356 Bacteria 1251
36 Ga0070674_100336507 3300005356 Unclassified 1215
37 Ga0070674_100795868 3300005356 Bacteria 816
38 Ga0070673_100049700 3300005364 Bacteria 3275
39 Ga0070673_100428778 3300005364 Bacteria 1187
40 Ga0070673_100491401 3300005364 Bacteria 1109
41 Ga0070688_100642511 3300005365 Bacteria 816
42 Ga0070659_100092298 3300005366 Bacteria 2428
43 Ga0070659_100787631 3300005366 Bacteria 826
44 Ga0070667_100040793 3300005367 Bacteria 3893
45 Ga0070667_100101297 3300005367 Bacteria 2488
46 Ga0070667_100156037 3300005367 Bacteria 2008
47 Ga0070667_100220469 3300005367 Bacteria 1688
48 Ga0070667_100956645 3300005367 Bacteria 798
49 Ga0070701_10011115 3300005438 Bacteria 4009
50 Ga0070701_10392998 3300005438 Bacteria 877
51 Ga0070705_100040613 3300005440 Bacteria 2647
52 Ga0070700_100089032 3300005441 Bacteria 2010
53 Ga0070694_100965829 3300005444 Bacteria 706
54 Ga0070708_101308280 3300005445 Bacteria 677
55 Ga0070663_100050607 3300005455 Bacteria 2956
56 Ga0070678_100199855 3300005456 Bacteria 1649
57 Ga0070678_100206725 3300005456 Bacteria 1624
58 Ga0070662_100700016 3300005457 Bacteria 857
59 Ga0070662_100814631 3300005457 Bacteria 794
60 Ga0068867_100007269 3300005459 Bacteria 7833
61 Ga0068867_100357193 3300005459 Bacteria 1221
62 Ga0068867_100458251 3300005459 Bacteria 1088
63 Ga0068867_100918908 3300005459 Bacteria 789
64 Ga0070706_100319873 3300005467 Bacteria 1447
65 Ga0070706_100610997 3300005467 Bacteria 1013
66 Ga0070706_100847520 3300005467 Bacteria 845
67 Ga0070684_100006516 3300005535 Bacteria 9039
68 Ga0068853_100719416 3300005539 Unclassified 953
69 Ga0070672_100072625 3300005543 Bacteria 2740
70 Ga0070672_100853316 3300005543 Bacteria 803
71 Ga0070686_100035949 3300005544 Bacteria 3063
72 Ga0070686_100065636 3300005544 Bacteria 2358
73 Ga0070693_100059765 3300005547 Bacteria 2210
74 Ga0070665_100012125 3300005548 Bacteria 8697
75 Ga0070665_100016273 3300005548 Bacteria 7462
76 Ga0070665_100022961 3300005548 Bacteria 6282
77 Ga0070704_100033633 3300005549 Bacteria 3468
78 Ga0068855_101147603 3300005563 Bacteria 810
79 Ga0068855_101528310 3300005563 Bacteria 685
80 Ga0070664_100004425 3300005564 Bacteria 11288
81 Ga0070664_100210895 3300005564 Bacteria 1736
82 Ga0068854_100017348 3300005578 Bacteria 4817
83 Ga0070702_100015240 3300005615 Bacteria 3920
84 Ga0070702_100032901 3300005615 Bacteria 2848
85 Ga0070702_100067859 3300005615 Unclassified 2097
86 Ga0068852_100242662 3300005616 Bacteria 1723
87 Ga0068859_100156793 3300005617 Bacteria 2354
88 Ga0068859_100159723 3300005617 Bacteria 2333
89 Ga0068859_100706856 3300005617 Bacteria 1098
90 Ga0068864_100279695 3300005618 Bacteria 1557
91 Ga0068864_100673611 3300005618 Bacteria 1009
92 Ga0068866_10123569 3300005718 Bacteria 1462
93 Ga0068861_100101990 3300005719 Bacteria 2284
94 Ga0068861_100110876 3300005719 Bacteria 2198
95 Ga0068861_100148743 3300005719 Bacteria 1919
96 Ga0068861_100171440 3300005719 Bacteria 1799
97 Ga0068861_100343679 3300005719 Bacteria 1307
98 Ga0068870_10218164 3300005840 Bacteria 1166
99 Ga0068863_100559435 3300005841 Bacteria 1130
100 Ga0068858_100031397 3300005842 Bacteria 4934
101 Ga0068858_100154978 3300005842 Bacteria 2155
102 Ga0068858_100230704 3300005842 Bacteria 1755
103 Ga0068858_101080465 3300005842 Bacteria 787
104 Ga0068858_101096391 3300005842 Bacteria 782
105 Ga0068860_100097046 3300005843 Bacteria 2810
106 Ga0068860_100155914 3300005843 Bacteria 2200
107 Ga0075365_10000240 3300006038 Bacteria 18779
108 Ga0075365_10029023 3300006038 Bacteria 3531
109 Ga0075365_10339292 3300006038 Bacteria 1059
110 Ga0075365_10740334 3300006038 Bacteria 694
111 Ga0075368_10006477 3300006042 Bacteria 4092
112 Ga0075368_10016255 3300006042 Unclassified 2774
113 Ga0075368_10032501 3300006042 Bacteria 2027
114 Ga0075364_10003042 3300006051 Bacteria 9472
115 Ga0075364_10005552 3300006051 Bacteria 7346
116 Ga0075364_10047798 3300006051 Bacteria 2788
117 Ga0075367_10011405 3300006178 Bacteria 4701
118 Ga0075367_10029698 3300006178 Bacteria 3130
119 Ga0075367_10306046 3300006178 Bacteria 1001
120 Ga0075367_10562137 3300006178 Bacteria 724
121 Ga0075369_10037958 3300006186 Bacteria 2054
122 Ga0075366_10011051 3300006195 Bacteria 5084
123 Ga0075366_10013665 3300006195 Bacteria 4628
124 Ga0075366_10020514 3300006195 Bacteria 3835
125 Ga0075366_10132836 3300006195 Bacteria 1502
126 Ga0075366_10286074 3300006195 Bacteria 1008
127 Ga0097621_100102712 3300006237 Bacteria 2407
128 Ga0097621_100404936 3300006237 Bacteria 1222
129 Ga0097621_101602251 3300006237 Bacteria 619
130 Ga0075370_10012996 3300006353 Bacteria 4416
131 Ga0075370_10018468 3300006353 Bacteria 3784
132 Ga0068871_100244524 3300006358 Bacteria 1561
