F458813

General Info

Members Datasets Scaffolds Average Seq Length
522 257 522 205

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10246826|Ga0070681_102468262
Length 247
Sequence MPIPMSVSPKFRMAMLYHIHSWRAHIIGTLDWRVLTHYHRNMSDFSKPMMQVLVPTVIENEGRYERAYDIYSRLLKDRIIFLNQDVNEATANLIVAQFLFLQAQDAKKDIYLYINSPGGSVYDALAIYDTMQFVTNDVQTVGIGVQASAAAFLLSSGAKGKRFMLPNSTVMIHQPSSGTQGKVTDMEIDLKESLRIKQRLNEIMAKNTGQKVEKIKEDMERDKWMDADESKTYGLIDAVITSPPKAA

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
78 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
79 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
80 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
151 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
152 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
153 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
154 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
155 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
156 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
160 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
161 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
162 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
165 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
180 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
181 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
184 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
195 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
198 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
199 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
227 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
230 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
231 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
232 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
233 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
238 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
239 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
240 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
241 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
242 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
243 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
244 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
245 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
246 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
247 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
248 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
249 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
250 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
251 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
252 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
253 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
254 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
255 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
256 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.49
Nodule 0
Rhizoplane 0.77
Rhizosphere 86.59
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1012158 3300001915 Bacteria 1486
2 JGI24740J21852_10009297 3300001979 Bacteria 3857
3 JGI24740J21852_10015574 3300001979 Bacteria 2772
4 JGI24737J22298_10000026 3300001990 Bacteria 43680
5 JGI24735J21928_10000080 3300002067 Bacteria 37384
6 JGI24742J22300_10000550 3300002244 Bacteria 5618
7 rootH1_10127459 3300003316 Bacteria 3507
8 rootH2_10000244 3300003320 Bacteria 697651
9 rootH1_10027145 3300003323 Unclassified 1708
10 Ga0070658_10000012 3300005327 Bacteria 277871
11 Ga0070658_10000749 3300005327 Bacteria 27863
12 Ga0070658_10003292 3300005327 Bacteria 13325
13 Ga0070658_10006514 3300005327 Bacteria 9471
14 Ga0070658_10008460 3300005327 Bacteria 8275
15 Ga0070658_10011034 3300005327 Bacteria 7242
16 Ga0070676_10002007 3300005328 Bacteria 10348
17 Ga0070676_10088924 3300005328 Unclassified 1888
18 Ga0070683_100000138 3300005329 Bacteria 47210
19 Ga0070683_100000261 3300005329 Bacteria 36323
20 Ga0070683_100202928 3300005329 Bacteria 1883
21 Ga0070690_100004663 3300005330 Bacteria 7635
22 Ga0070690_100219495 3300005330 Bacteria 1331
23 Ga0070690_100445045 3300005330 Bacteria 959
24 Ga0070670_100598424 3300005331 Bacteria 987
25 Ga0070677_10011554 3300005333 Bacteria 3048
26 Ga0070666_10121910 3300005335 Unclassified 1808
27 Ga0070680_100020037 3300005336 Bacteria 5303
28 Ga0070680_100538554 3300005336 Bacteria 1000
29 Ga0070682_100018362 3300005337 Unclassified 4087
30 Ga0070682_100020997 3300005337 Bacteria 3848
31 Ga0070682_100040251 3300005337 Bacteria 2875
32 Ga0070682_100047342 3300005337 Bacteria 2673
33 Ga0070682_100057150 3300005337 Bacteria 2457
34 Ga0070682_100158780 3300005337 Bacteria 1559
35 Ga0070660_100002116 3300005339 Bacteria 13694
36 Ga0070689_100038500 3300005340 Bacteria 3659
37 Ga0070691_10036818 3300005341 Bacteria 2307
38 Ga0070661_100116494 3300005344 Bacteria 1998
39 Ga0070692_10180426 3300005345 Bacteria 1223
40 Ga0070668_100355315 3300005347 Bacteria 1241
41 Ga0070675_100337402 3300005354 Bacteria 1334
42 Ga0070671_100000001 3300005355 Bacteria 1228151
43 Ga0070671_100003481 3300005355 Bacteria 12283
44 Ga0070671_100005518 3300005355 Bacteria 10077
45 Ga0070674_100000707 3300005356 Bacteria 16995
46 Ga0070674_100269310 3300005356 Bacteria 1345
47 Ga0070673_100000224 3300005364 Bacteria 28378
48 Ga0070673_100058985 3300005364 Bacteria 3037
49 Ga0070673_101268370 3300005364 Bacteria 691
50 Ga0070688_100284522 3300005365 Unclassified 1189
51 Ga0070659_100000215 3300005366 Bacteria 44375
52 Ga0070659_100079412 3300005366 Bacteria 2619
53 Ga0070667_100015224 3300005367 Bacteria 6356
54 Ga0070667_100351328 3300005367 Bacteria 1335
55 Ga0070714_100000414 3300005435 Bacteria 31336
56 Ga0070663_100039029 3300005455 Bacteria 3316
57 Ga0070678_100000168 3300005456 Bacteria 28067
58 Ga0070678_100056035 3300005456 Bacteria 2880
59 Ga0070662_100129231 3300005457 Bacteria 1945
60 Ga0070681_10011460 3300005458 Bacteria 8775
61 Ga0070681_10030555 3300005458 Bacteria 5405
62 Ga0070681_10246826 3300005458 Unclassified 1698
63 Ga0070681_10295373 3300005458 Bacteria 1530
64 Ga0070685_10000215 3300005466 Bacteria 38049
65 Ga0070679_100001253 3300005530 Bacteria 22393
66 Ga0070679_100004133 3300005530 Bacteria 13380
67 Ga0070679_100005147 3300005530 Bacteria 12094
68 Ga0070679_100034475 3300005530 Bacteria 5017
69 Ga0070679_100080166 3300005530 Bacteria 3253
70 Ga0070679_101203063 3300005530 Bacteria 703
71 Ga0070684_100000229 3300005535 Bacteria 38887
72 Ga0068853_100121450 3300005539 Bacteria 2331
73 Ga0068853_100140417 3300005539 Bacteria 2168
74 Ga0068853_100691855 3300005539 Bacteria 972
75 Ga0070672_100057236 3300005543 Bacteria 3059
76 Ga0070686_100010226 3300005544 Bacteria 5282
77 Ga0070686_100111123 3300005544 Bacteria 1867
78 Ga0070686_100628956 3300005544 Bacteria 849
79 Ga0070696_100002230 3300005546 Bacteria 12775
80 Ga0070696_100069665 3300005546 Bacteria 2472
81 Ga0070693_100147407 3300005547 Bacteria 1487
82 Ga0070665_100007266 3300005548 Bacteria 11255
83 Ga0070665_100354452 3300005548 Bacteria 1473
84 Ga0070665_100605017 3300005548 Bacteria 1109
85 Ga0068855_100000003 3300005563 Bacteria 589862
86 Ga0068855_100000168 3300005563 Bacteria 83242
87 Ga0068855_100035025 3300005563 Bacteria 5982
88 Ga0068855_100648275 3300005563 Bacteria 1134
89 Ga0068855_100873016 3300005563 Bacteria 952
90 Ga0070664_100382218 3300005564 Bacteria 1285
91 Ga0070664_100635386 3300005564 Bacteria 991
92 Ga0068857_100003251 3300005577 Bacteria 13497
93 Ga0068857_100038915 3300005577 Bacteria 4211
94 Ga0068857_100054742 3300005577 Bacteria 3541
95 Ga0068856_100004495 3300005614 Bacteria 13869
96 Ga0068856_100005703 3300005614 Bacteria 12263
97 Ga0068856_100313279 3300005614 Bacteria 1587
98 Ga0070702_100006982 3300005615 Bacteria 5380
99 Ga0068852_100230983 3300005616 Bacteria 1763
100 Ga0068859_100034504 3300005617 Bacteria 5078
101 Ga0068859_100683608 3300005617 Bacteria 1117
102 Ga0068859_100811211 3300005617 Unclassified 1023
103 Ga0068859_100979044 3300005617 Bacteria 928
104 Ga0068861_100128159 3300005719 Bacteria 2056
105 Ga0068863_100086427 3300005841 Bacteria 2971
106 Ga0068863_100121525 3300005841 Unclassified 2491
107 Ga0068863_100152794 3300005841 Bacteria 2209
108 Ga0068863_100244749 3300005841 Bacteria 1731
109 Ga0068863_100399350 3300005841 Bacteria 1344
110 Ga0068858_100323350 3300005842 Bacteria 1474
111 Ga0068862_100069409 3300005844 Unclassified 3042
112 Ga0068862_100115800 3300005844 Bacteria 2357
113 Ga0068862_100184442 3300005844 Bacteria 1874
114 Ga0068862_100622640 3300005844 Bacteria 1038
115 Ga0068862_100672707 3300005844 Bacteria 1000
116 Ga0075365_10006814 3300006038 Bacteria 6331
117 Ga0075365_10012916 3300006038 Bacteria 4978
118 Ga0075365_10101693 3300006038 Bacteria 1968
119 Ga0075368_10000178 3300006042 Bacteria 17351
120 Ga0075363_100000185 3300006048 Bacteria 16530
121 Ga0075364_10002401 3300006051 Bacteria 10505
122 Ga0075364_10029098 3300006051 Bacteria 3541
123 Ga0075367_10000441 3300006178 Bacteria 15392
124 Ga0075369_10000005 3300006186 Bacteria 147699
125 Ga0075369_10033192 3300006186 Bacteria 2187
126 Ga0075369_10119290 3300006186 Bacteria 1193
127 Ga0075366_10000294 3300006195 Bacteria 22461
128 Ga0075366_10003895 3300006195 Bacteria 7956
129 Ga0075366_10036915 3300006195 Bacteria 2882
130 Ga0075366_10038807 3300006195 Bacteria 2813
131 Ga0075366_10190554 3300006195 Unclassified 1246
132 Ga0097621_100000264 3300006237 Bacteria 35498
133 Ga0097621_100111653 3300006237 Bacteria 2310
134 Ga0097621_100118315 3300006237 Bacteria 2245
135 Ga0097621_100449695 3300006237 Bacteria 1160
136 Ga0068871_100001704 3300006358 Bacteria 14772
137 Ga0068871_100042311 3300006358 Bacteria 3656
138 Ga0068871_100161053 3300006358 Bacteria 1919
139 Ga0068871_100603129 3300006358 Bacteria 999
140 Ga0075428_100001893 3300006844 Bacteria 22462
141 Ga0068865_100663844 3300006881 Unclassified 887
142 Ga0097620_100034503 3300006931 Bacteria 5078
143 Ga0097620_100683653 3300006931 Bacteria 1117
144 Ga0097620_100811325 3300006931 Unclassified 1023
145 Ga0097620_100979067 3300006931 Bacteria 928
146 Ga0105240_10000003 3300009093 Bacteria 1183681
147 Ga0105240_10103414 3300009093 Bacteria 3461
148 Ga0105240_10118792 3300009093 Bacteria 3186
149 Ga0105240_10147902 3300009093 Bacteria 2801
150 Ga0105240_10208981 3300009093 Bacteria 2282
151 Ga0105240_10240709 3300009093 Unclassified 2098
152 Ga0105240_10250035 3300009093 Bacteria 2051
153 Ga0111539_10002740 3300009094 Bacteria 23389
154 Ga0111539_10193957 3300009094 Bacteria 2369
155 Ga0105245_10000002 3300009098 Bacteria 634374
156 Ga0105245_10001120 3300009098 Bacteria 24232
157 Ga0105245_10002882 3300009098 Bacteria 15448
158 Ga0105245_10024526 3300009098 Bacteria 5297
159 Ga0105245_11022724 3300009098 Bacteria 871
160 Ga0105243_10000001 3300009148 Bacteria 1156578
161 Ga0105243_10004400 3300009148 Bacteria 11143
162 Ga0105241_10000003 3300009174 Bacteria 839043
163 Ga0105241_10001167 3300009174 Bacteria 19988
164 Ga0105241_10020185 3300009174 Bacteria 4921
165 Ga0105241_10168688 3300009174 Bacteria 1806
166 Ga0105241_10178429 3300009174 Bacteria 1760
167 Ga0105242_10000135 3300009176 Bacteria 53544
168 Ga0105242_10002027 3300009176 Bacteria 15934
169 Ga0105242_10039193 3300009176 Bacteria 3812
170 Ga0105242_10143567 3300009176 Bacteria 2074
171 Ga0105237_10021926 3300009545 Bacteria 6560
172 Ga0105238_10000579 3300009551 Bacteria 38459
173 Ga0105238_10045023 3300009551 Unclassified 4458
174 Ga0105238_10162569 3300009551 Bacteria 2208
175 Ga0105238_10783265 3300009551 Bacteria 969
176 Ga0105249_10004554 3300009553 Bacteria 11976
177 Ga0105249_10453865 3300009553 Bacteria 1321
178 Ga0105032_101443 3300009979 Bacteria 2176
179 Ga0105033_100036 3300009986 Bacteria 9942
180 Ga0105030_100547 3300009987 Bacteria 3346
181 Ga0105028_100239 3300009993 Bacteria 5978
182 Ga0105028_100282 3300009993 Bacteria 5522
183 Ga0105239_10012962 3300010375 Bacteria 9276
184 Ga0105239_10068207 3300010375 Bacteria 3908
185 Ga0105239_10197479 3300010375 Unclassified 2253
186 Ga0105246_10383007 3300011119 Unclassified 1163
187 Ga0157373_10000042 3300013100 Bacteria 113564
188 Ga0157371_10001081 3300013102 Bacteria 29510
189 Ga0157370_10380625 3300013104 Bacteria 1300
190 Ga0157370_10608333 3300013104 Bacteria 1000
191 Ga0157369_10000945 3300013105 Bacteria 36893
192 Ga0157369_10111461 3300013105 Bacteria 2908
193 Ga0157374_10000031 3300013296 Bacteria 204840
194 Ga0157374_10000195 3300013296 Bacteria 56142
195 Ga0157374_10000945 3300013296 Bacteria 25227
196 Ga0157374_10004281 3300013296 Bacteria 12008
197 Ga0157374_10006505 3300013296 Bacteria 9922
198 Ga0157374_10059165 3300013296 Bacteria 3582
199 Ga0157374_10232042 3300013296 Bacteria 1813
200 Ga0157374_10283733 3300013296 Bacteria 1635
201 Ga0157374_10288675 3300013296 Unclassified 1621
202 Ga0157374_10572344 3300013296 Bacteria 1138
203 Ga0157378_10018720 3300013297 Bacteria 6088
204 Ga0157378_10195661 3300013297 Bacteria 1909
205 Ga0163162_10163931 3300013306 Bacteria 2346
206 Ga0157372_10021984 3300013307 Bacteria 6895
207 Ga0157372_10249605 3300013307 Unclassified 2060
208 Ga0157372_11237126 3300013307 Unclassified 862
209 Ga0157375_11068682 3300013308 Bacteria 944
210 Ga0157514_121816 3300013874 Bacteria 747
211 Ga0163163_10000901 3300014325 Bacteria 25176
212 Ga0163163_10001150 3300014325 Bacteria 22476
213 Ga0163163_10041860 3300014325 Bacteria 4482
214 Ga0157380_10427173 3300014326 Bacteria 1265
215 Ga0157377_10015405 3300014745 Bacteria 3911
216 Ga0157377_10189283 3300014745 Unclassified 1299
217 Ga0157377_10514643 3300014745 Bacteria 839
218 Ga0157379_10024555 3300014968 Bacteria 5350
219 Ga0157376_10000001 3300014969 Bacteria 842910
220 Ga0157376_10173137 3300014969 Bacteria 1967
221 Ga0157376_10450203 3300014969 Bacteria 1256
222 Ga0157376_10726874 3300014969 Bacteria 1000
223 Ga0154015_1350567 3300020610 Bacteria 1172
224 Ga0207642_10038812 3300025899 Bacteria 2064
225 Ga0207710_10061525 3300025900 Bacteria 1704
226 Ga0207688_10024071 3300025901 Bacteria 3339
227 Ga0207680_10265358 3300025903 Unclassified 1189
228 Ga0207645_10001343 3300025907 Bacteria 20227
229 Ga0207645_10179509 3300025907 Unclassified 1389
230 Ga0207645_10185832 3300025907 Bacteria 1364
231 Ga0207705_10000011 3300025909 Bacteria 517768
232 Ga0207705_10000056 3300025909 Bacteria 157554
233 Ga0207705_10005398 3300025909 Bacteria 9562
234 Ga0207705_10007548 3300025909 Bacteria 7989
235 Ga0207705_10666549 3300025909 Unclassified 809
236 Ga0207654_10000002 3300025911 Bacteria 1460142
237 Ga0207654_10000623 3300025911 Bacteria 20022
238 Ga0207654_10008169 3300025911 Bacteria 5278
239 Ga0207654_10379904 3300025911 Unclassified 978
240 Ga0207707_10029266 3300025912 Bacteria 4816
241 Ga0207707_10033206 3300025912 Unclassified 4517
242 Ga0207707_10241068 3300025912 Bacteria 1572
243 Ga0207707_10674903 3300025912 Bacteria 869