133 Ga0068871_100299192 3300006358 Bacteria 1412
134 Ga0068871_100554838 3300006358 Unclassified 1041
135 Ga0068871_100695897 3300006358 Bacteria 931
136 Ga0068871_100735135 3300006358 Bacteria 906
137 Ga0068871_101190345 3300006358 Bacteria 714
138 Ga0075428_100002189 3300006844 Bacteria 21139
139 Ga0075428_100228937 3300006844 Bacteria 2006
140 Ga0075428_100627365 3300006844 Bacteria 1147
141 Ga0075430_100000722 3300006846 Bacteria 25248
142 Ga0075430_100079124 3300006846 Bacteria 2755
143 Ga0075430_100646716 3300006846 Bacteria 872
144 Ga0075431_100017012 3300006847 Bacteria 7384
145 Ga0075431_100048391 3300006847 Bacteria 4385
146 Ga0075431_100069232 3300006847 Bacteria 3641
147 Ga0075431_100404434 3300006847 Unclassified 1366
148 Ga0075431_100655540 3300006847 Unclassified 1030
149 Ga0075433_10041070 3300006852 Bacteria 4007
150 Ga0075433_10122170 3300006852 Bacteria 2313
151 Ga0075433_10891686 3300006852 Bacteria 776
152 Ga0075434_100005974 3300006871 Bacteria 11142
153 Ga0075434_100350286 3300006871 Bacteria 1498
154 Ga0075434_101296936 3300006871 Bacteria 739
155 Ga0075429_100045348 3300006880 Bacteria 3825
156 Ga0075429_100311578 3300006880 Bacteria 1378
157 Ga0075429_100323046 3300006880 Bacteria 1351
158 Ga0075429_101853265 3300006880 Bacteria 523
159 Ga0068865_100073573 3300006881 Bacteria 2430
160 Ga0068865_100362451 3300006881 Unclassified 1177
161 Ga0097620_100156788 3300006931 Bacteria 2354
162 Ga0097620_100159713 3300006931 Bacteria 2333
163 Ga0097620_100706843 3300006931 Bacteria 1098
164 Ga0075435_100002471 3300007076 Bacteria 12289
165 Ga0075435_100798366 3300007076 Bacteria 822
166 Ga0105240_10162101 3300009093 Bacteria 2655
167 Ga0111539_10003342 3300009094 Bacteria 21190
168 Ga0111539_10175568 3300009094 Bacteria 2503
169 Ga0111539_10215579 3300009094 Bacteria 2236
170 Ga0111539_10530709 3300009094 Bacteria 1371
171 Ga0111539_11221948 3300009094 Bacteria 873
172 Ga0105245_10047391 3300009098 Bacteria 3842
173 Ga0105245_10145027 3300009098 Unclassified 2239
174 Ga0105245_10388852 3300009098 Bacteria 1391
175 Ga0105247_10138801 3300009101 Bacteria 1591
176 Ga0114129_10022938 3300009147 Bacteria 8853
177 Ga0114129_10108655 3300009147 Bacteria 3829
178 Ga0114129_10472990 3300009147 Bacteria 1641
179 Ga0114129_11023722 3300009147 Bacteria 1039
180 Ga0114129_11525612 3300009147 Bacteria 820
181 Ga0105243_10222245 3300009148 Bacteria 1670
182 Ga0105243_10262042 3300009148 Bacteria 1548
183 Ga0105241_10083742 3300009174 Bacteria 2503
184 Ga0105242_10023704 3300009176 Bacteria 4839
185 Ga0105242_10172370 3300009176 Bacteria 1903
186 Ga0105242_11353407 3300009176 Bacteria 738
187 Ga0105248_10013729 3300009177 Bacteria 8916
188 Ga0105248_10032063 3300009177 Bacteria 5872
189 Ga0105248_10078634 3300009177 Bacteria 3708
190 Ga0105248_10177480 3300009177 Bacteria 2401
191 Ga0105248_10233972 3300009177 Bacteria 2068
192 Ga0105248_10629589 3300009177 Bacteria 1210
193 Ga0105248_11390690 3300009177 Bacteria 794
194 Ga0105238_10141341 3300009551 Unclassified 2384
195 Ga0105238_10207613 3300009551 Bacteria 1934
196 Ga0105249_10085597 3300009553 Bacteria 2938
197 Ga0105249_11021056 3300009553 Bacteria 896
198 Ga0105239_10805808 3300010375 Bacteria 1076
199 Ga0105246_10196091 3300011119 Bacteria 1566
200 Ga0105246_11084470 3300011119 Bacteria 730
201 Ga0157374_10229072 3300013296 Bacteria 1825
202 Ga0157374_10301129 3300013296 Bacteria 1586
203 Ga0157378_10080895 3300013297 Bacteria 2936
204 Ga0157378_10780873 3300013297 Bacteria 980
205 Ga0157378_11260228 3300013297 Bacteria 780
206 Ga0163162_10220896 3300013306 Bacteria 2025
207 Ga0157375_10045998 3300013308 Bacteria 4251
208 Ga0157375_10196458 3300013308 Bacteria 2172
209 Ga0157375_10812021 3300013308 Bacteria 1083
210 Ga0157375_12438598 3300013308 Bacteria 624
211 Ga0163163_10050770 3300014325 Bacteria 4086
212 Ga0163163_10056835 3300014325 Bacteria 3867
213 Ga0163163_10173848 3300014325 Bacteria 2200
214 Ga0163163_10229023 3300014325 Bacteria 1907
215 Ga0163163_10238067 3300014325 Bacteria 1870
216 Ga0157380_10494187 3300014326 Bacteria 1187
217 Ga0157380_11178076 3300014326 Bacteria 809
218 Ga0157380_11479978 3300014326 Bacteria 731
219 Ga0157380_11785817 3300014326 Bacteria 674
220 Ga0157380_12061945 3300014326 Bacteria 633
221 Ga0157377_10431427 3300014745 Bacteria 905
222 Ga0157379_10020720 3300014968 Bacteria 5818
223 Ga0157379_10074568 3300014968 Unclassified 3037
224 Ga0157379_10559548 3300014968 Bacteria 1065
225 Ga0157379_10894071 3300014968 Bacteria 842
226 Ga0157376_10036575 3300014969 Bacteria 3979
227 Ga0163161_10195737 3300017792 Bacteria 1556
228 Ga0163161_10857053 3300017792 Bacteria 767
229 Ga0207682_10020092 3300025893 Bacteria 2620