244 Ga0207707_10784560 3300025912 Bacteria 795
245 Ga0207695_10000005 3300025913 Bacteria 1196715
246 Ga0207695_10067799 3300025913 Bacteria 3658
247 Ga0207695_10205812 3300025913 Bacteria 1881
248 Ga0207695_10242989 3300025913 Bacteria 1701
249 Ga0207671_10106445 3300025914 Bacteria 2129
250 Ga0207660_10068430 3300025917 Unclassified 2575
251 Ga0207662_10024328 3300025918 Bacteria 3485
252 Ga0207657_10018295 3300025919 Bacteria 6697
253 Ga0207649_10304525 3300025920 Bacteria 1166
254 Ga0207652_10001646 3300025921 Bacteria 19604
255 Ga0207652_10003497 3300025921 Bacteria 12948
256 Ga0207652_10039296 3300025921 Unclassified 4015
257 Ga0207652_10150239 3300025921 Bacteria 2085
258 Ga0207652_10505641 3300025921 Bacteria 1088
259 Ga0207652_10819230 3300025921 Bacteria 826
260 Ga0207694_10000232 3300025924 Bacteria 53672
261 Ga0207650_10712118 3300025925 Bacteria 848
262 Ga0207659_10097745 3300025926 Bacteria 2206
263 Ga0207687_10000001 3300025927 Bacteria 1130810
264 Ga0207687_10000318 3300025927 Bacteria 32809
265 Ga0207687_10018679 3300025927 Unclassified 4580
266 Ga0207687_10038561 3300025927 Bacteria 3266
267 Ga0207687_10593150 3300025927 Unclassified 933
268 Ga0207664_10000883 3300025929 Bacteria 20230
269 Ga0207644_10000001 3300025931 Bacteria 1243214
270 Ga0207644_10012913 3300025931 Bacteria 5554
271 Ga0207690_10020866 3300025932 Bacteria 4054
272 Ga0207690_10048346 3300025932 Bacteria 2828
273 Ga0207706_10255096 3300025933 Bacteria 1531
274 Ga0207686_10000001 3300025934 Bacteria 1169580
275 Ga0207709_10000002 3300025935 Bacteria 1171536
276 Ga0207709_10078122 3300025935 Bacteria 2124
277 Ga0207669_10400099 3300025937 Bacteria 1075
278 Ga0207704_10702491 3300025938 Unclassified 837
279 Ga0207691_10055068 3300025940 Bacteria 3627
280 Ga0207711_10104737 3300025941 Bacteria 2507
281 Ga0207689_10028693 3300025942 Bacteria 4654
282 Ga0207661_10000021 3300025944 Bacteria 205381
283 Ga0207661_10001472 3300025944 Bacteria 15924
284 Ga0207661_10085020 3300025944 Bacteria 2622
285 Ga0207667_10000008 3300025949 Bacteria 625138
286 Ga0207667_10000339 3300025949 Bacteria 64087
287 Ga0207667_10045310 3300025949 Bacteria 4659
288 Ga0207667_10079387 3300025949 Bacteria 3401
289 Ga0207667_10705075 3300025949 Bacteria 1011
290 Ga0207667_10730992 3300025949 Bacteria 990
291 Ga0207651_10000167 3300025960 Bacteria 28415
292 Ga0207651_10200350 3300025960 Bacteria 1599
293 Ga0207651_10659669 3300025960 Bacteria 919
294 Ga0207712_10005674 3300025961 Bacteria 7875
295 Ga0207658_10012511 3300025986 Bacteria 5796
296 Ga0207677_10753632 3300026023 Bacteria 868
297 Ga0207639_10018683 3300026041 Bacteria 4930
298 Ga0207678_10448417 3300026067 Bacteria 1121
299 Ga0207708_10219699 3300026075 Bacteria 1522
300 Ga0207702_10009412 3300026078 Bacteria 8206
301 Ga0207702_10026887 3300026078 Bacteria 4778
302 Ga0207641_10080881 3300026088 Bacteria 2820
303 Ga0207641_10166948 3300026088 Bacteria 2005
304 Ga0207641_10400679 3300026088 Bacteria 1317
305 Ga0207676_10386988 3300026095 Bacteria 1303
306 Ga0207674_10000001 3300026116 Bacteria 616581
307 Ga0207674_10003175 3300026116 Bacteria 20237
308 Ga0207674_10161712 3300026116 Bacteria 2193
309 Ga0207674_10183980 3300026116 Bacteria 2040
310 Ga0207675_100134965 3300026118 Bacteria 2341
311 Ga0207675_100296036 3300026118 Bacteria 1575
312 Ga0207683_10006781 3300026121 Bacteria 9803
313 Ga0207683_10035541 3300026121 Bacteria 4334
314 Ga0207698_10099825 3300026142 Bacteria 2402
315 Ga0209813_10000009 3300027866 Bacteria 102315
316 Ga0207428_10006907 3300027907 Bacteria 10402
317 Ga0268266_10043318 3300028379 Bacteria 3846
318 Ga0268265_10106417 3300028380 Bacteria 2278
319 Ga0268264_10029493 3300028381 Bacteria 4494
320 Ga0268264_10051447 3300028381 Bacteria 3432
321 Ga0268264_11578875 3300028381 Bacteria 667
322 Ga0265337_1008418 3300028556 Unclassified 3752
323 Ga0265337_1022396 3300028556 Bacteria 1958
324 Ga0265337_1028742 3300028556 Bacteria 1666
325 Ga0265326_10000600 3300028558 Bacteria 13508
326 Ga0265326_10003561 3300028558 Bacteria 5091
327 Ga0265326_10013814 3300028558 Bacteria 2356
328 Ga0265326_10049990 3300028558 Unclassified 1184
329 Ga0265319_1019202 3300028563 Unclassified 2558
330 Ga0265334_10000049 3300028573 Bacteria 89091
331 Ga0265334_10000184 3300028573 Bacteria 36597
332 Ga0265334_10002192 3300028573 Bacteria 9189
333 Ga0265334_10009267 3300028573 Bacteria 4165
334 Ga0265334_10010854 3300028573 Bacteria 3845
335 Ga0265334_10017783 3300028573 Bacteria 2933
336 Ga0265334_10096242 3300028573 Bacteria 1076
337 Ga0265318_10018543 3300028577 Unclassified 2837
338 Ga0265323_10002206 3300028653 Bacteria 9068
339 Ga0265322_10002928 3300028654 Bacteria 5198
340 Ga0265322_10009746 3300028654 Bacteria 2789
341 Ga0265322_10031760 3300028654 Bacteria 1507
342 Ga0265322_10037035 3300028654 Bacteria 1390
343 Ga0265322_10094326 3300028654 Bacteria 851
344 Ga0265336_10000047 3300028666 Bacteria 123576
345 Ga0265336_10000932 3300028666 Bacteria 14816
346 Ga0265336_10004866 3300028666 Bacteria 5032
347 Ga0265336_10004878 3300028666 Bacteria 5026
348 Ga0265338_10000003 3300028800 Bacteria 733923
349 Ga0265338_10000052 3300028800 Bacteria 209239
350 Ga0265338_10000054 3300028800 Bacteria 207383
351 Ga0265338_10000130 3300028800 Bacteria 137739
352 Ga0265338_10000178 3300028800 Bacteria 118345
353 Ga0265338_10000192 3300028800 Bacteria 115195
354 Ga0265338_10000366 3300028800 Bacteria 81024
355 Ga0265338_10000543 3300028800 Bacteria 66162
356 Ga0265338_10002183 3300028800 Bacteria 30004
357 Ga0265338_10002202 3300028800 Bacteria 29782
358 Ga0265338_10002691 3300028800 Bacteria 26117
359 Ga0265338_10015999 3300028800 Bacteria 8198
360 Ga0265338_10112684 3300028800 Bacteria 2186
361 Ga0265338_10175256 3300028800 Bacteria 1640
362 Ga0265338_10249942 3300028800 Bacteria 1309
363 Ga0265324_10008768 3300029957 Bacteria 3992
364 Ga0314311_1003842 3300030733 Bacteria 1623
365 Ga0316179_1032107 3300030734 Unclassified 1230
366 Ga0265330_10011157 3300031235 Bacteria 4217
367 Ga0265328_10004117 3300031239 Bacteria 6348
368 Ga0265320_10006914 3300031240 Bacteria 7089
369 Ga0265320_10047520 3300031240 Bacteria 2099
370 Ga0265320_10161735 3300031240 Bacteria 1008
371 Ga0265325_10012632 3300031241 Bacteria 4824
372 Ga0265325_10034899 3300031241 Bacteria 2673
373 Ga0265329_10004354 3300031242 Bacteria 5907
374 Ga0265329_10069321 3300031242 Unclassified 1115
375 Ga0265340_10011307 3300031247 Bacteria 4748
376 Ga0265339_10014524 3300031249 Bacteria 4744
377 Ga0265339_10216219 3300031249 Unclassified 939
378 Ga0265331_10017294 3300031250 Bacteria 3766
379 Ga0265327_10000017 3300031251 Bacteria 445264
380 Ga0265327_10003790 3300031251 Bacteria 14008
381 Ga0265327_10013906 3300031251 Bacteria 5309
382 Ga0265327_10023151 3300031251 Bacteria 3686
383 Ga0265327_10026045 3300031251 Bacteria 3395
384 Ga0265316_10002349 3300031344 Bacteria 19725
385 Ga0265316_10118652 3300031344 Bacteria 1999
386 Ga0265316_10494761 3300031344 Bacteria 874
387 Ga0307513_10042035 3300031456 Bacteria 5038
388 Ga0307513_10514310 3300031456 Bacteria 913
389 Ga0307509_10017574 3300031507 Bacteria 8224
390 Ga0307408_100016814 3300031548 Bacteria 4890
391 Ga0265313_10007818 3300031595 Bacteria 7222
392 Ga0265313_10014158 3300031595 Unclassified 4732
393 Ga0265314_10262762 3300031711 Unclassified 985
394 Ga0265314_10364139 3300031711 Bacteria 792
395 Ga0265342_10008872 3300031712 Bacteria 7162
396 Ga0307405_10254950 3300031731 Bacteria 1307