230 Ga0207682_10065691 3300025893 Bacteria 1528
231 Ga0207688_10081787 3300025901 Bacteria 1845
232 Ga0207680_10047299 3300025903 Bacteria 2549
233 Ga0207680_10148765 3300025903 Bacteria 1559
234 Ga0207680_10196599 3300025903 Bacteria 1372
235 Ga0207680_10288657 3300025903 Bacteria 1141
236 Ga0207647_10114605 3300025904 Bacteria 1592
237 Ga0207645_10014108 3300025907 Bacteria 5354
238 Ga0207643_10040333 3300025908 Bacteria 2628
239 Ga0207663_10811429 3300025916 Bacteria 745
240 Ga0207662_10003112 3300025918 Bacteria 8469
241 Ga0207662_10226072 3300025918 Bacteria 1220
242 Ga0207649_10139869 3300025920 Bacteria 1655
243 Ga0207649_10152746 3300025920 Bacteria 1592
244 Ga0207681_10143200 3300025923 Bacteria 1783
245 Ga0207650_10017077 3300025925 Bacteria 5080
246 Ga0207650_10208892 3300025925 Bacteria 1567
247 Ga0207650_10546579 3300025925 Bacteria 971
248 Ga0207659_10067230 3300025926 Bacteria 2603
249 Ga0207659_10403386 3300025926 Unclassified 1144
250 Ga0207659_11600789 3300025926 Bacteria 556
251 Ga0207659_11600910 3300025926 Bacteria 556
252 Ga0207687_10058169 3300025927 Bacteria 2719
253 Ga0207687_10690664 3300025927 Bacteria 866
254 Ga0207644_10043256 3300025931 Bacteria 3195
255 Ga0207644_10125821 3300025931 Bacteria 1956
256 Ga0207644_10190429 3300025931 Bacteria 1612
257 Ga0207690_10164102 3300025932 Bacteria 1658
258 Ga0207706_10346968 3300025933 Bacteria 1291
259 Ga0207706_10400572 3300025933 Bacteria 1190
260 Ga0207706_10465090 3300025933 Bacteria 1093
261 Ga0207709_10102162 3300025935 Bacteria 1898
262 Ga0207670_10340415 3300025936 Bacteria 1185
263 Ga0207670_10688504 3300025936 Bacteria 845
264 Ga0207669_10090550 3300025937 Bacteria 1990
265 Ga0207669_10462924 3300025937 Bacteria 1007
266 Ga0207704_10396476 3300025938 Unclassified 1088
267 Ga0207691_10010869 3300025940 Bacteria 8735
268 Ga0207691_10012233 3300025940 Bacteria 8226
269 Ga0207691_10014994 3300025940 Bacteria 7378
270 Ga0207691_10090465 3300025940 Bacteria 2743
271 Ga0207711_10007673 3300025941 Bacteria 9019
272 Ga0207711_10169102 3300025941 Bacteria 1983
273 Ga0207711_10514266 3300025941 Bacteria 1116
274 Ga0207689_10073686 3300025942 Bacteria 2805
275 Ga0207689_10331167 3300025942 Bacteria 1264
276 Ga0207661_10129646 3300025944 Bacteria 2158
277 Ga0207679_10050836 3300025945 Bacteria 3031
278 Ga0207679_10171261 3300025945 Bacteria 1788
279 Ga0207679_10247250 3300025945 Bacteria 1514
280 Ga0207679_10340444 3300025945 Bacteria 1304
281 Ga0207679_10551809 3300025945 Bacteria 1034
282 Ga0207651_10004342 3300025960 Bacteria 7127
283 Ga0207651_10185874 3300025960 Bacteria 1653
284 Ga0207651_10192545 3300025960 Bacteria 1628
285 Ga0207712_10408206 3300025961 Bacteria 1143
286 Ga0207712_11128663 3300025961 Bacteria 698
287 Ga0207668_10494741 3300025972 Bacteria 1051
288 Ga0207640_10527484 3300025981 Bacteria 988
289 Ga0207658_10164704 3300025986 Bacteria 1820
290 Ga0207658_10209268 3300025986 Bacteria 1633
291 Ga0207658_10223416 3300025986 Bacteria 1586
292 Ga0207658_10625148 3300025986 Bacteria 969
293 Ga0207677_10069770 3300026023 Bacteria 2473
294 Ga0207677_10146853 3300026023 Bacteria 1813
295 Ga0207677_10919524 3300026023 Bacteria 789
296 Ga0207703_10273602 3300026035 Bacteria 1531
297 Ga0207703_10304229 3300026035 Bacteria 1455
298 Ga0207703_10484644 3300026035 Bacteria 1159
299 Ga0207703_10787343 3300026035 Bacteria 907
300 Ga0207639_10384216 3300026041 Bacteria 1261
301 Ga0207678_10071196 3300026067 Bacteria 2981
302 Ga0207678_10077253 3300026067 Bacteria 2852
303 Ga0207678_10242037 3300026067 Bacteria 1545
304 Ga0207678_10416572 3300026067 Bacteria 1164
305 Ga0207708_10043184 3300026075 Bacteria 3436
306 Ga0207708_10406583 3300026075 Bacteria 1127
307 Ga0207708_10496424 3300026075 Bacteria 1022
308 Ga0207708_11190603 3300026075 Bacteria 666
309 Ga0207641_10073333 3300026088 Bacteria 2950
310 Ga0207641_10091843 3300026088 Bacteria 2658
311 Ga0207641_10537219 3300026088 Bacteria 1139
312 Ga0207641_10823941 3300026088 Bacteria 919
313 Ga0207648_10003828 3300026089 Bacteria 15712
314 Ga0207648_10295579 3300026089 Unclassified 1451
315 Ga0207648_10351544 3300026089 Bacteria 1329
316 Ga0207648_10423577 3300026089 Bacteria 1209
317 Ga0207648_10936407 3300026089 Bacteria 810
318 Ga0207676_10365184 3300026095 Bacteria 1339
319 Ga0207676_10930681 3300026095 Bacteria 854
320 Ga0207674_10771203 3300026116 Bacteria 928
321 Ga0207675_100082052 3300026118 Bacteria 3024
322 Ga0207675_100083524 3300026118 Bacteria 2996
323 Ga0207675_100135386 3300026118 Bacteria 2337
324 Ga0207675_100156056 3300026118 Bacteria 2175
325 Ga0207675_101383178 3300026118 Bacteria 724
326 Ga0207683_10013542 3300026121 Bacteria 6958
327 Ga0207683_10356284 3300026121 Unclassified 1343
328 Ga0207683_10364962 3300026121 Bacteria 1326
329 Ga0207698_10826316 3300026142 Bacteria 930
330 Ga0209971_1024912 3300027682 Bacteria 1429
331 Ga0209998_10017670 3300027717 Bacteria 1509
332 Ga0209813_10012894 3300027866 Bacteria 2220
333 Ga0207428_10000531 3300027907 Bacteria 45546
334 Ga0207428_10433421 3300027907 Bacteria 960
335 Ga0207428_10766278 3300027907 Bacteria 687
336 Ga0268266_10138473 3300028379 Unclassified 2182
337 Ga0268266_10269790 3300028379 Bacteria 1579
338 Ga0268266_10581458 3300028379 Unclassified 1075
339 Ga0268265_10147760 3300028380 Bacteria 1978
340 Ga0268264_10674872 3300028381 Bacteria 1025
341 Ga0268264_10964479 3300028381 Bacteria 858
342 Ga0307408_100027696 3300031548 Bacteria 3908
343 Ga0307408_100215485 3300031548 Bacteria 1563
344 Ga0265314_10345371 3300031711 Bacteria 820
345 Ga0307405_10003597 3300031731 Bacteria 7159
346 Ga0307413_10089497 3300031824 Bacteria 2000
347 Ga0307410_10118082 3300031852 Bacteria 1930
348 Ga0307406_10039130 3300031901 Bacteria 2940
349 Ga0307407_10447201 3300031903 Bacteria 937
350 Ga0307412_10149133 3300031911 Bacteria 1723
351 Ga0307409_100040170 3300031995 Bacteria 3480
352 Ga0307409_100805509 3300031995 Unclassified 947
353 Ga0307416_100013118 3300032002 Bacteria 5620
354 Ga0307416_100043485 3300032002 Bacteria 3517
355 Ga0307416_100671845 3300032002 Bacteria 1123
356 Ga0307416_100764343 3300032002 Bacteria 1060
357 Ga0307411_10143193 3300032005 Bacteria 1765
358 Ga0307411_10174183 3300032005 Bacteria 1626
359 Ga0373930_0024117 3300034816 Bacteria 1214
360 Ga0373934_0222423 3300035086 Bacteria 779
361 Ga0373934_0282889 3300035086 Bacteria 687
362 Ga0373936_0425597 3300035113 Bacteria 612
363 Ga0373946_0343227 3300035171 Bacteria 745
364 Ga0373962_0022632 3300035242 Bacteria 1668
365 Ga0395900_0901244 3300037418 Bacteria 808
366 Ga0439439_0013911 3300041406 Bacteria 1955
367 Ga0451791_1362089 3300041451 Bacteria 819
368 Ga0451800_1659818 3300041459 Bacteria 1332
369 Ga0451802_1058074 3300041460 Bacteria 893
370 Ga0451837_1205350 3300041494 Bacteria 576
371 Ga0451853_1753717 3300041512 Bacteria 758
372 Ga0439445_0009230 3300042004 Bacteria 2321
373 Ga0439457_065991 3300042014 Bacteria 822
374 Ga0439462_0193292 3300042015 Bacteria 578
375 Ga0450894_003403 3300042131 Bacteria 2079
376 Ga0450894_055913 3300042131 Bacteria 588
377 Ga0450905_046072 3300042142 Bacteria 702
378 Ga0439446_0033678 3300042156 Bacteria 1489
379 Ga0450908_000482 3300042184 Bacteria 7673
380 Ga0439464_0000590 3300042439 Bacteria 7621
381 Ga0466960_0564527 3300044901 Bacteria 672
382 Ga0466967_0060754 3300045976 Bacteria 3351
383 Ga0466967_0535609 3300045976 Bacteria 1152
384 Ga0495629_0262069 3300046459 Bacteria 1188
385 Ga0495580_0532189 3300046472 Bacteria 782
386 Ga0495596_0406345 3300046500 Bacteria 531
387 Ga0495643_0437171 3300046522 Bacteria 571
388 Ga0495642_0143396 3300046528 Bacteria 1031
389 Ga0495635_0364370 3300046663 Bacteria 963
390 Ga0495599_0411697 3300046678 Unclassified 804
391 Ga0495647_0133045 3300046681 Bacteria 1055
392 Ga0495647_0353276 3300046681 Bacteria 669
393 Ga0495658_0105108 3300046683 Bacteria 1691
394 Ga0495669_0050332 3300046684 Bacteria 1868
395 Ga0495672_0032844 3300047320 Bacteria 3222
396 Ga0496101_0051205 3300048904 Bacteria 2975
397 Ga0496101_0253648 3300048904 Bacteria 1371
398 Ga0496101_0569000 3300048904 Unclassified 896
399 Ga0496102_0078894 3300048905 Bacteria 3031
400 Ga0496103_0025836 3300048906 Bacteria 3552
401 Ga0496103_0443129 3300048906 Bacteria 833
402 Ga0496104_0108540 3300048907 Bacteria 2660
403 Ga0496104_0384411 3300048907 Bacteria 1316
404 Ga0496105_0138595 3300048908 Bacteria 2003
405 Ga0496106_0078503 3300048909 Bacteria 2533
406 Ga0496107_0071456 3300048910 Bacteria 2522
407 Ga0496107_0243902 3300048910 Bacteria 1337
408 Ga0496108_0005056 3300048911 Bacteria 10656
409 Ga0496108_0860200 3300048911 Bacteria 780
410 Ga0496109_0099409 3300048912 Unclassified 2698
411 Ga0496109_1765745 3300048912 Bacteria 552
412 Ga0496110_0536045 3300048913 Bacteria 1064
413 Ga0496112_0006409 3300048915 Bacteria 10327
414 Ga0496112_0030528 3300048915 Bacteria 5216
415 Ga0496112_1349963 3300048915 Bacteria 628
416 Ga0496113_0137275 3300048916 Bacteria 1922
417 Ga0496113_0140321 3300048916 Unclassified 1901
418 Ga0496113_0360699 3300048916 Bacteria 1166
419 Ga0501034_0073347 3300049571 Bacteria 3431
420 Ga0501037_0063062 3300049573 Bacteria 2702
421 Ga0501037_0648329 3300049573 Bacteria 706
422 Ga0501041_0185871 3300049577 Bacteria 1301
423 Ga0501041_0849861 3300049577 Bacteria 586
424 Ga0501042_0079860 3300049578 Bacteria 2344
425 Ga0501042_1172993 3300049578 Bacteria 560