397 Ga0307413_10018409 3300031824 Bacteria 3664
398 Ga0307413_10199172 3300031824 Bacteria 1445
399 Ga0307410_10389398 3300031852 Bacteria 1123
400 Ga0307406_10020251 3300031901 Bacteria 3915
401 Ga0307407_10008467 3300031903 Bacteria 4726
402 Ga0307409_100005980 3300031995 Bacteria 7092
403 Ga0307409_100097140 3300031995 Bacteria 2432
404 Ga0307416_100186112 3300032002 Bacteria 1952
405 Ga0307416_101557637 3300032002 Bacteria 766
406 Ga0307416_101592102 3300032002 Bacteria 758
407 Ga0307411_10006259 3300032005 Bacteria 5938
408 Ga0307411_10523395 3300032005 Bacteria 1007
409 Ga0307415_100623017 3300032126 Bacteria 963
410 Ga0395899_0133016 3300037312 Bacteria 1775
411 Ga0395899_0142040 3300037312 Bacteria 1707
412 Ga0395900_0000232 3300037418 Bacteria 87268
413 Ga0395900_0001560 3300037418 Bacteria 27209
414 Ga0395900_0022671 3300037418 Bacteria 6426
415 Ga0395900_0084321 3300037418 Bacteria 3265
416 Ga0395900_0088413 3300037418 Bacteria 3185
417 Ga0395900_0318880 3300037418 Bacteria 1535
418 Ga0395898_0017849 3300037466 Bacteria 7240
419 Ga0395898_0044080 3300037466 Bacteria 4394
420 Ga0395898_0154499 3300037466 Bacteria 2195
421 Ga0395905_0000238 3300037471 Bacteria 83164
422 Ga0395905_1017172 3300037471 Bacteria 732
423 Ga0395901_0004611 3300038443 Bacteria 13907
424 Ga0395901_0069439 3300038443 Bacteria 3669
425 Ga0395901_0185373 3300038443 Unclassified 2183
426 Ga0451807_0051513 3300041486 Bacteria 1637
427 Ga0466967_0358727 3300045976 Bacteria 1412
428 Ga0495590_0010707 3300046457 Bacteria 3438
429 Ga0495591_048562 3300046458 Bacteria 1170
430 Ga0495638_0052126 3300046460 Bacteria 2549
431 Ga0495584_0171701 3300046491 Bacteria 1102
432 Ga0495632_0049766 3300046519 Bacteria 2070
433 Ga0495668_0056991 3300046616 Bacteria 2156
434 Ga0495671_0075124 3300046692 Bacteria 1658
435 Ga0495672_0000016 3300047320 Bacteria 500601
436 Ga0495686_0176640 3300047472 Bacteria 1239
437 Ga0495602_0710007 3300048088 Bacteria 682
438 Ga0496108_0350579 3300048911 Bacteria 1288
439 Ga0496114_0071893 3300048917 Bacteria 2908
440 Ga0496114_1087632 3300048917 Unclassified 684
441 Ga0501031_0000854 3300049568 Bacteria 18296
442 Ga0501032_0019018 3300049569 Bacteria 4806
443 Ga0501034_0005296 3300049571 Bacteria 14147
444 Ga0501034_0012563 3300049571 Bacteria 8741
445 Ga0501034_0040229 3300049571 Bacteria 4733
446 Ga0501036_0023649 3300049572 Bacteria 5178
447 Ga0501036_0139194 3300049572 Bacteria 2049
448 Ga0501037_0000133 3300049573 Bacteria 69741
449 Ga0501038_0002588 3300049574 Bacteria 16889
450 Ga0501039_0506712 3300049575 Bacteria 948
451 Ga0501042_0469018 3300049578 Bacteria 913
452 Ga0501043_0000404 3300049579 Bacteria 38801
453 Ga0501043_0424538 3300049579 Bacteria 1002
454 Ga0501046_0000038 3300049580 Bacteria 159193
455 Ga0501047_0000229 3300049581 Bacteria 66412
456 Ga0501047_0001085 3300049581 Bacteria 27157
457 Ga0501048_0000033 3300049582 Bacteria 64896
458 Ga0501048_0038797 3300049582 Bacteria 3418
459 Ga0501068_0012002 3300049584 Bacteria 4900
460 Ga0501070_0017110 3300049586 Bacteria 6085
461 Ga0501070_0042904 3300049586 Bacteria 3766
462 Ga0501070_0063235 3300049586 Bacteria 3066
463 Ga0501070_0647645 3300049586 Bacteria 839
464 Ga0501073_0022322 3300049589 Bacteria 4559
465 Ga0501073_0388359 3300049589 Bacteria 964
466 Ga0501074_0049930 3300049590 Bacteria 3020
467 Ga0501075_0389221 3300049591 Bacteria 1063
468 Ga0501076_0196782 3300049592 Bacteria 1645
469 Ga0501080_0002131 3300049742 Bacteria 17194
470 Ga0501080_0004501 3300049742 Bacteria 12422
471 Ga0501083_0025708 3300049744 Bacteria 4076
472 Ga0501276_001600 3300049773 Bacteria 1546
473 Ga0501035_0000033 3300049822 Bacteria 175087
474 Ga0501035_0000562 3300049822 Bacteria 41104
475 Ga0501044_0268590 3300049823 Bacteria 1642
476 nmdc:mga03683_40075_c1 3300050489 Bacteria 1919
477 nmdc:mga03n38_2194_c1 3300050490 Bacteria 5956
478 nmdc:mga03n38_90743_c1 3300050490 Bacteria 1454
479 nmdc:mga00v17_11937_c1 3300050491 Unclassified 4783
480 nmdc:mga00v17_222845_c1 3300050491 Bacteria 1221
481 nmdc:mga0yw44_114190_c1 3300050492 Bacteria 1733
482 nmdc:mga0yw44_211217_c1 3300050492 Bacteria 1284
483 nmdc:mga0k408_184060_c1 3300050493 Unclassified 1246
484 nmdc:mga0k408_24_c2 3300050493 Bacteria 61722
485 nmdc:mga0k408_2796_c1 3300050493 Bacteria 9272
486 nmdc:mga0k408_34801_c1 3300050493 Bacteria 2885
487 nmdc:mga0k408_52720_c2 3300050493 Bacteria 2042
488 nmdc:mga06z11_14_c1 3300050494 Bacteria 96662
489 nmdc:mga04h51_10_c1 3300050495 Bacteria 102434
490 nmdc:mga07m45_119239_c1 3300050496 Bacteria 1523
491 nmdc:mga08y16_877_c2 3300050511 Bacteria 23348
492 nmdc:mga0sz30_19388_c1 3300050516 Bacteria 2734
493 Ga0500610_0000001 3300053079 Bacteria 185468
494 Ga0500610_0059097 3300053079 Bacteria 2000
495 Ga0500643_000010 3300053087 Bacteria 408084
496 Ga0500643_004933 3300053087 Bacteria 5874
497 Ga0500644_0000433 3300053088 Bacteria 19499
498 Ga0500644_0002075 3300053088 Bacteria 5089
499 Ga0500644_0070924 3300053088 Unclassified 1256
500 Ga0500646_0001156 3300053090 Bacteria 7133
501 Ga0500583_0000052 3300053092 Bacteria 75622
502 Ga0500583_0010396 3300053092 Bacteria 3451
503 Ga0500651_0000240 3300053093 Bacteria 33761
504 Ga0500651_0093369 3300053093 Unclassified 1850
505 Ga0500650_0000001 3300053098 Bacteria 818797
506 Ga0500555_000001 3300053103 Bacteria 1353713
507 Ga0500555_000002 3300053103 Bacteria 1314346
508 Ga0500562_002567 3300053108 Bacteria 4527
509 Ga0500594_0000001 3300053118 Bacteria 1178472
510 Ga0500594_0008902 3300053118 Bacteria 2300
511 Ga0500614_002059 3300053123 Bacteria 4597
512 Ga0500628_000012 3300053129 Bacteria 106556
513 Ga0500628_004509 3300053129 Unclassified 2306
514 Ga0500642_0004360 3300053130 Bacteria 4421
515 Ga0500652_000908 3300053131 Bacteria 9761
516 Ga0500655_001261 3300053133 Bacteria 4808
517 Ga0500577_0000126 3300053142 Bacteria 18607
518 Ga0500577_0001526 3300053142 Bacteria 5900
519 Ga0500589_000016 3300053147 Bacteria 107090
520 Ga0501084_0155601 3300054114 Bacteria 1928
521 Ga0501082_0119410 3300060353 Bacteria 2285
522 Ga0501082_0316989 3300060353 Bacteria 1358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10088924 Ga0070676_100889242 195
2 3300013296 Ga0157374_10283733 Ga0157374_102837332 196
3 3300005367 Ga0070667_100015224 Ga0070667_1000152243 197
4 3300005458 Ga0070681_10011460 Ga0070681_100114602 197
5 3300005539 Ga0068853_100121450 Ga0068853_1001214502 197
6 3300005844 Ga0068862_100622640 Ga0068862_1006226402 197
7 3300010375 Ga0105239_10068207 Ga0105239_100682073 197
8 3300025912 Ga0207707_10029266 Ga0207707_100292663 197
9 3300025986 Ga0207658_10012511 Ga0207658_100125113 197
10 3300032005 Ga0307411_10523395 Ga0307411_105233952 197
11 3300038443 Ga0395901_0185373 Ga0395901_0185373_128_730 197
12 3300003323 rootH1_10027145 rootH1_100271451 198
13 3300005327 Ga0070658_10000012 Ga0070658_10000012276 198
14 3300005327 Ga0070658_10000749 Ga0070658_1000074923 198
15 3300005327 Ga0070658_10006514 Ga0070658_100065146 198
16 3300005335 Ga0070666_10121910 Ga0070666_101219102 198
17 3300005337 Ga0070682_100018362 Ga0070682_1000183623 198
18 3300005337 Ga0070682_100047342 Ga0070682_1000473423 198
19 3300005347 Ga0070668_100355315 Ga0070668_1003553152 198
20 3300005355 Ga0070671_100000001 Ga0070671_100000001493 198
21 3300005355 Ga0070671_100005518 Ga0070671_1000055189 198
22 3300005364 Ga0070673_100000224 Ga0070673_1000002244 198
23 3300005365 Ga0070688_100284522 Ga0070688_1002845222 198