426 Ga0501043_0001015 3300049579 Bacteria 24651
427 Ga0501046_0201096 3300049580 Bacteria 1482
428 Ga0501046_0461200 3300049580 Unclassified 913
429 Ga0501047_0000134 3300049581 Bacteria 89882
430 Ga0501048_0054562 3300049582 Bacteria 2839
431 Ga0501048_0287959 3300049582 Bacteria 1168
432 Ga0501048_1207775 3300049582 Bacteria 544
433 Ga0501067_0032969 3300049583 Bacteria 2875
434 Ga0501068_0470713 3300049584 Bacteria 814
435 Ga0501069_0232320 3300049585 Bacteria 1074
436 Ga0501071_0229538 3300049587 Bacteria 1398
437 Ga0501071_0483074 3300049587 Bacteria 950
438 Ga0501072_0936280 3300049588 Bacteria 676
439 Ga0501073_0046818 3300049589 Bacteria 3041
440 Ga0501073_0361441 3300049589 Bacteria 1002
441 Ga0501075_0305150 3300049591 Bacteria 1213
442 Ga0501075_0620038 3300049591 Bacteria 825
443 Ga0501076_0667804 3300049592 Bacteria 858
444 Ga0501076_0931426 3300049592 Bacteria 716
445 Ga0501077_0143130 3300049593 Bacteria 1517
446 Ga0501077_0269130 3300049593 Bacteria 1084
447 Ga0501202_009523 3300049652 Unclassified 1788
448 Ga0501221_094035 3300049704 Bacteria 736
449 Ga0501079_0088921 3300049741 Bacteria 2392
450 Ga0501079_0342963 3300049741 Bacteria 1170
451 Ga0501079_1306299 3300049741 Bacteria 571
452 Ga0501080_0321156 3300049742 Bacteria 1402
453 Ga0501081_0182739 3300049743 Bacteria 1517
454 Ga0501081_0253620 3300049743 Bacteria 1285
455 Ga0501083_0015501 3300049744 Bacteria 5337
456 Ga0501083_0325350 3300049744 Bacteria 1000
457 Ga0501265_064058 3300049762 Unclassified 606
458 Ga0501045_0283859 3300049824 Bacteria 1232
459 nmdc:mga03n38_61827_c1 3300050490 Bacteria 1706
460 nmdc:mga00v17_129172_c1 3300050491 Bacteria 1614
461 nmdc:mga00v17_510684_c1 3300050491 Bacteria 779
462 nmdc:mga00v17_51242_c1 3300050491 Bacteria 2510
463 nmdc:mga00v17_921978_c1 3300050491 Unclassified 552
464 nmdc:mga0yw44_16145_c1 3300050492 Bacteria 4026
465 nmdc:mga0yw44_2539_c1 3300050492 Bacteria 7830
466 nmdc:mga0yw44_656179_c1 3300050492 Bacteria 713
467 nmdc:mga0k408_21408_c1 3300050493 Bacteria 3631
468 nmdc:mga0k408_229640_c1 3300050493 Bacteria 1108
469 nmdc:mga0k408_241027_c1 3300050493 Bacteria 1080
470 nmdc:mga0k408_34760_c1 3300050493 Bacteria 2887
471 nmdc:mga0k408_488134_c1 3300050493 Bacteria 730
472 nmdc:mga0k408_6215_c1 3300050493 Bacteria 6372
473 nmdc:mga0k408_74258_c1 3300050493 Bacteria 1987
474 nmdc:mga0k408_98053_c1 3300050493 Bacteria 1727
475 nmdc:mga06z11_11130_c1 3300050494 Bacteria 3866
476 nmdc:mga06z11_13363_c1 3300050494 Bacteria 3603
477 nmdc:mga06z11_190180_c1 3300050494 Bacteria 1188
478 nmdc:mga06z11_27428_c1 3300050494 Bacteria 2723
479 nmdc:mga06z11_34203_c1 3300050494 Bacteria 2493
480 nmdc:mga06z11_5146_c1 3300050494 Bacteria 5216
481 nmdc:mga04h51_15715_c1 3300050495 Bacteria 2185
482 nmdc:mga04h51_23506_c1 3300050495 Bacteria 1877
483 nmdc:mga04h51_64837_c1 3300050495 Bacteria 1261
484 nmdc:mga07m45_16376_c1 3300050496 Bacteria 3970
485 nmdc:mga07m45_2020_c1 3300050496 Bacteria 9409
486 nmdc:mga05p37_132772_c2 3300050507 Bacteria 850
487 nmdc:mga05p37_73567_c1 3300050507 Bacteria 4206
488 nmdc:mga05p37_981389_c1 3300050507 Bacteria 900
489 nmdc:mga09592_1465836_c1 3300050508 Bacteria 556
490 nmdc:mga09592_42911_c1 3300050508 Bacteria 3805
491 nmdc:mga09592_859150_c1 3300050508 Bacteria 765
492 nmdc:mga0qj67_9293_c1 3300050509 Bacteria 7312
493 nmdc:mga06r32_43247_c1 3300050510 Bacteria 4286
494 nmdc:mga06r32_72435_c1 3300050510 Bacteria 3336
495 nmdc:mga06r32_72616_c1 3300050510 Bacteria 3331
496 nmdc:mga06r32_839053_c1 3300050510 Unclassified 878
497 nmdc:mga08y16_1019314_c1 3300050511 Bacteria 807
498 nmdc:mga08y16_13383_c1 3300050511 Bacteria 8630
499 nmdc:mga08y16_310013_c1 3300050511 Bacteria 1625
500 nmdc:mga0n895_165060_c1 3300050512 Bacteria 2246
501 nmdc:mga0n895_37890_c1 3300050512 Bacteria 4668
502 nmdc:mga0rr50_228411_c1 3300050513 Bacteria 1539
503 nmdc:mga0rr50_713969_c1 3300050513 Bacteria 856
504 nmdc:mga0rr50_896470_c1 3300050513 Bacteria 756
505 nmdc:mga08x19_457831_c1 3300050514 Unclassified 898
506 nmdc:mga0a205_85702_c2 3300050515 Bacteria 2513
507 nmdc:mga0a205_880572_c1 3300050515 Bacteria 742
508 nmdc:mga0a205_92010_c1 3300050515 Bacteria 1848
509 nmdc:mga0sz30_163937_c1 3300050516 Unclassified 985
510 Ga0495619_0279414 3300053085 Bacteria 1157
511 Ga0495619_0279823 3300053085 Bacteria 1156
512 Ga0500592_011898 3300053116 Bacteria 1391
513 Ga0500568_0008172 3300053139 Bacteria 5070
514 Ga0500616_0000286 3300053153 Bacteria 74130
515 Ga0500611_171164 3300053727 Bacteria 605
516 Ga0500645_000150 3300053730 Bacteria 54398
517 Ga0501084_0020950 3300054114 Bacteria 5452
518 Ga0590071_005070 3300059421 Bacteria 3178
519 Ga0590074_042201 3300059423 Bacteria 822