24 3300005456 Ga0070678_100000168 Ga0070678_1000001682 198
25 3300005466 Ga0070685_10000215 Ga0070685_1000021517 198
26 3300005530 Ga0070679_100034475 Ga0070679_1000344756 198
27 3300005563 Ga0068855_100035025 Ga0068855_1000350256 198
28 3300005577 Ga0068857_100054742 Ga0068857_1000547422 198
29 3300005614 Ga0068856_100004495 Ga0068856_1000044952 198
30 3300005841 Ga0068863_100121525 Ga0068863_1001215252 198
31 3300005844 Ga0068862_100069409 Ga0068862_1000694094 198
32 3300006038 Ga0075365_10006814 Ga0075365_100068142 198
33 3300006051 Ga0075364_10029098 Ga0075364_100290984 198
34 3300006237 Ga0097621_100118315 Ga0097621_1001183152 198
35 3300006881 Ga0068865_100663844 Ga0068865_1006638441 198
36 3300009093 Ga0105240_10000003 Ga0105240_10000003820 198
37 3300009093 Ga0105240_10103414 Ga0105240_101034143 198
38 3300009094 Ga0111539_10193957 Ga0111539_101939572 198
39 3300009098 Ga0105245_10001120 Ga0105245_1000112012 198
40 3300009098 Ga0105245_10002882 Ga0105245_1000288213 198
41 3300009148 Ga0105243_10000001 Ga0105243_10000001471 198
42 3300009176 Ga0105242_10000135 Ga0105242_1000013521 198
43 3300009176 Ga0105242_10002027 Ga0105242_100020274 198
44 3300009545 Ga0105237_10021926 Ga0105237_100219266 198
45 3300009551 Ga0105238_10045023 Ga0105238_100450234 198
46 3300009551 Ga0105238_10162569 Ga0105238_101625693 198
47 3300010375 Ga0105239_10012962 Ga0105239_100129623 198
48 3300010375 Ga0105239_10197479 Ga0105239_101974792 198
49 3300013105 Ga0157369_10111461 Ga0157369_101114614 198
50 3300013296 Ga0157374_10000195 Ga0157374_100001956 198
51 3300013296 Ga0157374_10004281 Ga0157374_100042819 198
52 3300013296 Ga0157374_10006505 Ga0157374_100065052 198
53 3300013296 Ga0157374_10232042 Ga0157374_102320422 198
54 3300013296 Ga0157374_10288675 Ga0157374_102886752 198
55 3300013297 Ga0157378_10018720 Ga0157378_100187203 198
56 3300013307 Ga0157372_11237126 Ga0157372_112371261 198
57 3300014325 Ga0163163_10000901 Ga0163163_1000090115 198
58 3300014745 Ga0157377_10189283 Ga0157377_101892831 198
59 3300014969 Ga0157376_10000001 Ga0157376_10000001118 198
60 3300025903 Ga0207680_10265358 Ga0207680_102653582 198
61 3300025907 Ga0207645_10179509 Ga0207645_101795091 198
62 3300025909 Ga0207705_10000056 Ga0207705_10000056148 198
63 3300025909 Ga0207705_10666549 Ga0207705_106665491 198
64 3300025913 Ga0207695_10000005 Ga0207695_10000005830 198
65 3300025913 Ga0207695_10242989 Ga0207695_102429892 198
66 3300025914 Ga0207671_10106445 Ga0207671_101064453 198
67 3300025921 Ga0207652_10819230 Ga0207652_108192301 198
68 3300025927 Ga0207687_10000318 Ga0207687_100003184 198
69 3300025927 Ga0207687_10018679 Ga0207687_100186793 198
70 3300025927 Ga0207687_10593150 Ga0207687_105931501 198
71 3300025931 Ga0207644_10000001 Ga0207644_10000001943 198
72 3300025931 Ga0207644_10012913 Ga0207644_100129133 198
73 3300025934 Ga0207686_10000001 Ga0207686_10000001671 198
74 3300025935 Ga0207709_10000002 Ga0207709_10000002789 198
75 3300025938 Ga0207704_10702491 Ga0207704_107024911 198
76 3300025949 Ga0207667_10045310 Ga0207667_100453106 198
77 3300025949 Ga0207667_10730992 Ga0207667_107309921 198
78 3300025960 Ga0207651_10000167 Ga0207651_100001674 198
79 3300026078 Ga0207702_10026887 Ga0207702_100268872 198
80 3300026116 Ga0207674_10161712 Ga0207674_101617122 198
81 3300026121 Ga0207683_10006781 Ga0207683_100067814 198
82 3300028556 Ga0265337_1008418 Ga0265337_10084181 198
83 3300028556 Ga0265337_1022396 Ga0265337_10223961 198
84 3300028556 Ga0265337_1028742 Ga0265337_10287422 198
85 3300028558 Ga0265326_10013814 Ga0265326_100138142 198
86 3300028558 Ga0265326_10049990 Ga0265326_100499902 198
87 3300028563 Ga0265319_1019202 Ga0265319_10192022 198
88 3300028573 Ga0265334_10000049 Ga0265334_1000004944 198
89 3300028573 Ga0265334_10000184 Ga0265334_1000018431 198
90 3300028573 Ga0265334_10010854 Ga0265334_100108543 198
91 3300028577 Ga0265318_10018543 Ga0265318_100185433 198
92 3300028653 Ga0265323_10002206 Ga0265323_100022067 198
93 3300028654 Ga0265322_10002928 Ga0265322_100029282 198
94 3300028666 Ga0265336_10000932 Ga0265336_1000093213 198
95 3300028800 Ga0265338_10000003 Ga0265338_10000003474 198
96 3300028800 Ga0265338_10000192 Ga0265338_10000192116 198
97 3300028800 Ga0265338_10000543 Ga0265338_1000054368 198
98 3300028800 Ga0265338_10002691 Ga0265338_100026916 198
99 3300031235 Ga0265330_10011157 Ga0265330_100111572 198
100 3300031239 Ga0265328_10004117 Ga0265328_100041178 198
101 3300031240 Ga0265320_10006914 Ga0265320_100069142 198
102 3300031240 Ga0265320_10047520 Ga0265320_100475202 198
103 3300031241 Ga0265325_10012632 Ga0265325_100126322 198
104 3300031242 Ga0265329_10004354 Ga0265329_100043546 198
105 3300031242 Ga0265329_10069321 Ga0265329_100693212 198
106 3300031247 Ga0265340_10011307 Ga0265340_100113072 198
107 3300031249 Ga0265339_10014524 Ga0265339_100145242 198
108 3300031250 Ga0265331_10017294 Ga0265331_100172942 198
109 3300031251 Ga0265327_10000017 Ga0265327_10000017150 198
110 3300031251 Ga0265327_10013906 Ga0265327_100139065 198
111 3300031344 Ga0265316_10002349 Ga0265316_1000234917 198
112 3300031595 Ga0265313_10007818 Ga0265313_100078182 198
113 3300031595 Ga0265313_10014158 Ga0265313_100141583 198
114 3300031711 Ga0265314_10262762 Ga0265314_102627621 198
115 3300031712 Ga0265342_10008872 Ga0265342_100088726 198
116 3300031824 Ga0307413_10199172 Ga0307413_101991721 198
117 3300031995 Ga0307409_100005980 Ga0307409_1000059803 198
118 3300032126 Ga0307415_100623017 Ga0307415_1006230171 198
119 3300037418 Ga0395900_0318880 Ga0395900_0318880_553_1158 198
120 3300037471 Ga0395905_0000238 Ga0395905_0000238_42599_43204 198
121 3300038443 Ga0395901_0004611 Ga0395901_0004611_8886_9494 198
122 3300045976 Ga0466967_0358727 Ga0466967_0358727_22_630 198
123 3300047472 Ga0495686_0176640 Ga0495686_0176640_181_795 198
124 3300048911 Ga0496108_0350579 Ga0496108_0350579_560_1168 198
125 3300049571 Ga0501034_0040229 Ga0501034_0040229_3139_3738 198
126 3300049572 Ga0501036_0139194 Ga0501036_0139194_910_1533 198
127 3300049575 Ga0501039_0506712 Ga0501039_0506712_75_698 198
128 3300049584 Ga0501068_0012002 Ga0501068_0012002_1522_2145 198
129 3300049586 Ga0501070_0063235 Ga0501070_0063235_428_1027 198
130 3300049589 Ga0501073_0022322 Ga0501073_0022322_1087_1710 198
131 3300049590 Ga0501074_0049930 Ga0501074_0049930_806_1429 198
132 3300049592 Ga0501076_0196782 Ga0501076_0196782_494_1117 198
133 3300049742 Ga0501080_0004501 Ga0501080_0004501_2429_3052 198
134 3300053090 Ga0500646_0001156 Ga0500646_0001156_2778_3383 198
135 3300053092 Ga0500583_0010396 Ga0500583_0010396_1575_2180 198
136 3300053093 Ga0500651_0000240 Ga0500651_0000240_17185_17790 198
137 3300053093 Ga0500651_0093369 Ga0500651_0093369_309_914 198
138 3300053098 Ga0500650_0000001 Ga0500650_0000001_474085_474690 198
139 3300053108 Ga0500562_002567 Ga0500562_002567_752_1357 198
140 3300053118 Ga0500594_0000001 Ga0500594_0000001_1135159_1135764 198
141 3300053123 Ga0500614_002059 Ga0500614_002059_69_674 198
142 3300053133 Ga0500655_001261 Ga0500655_001261_4118_4723 198
143 3300053142 Ga0500577_0000126 Ga0500577_0000126_1935_2540 198
144 3300054114 Ga0501084_0155601 Ga0501084_0155601_85_708 198
145 3300060353 Ga0501082_0119410 Ga0501082_0119410_930_1553 198
146 3300009174 Ga0105241_10001167 Ga0105241_1000116713 199
147 3300009979 Ga0105032_101443 Ga0105032_1014433 199
148 3300009993 Ga0105028_100239 Ga0105028_1002393 199
149 3300014745 Ga0157377_10514643 Ga0157377_105146432 199
150 3300025911 Ga0207654_10000623 Ga0207654_1000062313 199
151 3300028381 Ga0268264_10029493 Ga0268264_100294931 199
152 3300031344 Ga0265316_10494761 Ga0265316_104947611 199
153 3300031507 Ga0307509_10017574 Ga0307509_100175743 199
154 3300032002 Ga0307416_101557637 Ga0307416_1015576371 199
155 3300032002 Ga0307416_101592102 Ga0307416_1015921021 199
156 3300046457 Ga0495590_0010707 Ga0495590_0010707_1333_1959 199
157 3300046491 Ga0495584_0171701 Ga0495584_0171701_387_1013 199
158 3300046519 Ga0495632_0049766 Ga0495632_0049766_1361_1987 199
159 3300046616 Ga0495668_0056991 Ga0495668_0056991_728_1354 199
160 3300047320 Ga0495672_0000016 Ga0495672_0000016_12362_12964 199
161 3300049773 Ga0501276_001600 Ga0501276_001600_76_675 199
162 3300050490 nmdc:mga03n38_90743_c1 nmdc:mga03n38_90743_c1_807_1406 199
163 3300002244 JGI24742J22300_10000550 JGI24742J22300_100005503 200
164 3300005328 Ga0070676_10002007 Ga0070676_100020076 200
165 3300005330 Ga0070690_100219495 Ga0070690_1002194952 200
166 3300005330 Ga0070690_100445045 Ga0070690_1004450451 200
167 3300005331 Ga0070670_100598424 Ga0070670_1005984241 200
168 3300005333 Ga0070677_10011554 Ga0070677_100115545 200
169 3300005337 Ga0070682_100020997 Ga0070682_1000209976 200
170 3300005337 Ga0070682_100040251 Ga0070682_1000402511 200
171 3300005337 Ga0070682_100158780 Ga0070682_1001587802 200
172 3300005340 Ga0070689_100038500 Ga0070689_1000385003 200
173 3300005345 Ga0070692_10180426 Ga0070692_101804262 200
174 3300005354 Ga0070675_100337402 Ga0070675_1003374022 200
175 3300005356 Ga0070674_100269310 Ga0070674_1002693101 200
176 3300005364 Ga0070673_100058985 Ga0070673_1000589856 200
177 3300005364 Ga0070673_101268370 Ga0070673_1012683701 200
178 3300005367 Ga0070667_100351328 Ga0070667_1003513282 200
179 3300005456 Ga0070678_100056035 Ga0070678_1000560352 200
180 3300005457 Ga0070662_100129231 Ga0070662_1001292312 200
181 3300005530 Ga0070679_100001253 Ga0070679_10000125314 200
182 3300005543 Ga0070672_100057236 Ga0070672_1000572365 200
183 3300005544 Ga0070686_100111123 Ga0070686_1001111232 200
184 3300005544 Ga0070686_100628956 Ga0070686_1006289561 200
185 3300005546 Ga0070696_100002230 Ga0070696_1000022302 200
186 3300005548 Ga0070665_100007266 Ga0070665_1000072662 200
187 3300005548 Ga0070665_100354452 Ga0070665_1003544522 200
188 3300005548 Ga0070665_100605017 Ga0070665_1006050171 200
189 3300005564 Ga0070664_100382218 Ga0070664_1003822182 200
190 3300005564 Ga0070664_100635386 Ga0070664_1006353862 200
191 3300005615 Ga0070702_100006982 Ga0070702_1000069822 200
192 3300005617 Ga0068859_100034504 Ga0068859_1000345047 200
193 3300005617 Ga0068859_100683608 Ga0068859_1006836082 200
194 3300005617 Ga0068859_100979044 Ga0068859_1009790442 200
195 3300005719 Ga0068861_100128159 Ga0068861_1001281592 200
196 3300005841 Ga0068863_100152794 Ga0068863_1001527942 200
197 3300005841 Ga0068863_100399350 Ga0068863_1003993502 200
198 3300005842 Ga0068858_100323350 Ga0068858_1003233502 200
199 3300005844 Ga0068862_100115800 Ga0068862_1001158002 200
200 3300005844 Ga0068862_100184442 Ga0068862_1001844422 200
201 3300005844 Ga0068862_100672707 Ga0068862_1006727071 200
202 3300006237 Ga0097621_100111653 Ga0097621_1001116533 200
203 3300006237 Ga0097621_100449695 Ga0097621_1004496952 200
204 3300006358 Ga0068871_100042311 Ga0068871_1000423113 200
205 3300006358 Ga0068871_100161053 Ga0068871_1001610532 200
206 3300006358 Ga0068871_100603129 Ga0068871_1006031291 200
207 3300006931 Ga0097620_100034503 Ga0097620_1000345037 200
208 3300006931 Ga0097620_100683653 Ga0097620_1006836532 200
209 3300006931 Ga0097620_100979067 Ga0097620_1009790672 200
210 3300009176 Ga0105242_10039193 Ga0105242_100391931 200
211 3300009553 Ga0105249_10453865 Ga0105249_104538652 200
212 3300013296 Ga0157374_10059165 Ga0157374_100591655 200
213 3300013297 Ga0157378_10195661 Ga0157378_101956612 200
214 3300013306 Ga0163162_10163931 Ga0163162_101639312 200
215 3300014325 Ga0163163_10041860 Ga0163163_100418602 200
216 3300014326 Ga0157380_10427173 Ga0157380_104271731 200
217 3300014969 Ga0157376_10173137 Ga0157376_101731372 200
218 3300014969 Ga0157376_10450203 Ga0157376_104502032 200
219 3300014969 Ga0157376_10726874 Ga0157376_107268741 200
220 3300025899 Ga0207642_10038812 Ga0207642_100388121 200
221 3300025901 Ga0207688_10024071 Ga0207688_100240712 200
222 3300025907 Ga0207645_10001343 Ga0207645_1000134312 200
223 3300025907 Ga0207645_10185832 Ga0207645_101858322 200
224 3300025918 Ga0207662_10024328 Ga0207662_100243284 200
225 3300025921 Ga0207652_10001646 Ga0207652_100016464 200
226 3300025925 Ga0207650_10712118 Ga0207650_107121182 200
227 3300025926 Ga0207659_10097745 Ga0207659_100977452 200
228 3300025933 Ga0207706_10255096 Ga0207706_102550962 200
229 3300025937 Ga0207669_10400099 Ga0207669_104000991 200
230 3300025940 Ga0207691_10055068 Ga0207691_100550682 200
231 3300025941 Ga0207711_10104737 Ga0207711_101047372 200
232 3300025942 Ga0207689_10028693 Ga0207689_100286932 200
233 3300025960 Ga0207651_10200350 Ga0207651_102003502 200
234 3300025960 Ga0207651_10659669 Ga0207651_106596691 200
235 3300026023 Ga0207677_10753632 Ga0207677_107536322 200
236 3300026075 Ga0207708_10219699 Ga0207708_102196992 200
237 3300026088 Ga0207641_10080881 Ga0207641_100808813 200
238 3300026088 Ga0207641_10166948 Ga0207641_101669482 200
239 3300026095 Ga0207676_10386988 Ga0207676_103869881 200
240 3300026118 Ga0207675_100134965 Ga0207675_1001349653 200
241 3300026118 Ga0207675_100296036 Ga0207675_1002960362 200
242 3300026121 Ga0207683_10035541 Ga0207683_100355413 200
243 3300028379 Ga0268266_10043318 Ga0268266_100433184 200
244 3300028380 Ga0268265_10106417 Ga0268265_101064172 200
245 3300028381 Ga0268264_10051447 Ga0268264_100514472 200
246 3300028381 Ga0268264_11578875 Ga0268264_115788751 200
247 3300031456 Ga0307513_10042035 Ga0307513_100420353 200
248 3300031456 Ga0307513_10514310 Ga0307513_105143101 200
249 3300031548 Ga0307408_100016814 Ga0307408_1000168142 200
250 3300031731 Ga0307405_10254950 Ga0307405_102549502 200
251 3300031824 Ga0307413_10018409 Ga0307413_100184092 200
252 3300031852 Ga0307410_10389398 Ga0307410_103893981 200
253 3300031901 Ga0307406_10020251 Ga0307406_100202512 200
254 3300031903 Ga0307407_10008467 Ga0307407_100084676 200
255 3300031995 Ga0307409_100097140 Ga0307409_1000971402 200
256 3300032002 Ga0307416_100186112 Ga0307416_1001861122 200
257 3300032005 Ga0307411_10006259 Ga0307411_100062592 200
258 3300041486 Ga0451807_0051513 Ga0451807_0051513_257_883 200
259 3300046458 Ga0495591_048562 Ga0495591_048562_423_1046 200
260 3300046460 Ga0495638_0052126 Ga0495638_0052126_1245_1868 200
261 3300046692 Ga0495671_0075124 Ga0495671_0075124_893_1516 200
262 3300048917 Ga0496114_0071893 Ga0496114_0071893_379_1002 200
263 3300049591 Ga0501075_0389221 Ga0501075_0389221_58_681 200
264 3300005327 Ga0070658_10008460 Ga0070658_100084608 201
265 3300005329 Ga0070683_100000138 Ga0070683_10000013811 201
266 3300005336 Ga0070680_100538554 Ga0070680_1005385542 201
267 3300005341 Ga0070691_10036818 Ga0070691_100368182 201
268 3300005366 Ga0070659_100000215 Ga0070659_1000002152 201
269 3300005535 Ga0070684_100000229 Ga0070684_10000022916 201
270 3300005544 Ga0070686_100010226 Ga0070686_1000102263 201
271 3300005563 Ga0068855_100000003 Ga0068855_100000003113 201
272 3300006042 Ga0075368_10000178 Ga0075368_100001785 201
273 3300006048 Ga0075363_100000185 Ga0075363_1000001852 201
274 3300006051 Ga0075364_10002401 Ga0075364_100024015 201