520 Ga0590075_002481 3300059424 Bacteria 4415
521 Ga0501082_0397629 3300060353 Bacteria 1202
522 Ga0501082_0620086 3300060353 Bacteria 947
523 Ga0070696_100159744
524 Ga0065712_10234455
525 Ga0065715_10005177
526 Ga0065715_10059396
527 Ga0065715_10113613
528 Ga0065715_10151584
529 Ga0065715_10548209
530 Ga0070676_10041032
531 Ga0070683_100021775
532 Ga0070690_100081056
533 Ga0070690_100290061
534 Ga0070670_100025533
535 Ga0070670_100027586
536 Ga0070677_10252756
537 Ga0068869_100069903
538 Ga0068869_100667291
539 Ga0068869_101091816
540 Ga0070666_10059643
541 Ga0070666_10163941
542 Ga0070666_10209582
543 Ga0068868_100159056
544 Ga0068868_100289001
545 Ga0068868_100764578
546 Ga0070660_101536541
547 Ga0070687_100106176
548 Ga0070687_100359718
549 Ga0070668_100301925
550 Ga0070669_100700667
551 Ga0070669_100800260
552 Ga0070675_100249104
553 Ga0070675_100329297
554 Ga0070671_100048718
555 Ga0070671_100059818
556 Ga0070671_100108083
557 Ga0070674_100315805
558 Ga0070674_100336507
559 Ga0070674_100795868
560 Ga0070673_100049700
561 Ga0070673_100428778
562 Ga0070673_100491401
563 Ga0070688_100642511
564 Ga0070659_100092298
565 Ga0070659_100787631
566 Ga0070667_100040793
567 Ga0070667_100101297
568 Ga0070667_100156037
569 Ga0070667_100220469
570 Ga0070667_100956645
571 Ga0070701_10011115
572 Ga0070701_10392998
573 Ga0070705_100040613
574 Ga0070700_100089032
575 Ga0070694_100965829
576 Ga0070708_101308280
577 Ga0070663_100050607
578 Ga0070678_100199855
579 Ga0070678_100206725
580 Ga0070662_100700016
581 Ga0070662_100814631
582 Ga0068867_100007269
583 Ga0068867_100357193
584 Ga0068867_100458251
585 Ga0068867_100918908
586 Ga0070706_100319873
587 Ga0070706_100610997
588 Ga0070706_100847520
589 Ga0070684_100006516
590 Ga0068853_100719416
591 Ga0070672_100072625
592 Ga0070672_100853316
593 Ga0070686_100035949
594 Ga0070686_100065636
595 Ga0070693_100059765
596 Ga0070665_100012125
597 Ga0070665_100016273
598 Ga0070665_100022961
599 Ga0070704_100033633
600 Ga0068855_101147603
601 Ga0068855_101528310
602 Ga0070664_100004425
603 Ga0070664_100210895
604 Ga0068854_100017348
605 Ga0070702_100015240
606 Ga0070702_100032901
607 Ga0070702_100067859
608 Ga0068852_100242662
609 Ga0068859_100156793
610 Ga0068859_100159723
611 Ga0068859_100706856
612 Ga0068864_100279695
613 Ga0068864_100673611
614 Ga0068866_10123569
615 Ga0068861_100101990
616 Ga0068861_100110876
617 Ga0068861_100148743
618 Ga0068861_100171440
619 Ga0068861_100343679
620 Ga0068870_10218164
621 Ga0068863_100559435
622 Ga0068858_100031397
623 Ga0068858_100154978
624 Ga0068858_100230704
625 Ga0068858_101080465
626 Ga0068858_101096391
627 Ga0068860_100097046
628 Ga0068860_100155914
629 Ga0075365_10000240
630 Ga0075365_10029023
631 Ga0075365_10339292
632 Ga0075365_10740334
633 Ga0075368_10006477
634 Ga0075368_10016255
635 Ga0075368_10032501
636 Ga0075364_10003042
637 Ga0075364_10005552
638 Ga0075364_10047798
639 Ga0075367_10011405
640 Ga0075367_10029698
641 Ga0075367_10306046
642 Ga0075367_10562137
643 Ga0075369_10037958
644 Ga0075366_10011051
645 Ga0075366_10013665
646 Ga0075366_10020514
647 Ga0075366_10132836
648 Ga0075366_10286074
649 Ga0097621_100102712
650 Ga0097621_100404936
651 Ga0097621_101602251
652 Ga0075370_10012996
653 Ga0075370_10018468
654 Ga0068871_100244524
655 Ga0068871_100299192
656 Ga0068871_100554838
657 Ga0068871_100695897
658 Ga0068871_100735135
659 Ga0068871_101190345
660 Ga0075428_100002189
661 Ga0075428_100228937
662 Ga0075428_100627365
663 Ga0075430_100000722
664 Ga0075430_100079124
665 Ga0075430_100646716
666 Ga0075431_100017012
667 Ga0075431_100048391
668 Ga0075431_100069232
669 Ga0075431_100404434
670 Ga0075431_100655540
671 Ga0075433_10041070
672 Ga0075433_10122170
673 Ga0075433_10891686
674 Ga0075434_100005974
675 Ga0075434_100350286
676 Ga0075434_101296936
677 Ga0075429_100045348
678 Ga0075429_100311578
679 Ga0075429_100323046
680 Ga0075429_101853265
681 Ga0068865_100073573
682 Ga0068865_100362451
683 Ga0097620_100156788
684 Ga0097620_100159713
685 Ga0097620_100706843
686 Ga0075435_100002471
687 Ga0075435_100798366
688 Ga0105240_10162101
689 Ga0111539_10003342
690 Ga0111539_10175568
691 Ga0111539_10215579
692 Ga0111539_10530709
693 Ga0111539_11221948
694 Ga0105245_10047391
695 Ga0105245_10145027
696 Ga0105245_10388852
697 Ga0105247_10138801
698 Ga0114129_10022938
699 Ga0114129_10108655
700 Ga0114129_10472990
701 Ga0114129_11023722
702 Ga0114129_11525612
703 Ga0105243_10222245
704 Ga0105243_10262042
705 Ga0105241_10083742
706 Ga0105242_10023704
707 Ga0105242_10172370
708 Ga0105242_11353407
709 Ga0105248_10013729
710 Ga0105248_10032063
711 Ga0105248_10078634
712 Ga0105248_10177480
713 Ga0105248_10233972
714 Ga0105248_10629589