275 3300006178 Ga0075367_10000441 Ga0075367_100004413 201
276 3300006186 Ga0075369_10000005 Ga0075369_10000005115 201
277 3300009174 Ga0105241_10000003 Ga0105241_10000003189 201
278 3300009993 Ga0105028_100282 Ga0105028_1002822 201
279 3300013105 Ga0157369_10000945 Ga0157369_1000094515 201
280 3300025911 Ga0207654_10000002 Ga0207654_100000021020 201
281 3300025944 Ga0207661_10000021 Ga0207661_10000021134 201
282 3300025949 Ga0207667_10000008 Ga0207667_10000008112 201
283 3300025961 Ga0207712_10005674 Ga0207712_100056743 201
284 3300027866 Ga0209813_10000009 Ga0209813_100000095 201
285 3300031251 Ga0265327_10003790 Ga0265327_100037902 201
286 3300037312 Ga0395899_0133016 Ga0395899_0133016_501_1106 201
287 3300037418 Ga0395900_0000232 Ga0395900_0000232_909_1514 201
288 3300037466 Ga0395898_0044080 Ga0395898_0044080_412_1017 201
289 3300050490 nmdc:mga03n38_2194_c1 nmdc:mga03n38_2194_c1_209_820 201
290 3300050491 nmdc:mga00v17_11937_c1 nmdc:mga00v17_11937_c1_502_1110 201
291 3300050493 nmdc:mga0k408_52720_c2 nmdc:mga0k408_52720_c2_400_1005 201
292 3300050494 nmdc:mga06z11_14_c1 nmdc:mga06z11_14_c1_63088_63699 201
293 3300050495 nmdc:mga04h51_10_c1 nmdc:mga04h51_10_c1_3599_4210 201
294 3300053087 Ga0500643_000010 Ga0500643_000010_356400_357005 201
295 3300053103 Ga0500555_000001 Ga0500555_000001_747009_747614 201
296 3300001990 JGI24737J22298_10000026 JGI24737J22298_1000002622 202
297 3300002067 JGI24735J21928_10000080 JGI24735J21928_1000008022 202
298 3300003320 rootH2_10000244 rootH2_10000244383 202
299 3300005329 Ga0070683_100202928 Ga0070683_1002029282 202
300 3300005330 Ga0070690_100004663 Ga0070690_1000046639 202
301 3300005337 Ga0070682_100057150 Ga0070682_1000571502 202
302 3300005344 Ga0070661_100116494 Ga0070661_1001164942 202
303 3300005355 Ga0070671_100003481 Ga0070671_10000348112 202
304 3300005356 Ga0070674_100000707 Ga0070674_10000070711 202
305 3300005366 Ga0070659_100079412 Ga0070659_1000794123 202
306 3300005435 Ga0070714_100000414 Ga0070714_10000041414 202
307 3300005455 Ga0070663_100039029 Ga0070663_1000390291 202
308 3300005530 Ga0070679_101203063 Ga0070679_1012030631 202
309 3300005539 Ga0068853_100140417 Ga0068853_1001404171 202
310 3300005539 Ga0068853_100691855 Ga0068853_1006918552 202
311 3300005546 Ga0070696_100069665 Ga0070696_1000696652 202
312 3300005547 Ga0070693_100147407 Ga0070693_1001474071 202
313 3300005563 Ga0068855_100000168 Ga0068855_100000168105 202
314 3300005577 Ga0068857_100003251 Ga0068857_1000032519 202
315 3300005614 Ga0068856_100313279 Ga0068856_1003132792 202
316 3300005616 Ga0068852_100230983 Ga0068852_1002309832 202
317 3300005617 Ga0068859_100811211 Ga0068859_1008112112 202
318 3300005841 Ga0068863_100086427 Ga0068863_1000864274 202
319 3300005841 Ga0068863_100244749 Ga0068863_1002447492 202
320 3300006038 Ga0075365_10101693 Ga0075365_101016932 202
321 3300006195 Ga0075366_10000294 Ga0075366_1000029423 202
322 3300006195 Ga0075366_10036915 Ga0075366_100369152 202
323 3300006195 Ga0075366_10038807 Ga0075366_100388073 202
324 3300006195 Ga0075366_10190554 Ga0075366_101905542 202
325 3300006237 Ga0097621_100000264 Ga0097621_1000002649 202
326 3300006358 Ga0068871_100001704 Ga0068871_1000017048 202
327 3300006844 Ga0075428_100001893 Ga0075428_1000018933 202
328 3300006931 Ga0097620_100811325 Ga0097620_1008113252 202
329 3300009093 Ga0105240_10250035 Ga0105240_102500352 202
330 3300009094 Ga0111539_10002740 Ga0111539_1000274017 202
331 3300009098 Ga0105245_10000002 Ga0105245_10000002226 202
332 3300009098 Ga0105245_11022724 Ga0105245_110227241 202
333 3300009148 Ga0105243_10004400 Ga0105243_100044004 202
334 3300009551 Ga0105238_10783265 Ga0105238_107832651 202
335 3300009553 Ga0105249_10004554 Ga0105249_100045546 202
336 3300009987 Ga0105030_100547 Ga0105030_1005471 202
337 3300013102 Ga0157371_10001081 Ga0157371_1000108120 202
338 3300013104 Ga0157370_10608333 Ga0157370_106083332 202
339 3300013296 Ga0157374_10000031 Ga0157374_10000031145 202
340 3300013296 Ga0157374_10000945 Ga0157374_1000094517 202
341 3300013296 Ga0157374_10572344 Ga0157374_105723441 202
342 3300013307 Ga0157372_10021984 Ga0157372_100219842 202
343 3300013874 Ga0157514_121816 Ga0157514_1218161 202
344 3300014745 Ga0157377_10015405 Ga0157377_100154053 202
345 3300014968 Ga0157379_10024555 Ga0157379_100245553 202
346 3300025909 Ga0207705_10000011 Ga0207705_10000011295 202
347 3300025909 Ga0207705_10007548 Ga0207705_100075481 202
348 3300025912 Ga0207707_10784560 Ga0207707_107845601 202
349 3300025913 Ga0207695_10205812 Ga0207695_102058122 202
350 3300025917 Ga0207660_10068430 Ga0207660_100684303 202
351 3300025920 Ga0207649_10304525 Ga0207649_103045251 202
352 3300025927 Ga0207687_10000001 Ga0207687_10000001985 202
353 3300025929 Ga0207664_10000883 Ga0207664_100008836 202
354 3300025932 Ga0207690_10020866 Ga0207690_100208662 202
355 3300025932 Ga0207690_10048346 Ga0207690_100483463 202
356 3300025935 Ga0207709_10078122 Ga0207709_100781223 202
357 3300025944 Ga0207661_10085020 Ga0207661_100850202 202
358 3300025949 Ga0207667_10000339 Ga0207667_100003393 202
359 3300025949 Ga0207667_10079387 Ga0207667_100793872 202
360 3300026041 Ga0207639_10018683 Ga0207639_100186833 202
361 3300026067 Ga0207678_10448417 Ga0207678_104484172 202
362 3300026088 Ga0207641_10400679 Ga0207641_104006792 202
363 3300026116 Ga0207674_10000001 Ga0207674_10000001420 202
364 3300026116 Ga0207674_10003175 Ga0207674_100031758 202
365 3300026142 Ga0207698_10099825 Ga0207698_100998252 202
366 3300027907 Ga0207428_10006907 Ga0207428_100069075 202
367 3300028558 Ga0265326_10000600 Ga0265326_100006003 202
368 3300028558 Ga0265326_10003561 Ga0265326_100035611 202
369 3300028573 Ga0265334_10002192 Ga0265334_1000219213 202
370 3300028573 Ga0265334_10009267 Ga0265334_100092674 202
371 3300028573 Ga0265334_10017783 Ga0265334_100177833 202
372 3300028573 Ga0265334_10096242 Ga0265334_100962422 202
373 3300028654 Ga0265322_10009746 Ga0265322_100097462 202
374 3300028654 Ga0265322_10031760 Ga0265322_100317603 202
375 3300028654 Ga0265322_10037035 Ga0265322_100370352 202
376 3300028654 Ga0265322_10094326 Ga0265322_100943262 202
377 3300028666 Ga0265336_10000047 Ga0265336_1000004712 202
378 3300028666 Ga0265336_10004866 Ga0265336_100048666 202
379 3300028666 Ga0265336_10004878 Ga0265336_100048785 202
380 3300028800 Ga0265338_10000052 Ga0265338_1000005291 202
381 3300028800 Ga0265338_10000130 Ga0265338_10000130163 202
382 3300028800 Ga0265338_10002183 Ga0265338_100021832 202
383 3300028800 Ga0265338_10002202 Ga0265338_100022022 202
384 3300028800 Ga0265338_10015999 Ga0265338_100159992 202
385 3300028800 Ga0265338_10112684 Ga0265338_101126842 202
386 3300028800 Ga0265338_10175256 Ga0265338_101752562 202
387 3300028800 Ga0265338_10249942 Ga0265338_102499422 202
388 3300029957 Ga0265324_10008768 Ga0265324_100087682 202
389 3300031240 Ga0265320_10161735 Ga0265320_101617351 202
390 3300031241 Ga0265325_10034899 Ga0265325_100348992 202
391 3300031249 Ga0265339_10216219 Ga0265339_102162191 202
392 3300031251 Ga0265327_10023151 Ga0265327_100231514 202
393 3300031251 Ga0265327_10026045 Ga0265327_100260453 202
394 3300031344 Ga0265316_10118652 Ga0265316_101186521 202
395 3300031711 Ga0265314_10364139 Ga0265314_103641391 202
396 3300037312 Ga0395899_0142040 Ga0395899_0142040_654_1262 202
397 3300037418 Ga0395900_0001560 Ga0395900_0001560_17635_18243 202
398 3300037418 Ga0395900_0022671 Ga0395900_0022671_162_770 202