715 Ga0105248_11390690
716 Ga0105238_10141341
717 Ga0105238_10207613
718 Ga0105249_10085597
719 Ga0105249_11021056
720 Ga0105239_10805808
721 Ga0105246_10196091
722 Ga0105246_11084470
723 Ga0157374_10229072
724 Ga0157374_10301129
725 Ga0157378_10080895
726 Ga0157378_10780873
727 Ga0157378_11260228
728 Ga0163162_10220896
729 Ga0157375_10045998
730 Ga0157375_10196458
731 Ga0157375_10812021
732 Ga0157375_12438598
733 Ga0163163_10050770
734 Ga0163163_10056835
735 Ga0163163_10173848
736 Ga0163163_10229023
737 Ga0163163_10238067
738 Ga0157380_10494187
739 Ga0157380_11178076
740 Ga0157380_11479978
741 Ga0157380_11785817
742 Ga0157380_12061945
743 Ga0157377_10431427
744 Ga0157379_10020720
745 Ga0157379_10074568
746 Ga0157379_10559548
747 Ga0157379_10894071
748 Ga0157376_10036575
749 Ga0163161_10195737
750 Ga0163161_10857053
751 Ga0207682_10020092
752 Ga0207682_10065691
753 Ga0207688_10081787
754 Ga0207680_10047299
755 Ga0207680_10148765
756 Ga0207680_10196599
757 Ga0207680_10288657
758 Ga0207647_10114605
759 Ga0207645_10014108
760 Ga0207643_10040333
761 Ga0207663_10811429
762 Ga0207662_10003112
763 Ga0207662_10226072
764 Ga0207649_10139869
765 Ga0207649_10152746
766 Ga0207681_10143200
767 Ga0207650_10017077
768 Ga0207650_10208892
769 Ga0207650_10546579
770 Ga0207659_10067230
771 Ga0207659_10403386
772 Ga0207659_11600789
773 Ga0207659_11600910
774 Ga0207687_10058169
775 Ga0207687_10690664
776 Ga0207644_10043256
777 Ga0207644_10125821
778 Ga0207644_10190429
779 Ga0207690_10164102
780 Ga0207706_10346968
781 Ga0207706_10400572
782 Ga0207706_10465090
783 Ga0207709_10102162
784 Ga0207670_10340415
785 Ga0207670_10688504
786 Ga0207669_10090550
787 Ga0207669_10462924
788 Ga0207704_10396476
789 Ga0207691_10010869
790 Ga0207691_10012233
791 Ga0207691_10014994
792 Ga0207691_10090465
793 Ga0207711_10007673
794 Ga0207711_10169102
795 Ga0207711_10514266
796 Ga0207689_10073686
797 Ga0207689_10331167
798 Ga0207661_10129646
799 Ga0207679_10050836
800 Ga0207679_10171261
801 Ga0207679_10247250
802 Ga0207679_10340444
803 Ga0207679_10551809
804 Ga0207651_10004342
805 Ga0207651_10185874
806 Ga0207651_10192545
807 Ga0207712_10408206
808 Ga0207712_11128663
809 Ga0207668_10494741
810 Ga0207640_10527484
811 Ga0207658_10164704
812 Ga0207658_10209268
813 Ga0207658_10223416
814 Ga0207658_10625148
815 Ga0207677_10069770
816 Ga0207677_10146853
817 Ga0207677_10919524
818 Ga0207703_10273602
819 Ga0207703_10304229
820 Ga0207703_10484644
821 Ga0207703_10787343
822 Ga0207639_10384216
823 Ga0207678_10071196
824 Ga0207678_10077253
825 Ga0207678_10242037
826 Ga0207678_10416572
827 Ga0207708_10043184
828 Ga0207708_10406583
829 Ga0207708_10496424
830 Ga0207708_11190603
831 Ga0207641_10073333
832 Ga0207641_10091843
833 Ga0207641_10537219
834 Ga0207641_10823941
835 Ga0207648_10003828
836 Ga0207648_10295579
837 Ga0207648_10351544
838 Ga0207648_10423577
839 Ga0207648_10936407
840 Ga0207676_10365184
841 Ga0207676_10930681
842 Ga0207674_10771203
843 Ga0207675_100082052
844 Ga0207675_100083524
845 Ga0207675_100135386
846 Ga0207675_100156056
847 Ga0207675_101383178
848 Ga0207683_10013542
849 Ga0207683_10356284
850 Ga0207683_10364962
851 Ga0207698_10826316
852 Ga0209971_1024912
853 Ga0209998_10017670
854 Ga0209813_10012894
855 Ga0207428_10000531
856 Ga0207428_10433421
857 Ga0207428_10766278
858 Ga0268266_10138473
859 Ga0268266_10269790
860 Ga0268266_10581458
861 Ga0268265_10147760
862 Ga0268264_10674872
863 Ga0268264_10964479
864 Ga0307408_100027696
865 Ga0307408_100215485
866 Ga0265314_10345371
867 Ga0307405_10003597
868 Ga0307413_10089497
869 Ga0307410_10118082
870 Ga0307406_10039130
871 Ga0307407_10447201
872 Ga0307412_10149133
873 Ga0307409_100040170
874 Ga0307409_100805509
875 Ga0307416_100013118
876 Ga0307416_100043485
877 Ga0307416_100671845
878 Ga0307416_100764343
879 Ga0307411_10143193
880 Ga0307411_10174183
881 Ga0373930_0024117
882 Ga0373934_0222423
883 Ga0373934_0282889
884 Ga0373936_0425597
885 Ga0373946_0343227
886 Ga0373962_0022632
887 Ga0395900_0901244
888 Ga0439439_0013911
889 Ga0451791_1362089
890 Ga0451800_1659818
891 Ga0451802_1058074
892 Ga0451837_1205350
893 Ga0451853_1753717
894 Ga0439445_0009230
895 Ga0439457_065991
896 Ga0439462_0193292
897 Ga0450894_003403
898 Ga0450894_055913
899 Ga0450905_046072
900 Ga0439446_0033678
901 Ga0450908_000482
902 Ga0439464_0000590
903 Ga0466960_0564527
904 Ga0466967_0060754
905 Ga0466967_0535609
906 Ga0495629_0262069
907 Ga0495580_0532189
908 Ga0495596_0406345
909 Ga0495643_0437171
910 Ga0495642_0143396
911 Ga0495635_0364370
912 Ga0495599_0411697
913 Ga0495647_0133045
914 Ga0495647_0353276
915 Ga0495658_0105108
916 Ga0495669_0050332
917 Ga0495672_0032844
918 Ga0496101_0051205
919 Ga0496101_0253648
920 Ga0496101_0569000
921 Ga0496102_0078894
922 Ga0496103_0025836
923 Ga0496103_0443129
924 Ga0496104_0108540
925 Ga0496104_0384411
926 Ga0496105_0138595
927 Ga0496106_0078503
928 Ga0496107_0071456
929 Ga0496107_0243902
930 Ga0496108_0005056
931 Ga0496108_0860200
932 Ga0496109_0099409
933 Ga0496109_1765745
934 Ga0496110_0536045
935 Ga0496112_0006409
936 Ga0496112_0030528
937 Ga0496112_1349963
938 Ga0496113_0137275
939 Ga0496113_0140321
940 Ga0496113_0360699
941 Ga0501034_0073347
942 Ga0501037_0063062
943 Ga0501037_0648329
944 Ga0501041_0185871
945 Ga0501041_0849861
946 Ga0501042_0079860
947 Ga0501042_1172993
948 Ga0501043_0001015
949 Ga0501046_0201096
950 Ga0501046_0461200
951 Ga0501047_0000134
952 Ga0501048_0054562
953 Ga0501048_0287959
954 Ga0501048_1207775
955 Ga0501067_0032969
956 Ga0501068_0470713
957 Ga0501069_0232320
958 Ga0501071_0229538
959 Ga0501071_0483074
960 Ga0501072_0936280
961 Ga0501073_0046818
962 Ga0501073_0361441
963 Ga0501075_0305150
964 Ga0501075_0620038
965 Ga0501076_0667804
966 Ga0501076_0931426
967 Ga0501077_0143130
968 Ga0501077_0269130
969 Ga0501202_009523
970 Ga0501221_094035
971 Ga0501079_0088921
972 Ga0501079_0342963
973 Ga0501079_1306299
974 Ga0501080_0321156
975 Ga0501081_0182739
976 Ga0501081_0253620
977 Ga0501083_0015501
978 Ga0501083_0325350
979 Ga0501265_064058
980 Ga0501045_0283859
981 nmdc:mga03n38_61827_c1
982 nmdc:mga00v17_129172_c1
983 nmdc:mga00v17_510684_c1
984 nmdc:mga00v17_51242_c1
985 nmdc:mga00v17_921978_c1
986 nmdc:mga0yw44_16145_c1
987 nmdc:mga0yw44_2539_c1
988 nmdc:mga0yw44_656179_c1
989 nmdc:mga0k408_21408_c1
990 nmdc:mga0k408_229640_c1
991 nmdc:mga0k408_241027_c1
992 nmdc:mga0k408_34760_c1
993 nmdc:mga0k408_488134_c1
994 nmdc:mga0k408_6215_c1
995 nmdc:mga0k408_74258_c1
996 nmdc:mga0k408_98053_c1
997 nmdc:mga06z11_11130_c1
998 nmdc:mga06z11_13363_c1
999 nmdc:mga06z11_190180_c1
1000 nmdc:mga06z11_27428_c1
1001 nmdc:mga06z11_34203_c1
1002 nmdc:mga06z11_5146_c1
1003 nmdc:mga04h51_15715_c1
1004 nmdc:mga04h51_23506_c1
1005 nmdc:mga04h51_64837_c1
1006 nmdc:mga07m45_16376_c1
1007 nmdc:mga07m45_2020_c1
1008 nmdc:mga05p37_132772_c2
1009 nmdc:mga05p37_73567_c1
1010 nmdc:mga05p37_981389_c1
1011 nmdc:mga09592_1465836_c1
1012 nmdc:mga09592_42911_c1
1013 nmdc:mga09592_859150_c1
1014 nmdc:mga0qj67_9293_c1
1015 nmdc:mga06r32_43247_c1
1016 nmdc:mga06r32_72435_c1
1017 nmdc:mga06r32_72616_c1
1018 nmdc:mga06r32_839053_c1
1019 nmdc:mga08y16_1019314_c1
1020 nmdc:mga08y16_13383_c1
1021 nmdc:mga08y16_310013_c1
1022 nmdc:mga0n895_165060_c1
1023 nmdc:mga0n895_37890_c1
1024 nmdc:mga0rr50_228411_c1
1025 nmdc:mga0rr50_713969_c1
1026 nmdc:mga0rr50_896470_c1
1027 nmdc:mga08x19_457831_c1
1028 nmdc:mga0a205_85702_c2
1029 nmdc:mga0a205_880572_c1
1030 nmdc:mga0a205_92010_c1
1031 nmdc:mga0sz30_163937_c1
1032 Ga0495619_0279414
1033 Ga0495619_0279823
1034 Ga0500592_011898
1035 Ga0500568_0008172
1036 Ga0500616_0000286
1037 Ga0500611_171164
1038 Ga0500645_000150
1039 Ga0501084_0020950
1040 Ga0590071_005070
1041 Ga0590074_042201
1042 Ga0590075_002481
1043 Ga0501082_0397629
1044 Ga0501082_0620086

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07977

FabA

FabA-like domain

19

143

0.9

PF03061

4HBT

Thioesterase superfamily

69

144

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2okh-assembly1.cif.gz_A crystal structure of dimeric form of pffabz in crystal form3 0.902 17 146
8ayd-assembly1.cif.gz_CA-2 anammox-specific fabz from the annamox bacterium kuenenia stuttgartiensis 0.8998 17 144
2oki-assembly1.cif.gz_A crystal structure of dimeric form of pffabz in crystal form2 0.8981 17 146
2okh-assembly1.cif.gz_B crystal structure of dimeric form of pffabz in crystal form3 0.888 17 146
1zhg-assembly1.cif.gz_A crystal structure of beta-hydroxyacyl-acyl carrier protein dehydratase (fabz) from plasmodium falciparum 0.8878 17 146
ID Description Score Start End Superfamily
1zhgA00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8878 17 146 3.10.129.10
3d6xF00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8838 13 144 3.10.129.10
af_Q2FZ56_72_189_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.883 24 146 3.10.129.10
2okiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8769 17 144 3.10.129.10
2okiB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8699 17 144 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A6I4XJ20-F1-model_v4 3-hydroxyacyl-ACP dehydratase FabZ (EC 4.2.1.59) 0.9501 30 146 GO:0019171
AF-A0A2A5SG72-F1-model_v4 deleted 0.9465 23 146
AF-A0A538MFG1-F1-model_v4 Beta-hydroxyacyl-ACP dehydratase 0.9425 26 146 GO:0016829
AF-F0NRU4-F1-model_v4 deleted 0.9404 26 146
AF-F7QUV8-F1-model_v4 (3R)-hydroxymyristoyl-ACP dehydratase 0.9399 23 146 GO:0016829

Map