399 3300037418 Ga0395900_0084321 Ga0395900_0084321_1551_2177 202
400 3300037466 Ga0395898_0017849 Ga0395898_0017849_5586_6194 202
401 3300037466 Ga0395898_0154499 Ga0395898_0154499_948_1574 202
402 3300037471 Ga0395905_1017172 Ga0395905_1017172_55_663 202
403 3300038443 Ga0395901_0069439 Ga0395901_0069439_216_824 202
404 3300048088 Ga0495602_0710007 Ga0495602_0710007_18_635 202
405 3300048917 Ga0496114_1087632 Ga0496114_1087632_33_650 202
406 3300049571 Ga0501034_0005296 Ga0501034_0005296_1086_1694 202
407 3300049578 Ga0501042_0469018 Ga0501042_0469018_209_817 202
408 3300049579 Ga0501043_0424538 Ga0501043_0424538_217_825 202
409 3300049581 Ga0501047_0000229 Ga0501047_0000229_44509_45117 202
410 3300049582 Ga0501048_0038797 Ga0501048_0038797_86_694 202
411 3300049586 Ga0501070_0042904 Ga0501070_0042904_2619_3227 202
412 3300049586 Ga0501070_0647645 Ga0501070_0647645_48_656 202
413 3300049589 Ga0501073_0388359 Ga0501073_0388359_299_907 202
414 3300049742 Ga0501080_0002131 Ga0501080_0002131_4162_4770 202
415 3300049822 Ga0501035_0000033 Ga0501035_0000033_142553_143161 202
416 3300050489 nmdc:mga03683_40075_c1 nmdc:mga03683_40075_c1_648_1259 202
417 3300050491 nmdc:mga00v17_222845_c1 nmdc:mga00v17_222845_c1_120_728 202
418 3300050492 nmdc:mga0yw44_211217_c1 nmdc:mga0yw44_211217_c1_80_691 202
419 3300050493 nmdc:mga0k408_184060_c1 nmdc:mga0k408_184060_c1_230_871 202
420 3300050493 nmdc:mga0k408_2796_c1 nmdc:mga0k408_2796_c1_2139_2747 202
421 3300050493 nmdc:mga0k408_34801_c1 nmdc:mga0k408_34801_c1_1483_2091 202
422 3300050511 nmdc:mga08y16_877_c2 nmdc:mga08y16_877_c2_16863_17471 202
423 3300053079 Ga0500610_0000001 Ga0500610_0000001_80240_80848 202
424 3300053079 Ga0500610_0059097 Ga0500610_0059097_125_736 202
425 3300053087 Ga0500643_004933 Ga0500643_004933_1786_2394 202
426 3300053088 Ga0500644_0000433 Ga0500644_0000433_4938_5546 202
427 3300053088 Ga0500644_0002075 Ga0500644_0002075_1439_2062 202
428 3300053088 Ga0500644_0070924 Ga0500644_0070924_543_1154 202
429 3300053092 Ga0500583_0000052 Ga0500583_0000052_37438_38049 202
430 3300053103 Ga0500555_000002 Ga0500555_000002_495570_496178 202
431 3300053118 Ga0500594_0008902 Ga0500594_0008902_812_1420 202
432 3300053129 Ga0500628_000012 Ga0500628_000012_86968_87576 202
433 3300053129 Ga0500628_004509 Ga0500628_004509_848_1456 202
434 3300053130 Ga0500642_0004360 Ga0500642_0004360_2226_2837 202
435 3300053131 Ga0500652_000908 Ga0500652_000908_3007_3615 202
436 3300053142 Ga0500577_0001526 Ga0500577_0001526_552_1175 202
437 3300053147 Ga0500589_000016 Ga0500589_000016_94984_95595 202
438 3300001915 JGI24741J21665_1012158 JGI24741J21665_10121582 203
439 3300001979 JGI24740J21852_10009297 JGI24740J21852_100092972 203
440 3300001979 JGI24740J21852_10015574 JGI24740J21852_100155742 203
441 3300003316 rootH1_10127459 rootH1_101274594 203
442 3300005327 Ga0070658_10003292 Ga0070658_100032928 203
443 3300005327 Ga0070658_10011034 Ga0070658_100110344 203
444 3300005329 Ga0070683_100000261 Ga0070683_1000002614 203
445 3300005336 Ga0070680_100020037 Ga0070680_1000200377 203
446 3300005339 Ga0070660_100002116 Ga0070660_1000021164 203
447 3300005458 Ga0070681_10030555 Ga0070681_100305552 203
448 3300005458 Ga0070681_10246826 Ga0070681_102468262 203
449 3300005458 Ga0070681_10295373 Ga0070681_102953733 203
450 3300005530 Ga0070679_100004133 Ga0070679_1000041336 203
451 3300005530 Ga0070679_100005147 Ga0070679_1000051479 203
452 3300005530 Ga0070679_100080166 Ga0070679_1000801662 203
453 3300005563 Ga0068855_100648275 Ga0068855_1006482751 203
454 3300005563 Ga0068855_100873016 Ga0068855_1008730161 203
455 3300005577 Ga0068857_100038915 Ga0068857_1000389153 203
456 3300005614 Ga0068856_100005703 Ga0068856_1000057037 203
457 3300006038 Ga0075365_10012916 Ga0075365_100129163 203
458 3300006186 Ga0075369_10033192 Ga0075369_100331922 203
459 3300006186 Ga0075369_10119290 Ga0075369_101192901 203
460 3300006195 Ga0075366_10003895 Ga0075366_100038953 203
461 3300009093 Ga0105240_10118792 Ga0105240_101187922 203
462 3300009093 Ga0105240_10147902 Ga0105240_101479022 203
463 3300009093 Ga0105240_10208981 Ga0105240_102089812 203
464 3300009093 Ga0105240_10240709 Ga0105240_102407092 203
465 3300009098 Ga0105245_10024526 Ga0105245_100245262 203
466 3300009174 Ga0105241_10020185 Ga0105241_100201854 203
467 3300009174 Ga0105241_10168688 Ga0105241_101686882 203
468 3300009174 Ga0105241_10178429 Ga0105241_101784292 203
469 3300009176 Ga0105242_10143567 Ga0105242_101435672 203
470 3300009551 Ga0105238_10000579 Ga0105238_100005799 203
471 3300009986 Ga0105033_100036 Ga0105033_1000362 203
472 3300011119 Ga0105246_10383007 Ga0105246_103830072 203
473 3300013100 Ga0157373_10000042 Ga0157373_10000042111 203
474 3300013104 Ga0157370_10380625 Ga0157370_103806252 203
475 3300013307 Ga0157372_10249605 Ga0157372_102496053 203
476 3300013308 Ga0157375_11068682 Ga0157375_110686822 203
477 3300014325 Ga0163163_10001150 Ga0163163_100011509 203
478 3300020610 Ga0154015_1350567 Ga0154015_13505672 203
479 3300025900 Ga0207710_10061525 Ga0207710_100615252 203
480 3300025909 Ga0207705_10005398 Ga0207705_100053986 203
481 3300025911 Ga0207654_10008169 Ga0207654_100081693 203
482 3300025911 Ga0207654_10379904 Ga0207654_103799042 203
483 3300025912 Ga0207707_10033206 Ga0207707_100332062 203
484 3300025912 Ga0207707_10241068 Ga0207707_102410683 203
485 3300025912 Ga0207707_10674903 Ga0207707_106749031 203
486 3300025913 Ga0207695_10067799 Ga0207695_100677993 203
487 3300025919 Ga0207657_10018295 Ga0207657_100182953 203
488 3300025921 Ga0207652_10003497 Ga0207652_100034974 203
489 3300025921 Ga0207652_10039296 Ga0207652_100392962 203
490 3300025921 Ga0207652_10150239 Ga0207652_101502392 203
491 3300025921 Ga0207652_10505641 Ga0207652_105056412 203
492 3300025924 Ga0207694_10000232 Ga0207694_1000023218 203
493 3300025927 Ga0207687_10038561 Ga0207687_100385614 203
494 3300025944 Ga0207661_10001472 Ga0207661_1000147210 203
495 3300025949 Ga0207667_10705075 Ga0207667_107050752 203
496 3300026078 Ga0207702_10009412 Ga0207702_100094124 203
497 3300026116 Ga0207674_10183980 Ga0207674_101839803 203
498 3300028800 Ga0265338_10000054 Ga0265338_10000054173 203
499 3300028800 Ga0265338_10000178 Ga0265338_1000017878 203
500 3300028800 Ga0265338_10000366 Ga0265338_100003667 203
501 3300030733 Ga0314311_1003842 Ga0314311_10038422 203
502 3300030734 Ga0316179_1032107 Ga0316179_10321072 203
503 3300037418 Ga0395900_0088413 Ga0395900_0088413_1694_2314 203
504 3300049568 Ga0501031_0000854 Ga0501031_0000854_2465_3076 203
505 3300049569 Ga0501032_0019018 Ga0501032_0019018_2453_3064 203
506 3300049571 Ga0501034_0012563 Ga0501034_0012563_2194_2805 203
507 3300049572 Ga0501036_0023649 Ga0501036_0023649_1700_2311 203
508 3300049573 Ga0501037_0000133 Ga0501037_0000133_11309_11920 203
509 3300049574 Ga0501038_0002588 Ga0501038_0002588_4741_5352 203
510 3300049579 Ga0501043_0000404 Ga0501043_0000404_10478_11089 203
511 3300049580 Ga0501046_0000038 Ga0501046_0000038_138269_138880 203
512 3300049581 Ga0501047_0001085 Ga0501047_0001085_19015_19626 203
513 3300049582 Ga0501048_0000033 Ga0501048_0000033_25683_26294 203
514 3300049586 Ga0501070_0017110 Ga0501070_0017110_1272_1883 203
515 3300049744 Ga0501083_0025708 Ga0501083_0025708_985_1596 203
516 3300049822 Ga0501035_0000562 Ga0501035_0000562_14408_15019 203
517 3300049823 Ga0501044_0268590 Ga0501044_0268590_18_629 203
518 3300050492 nmdc:mga0yw44_114190_c1 nmdc:mga0yw44_114190_c1_14_625 203
519 3300050493 nmdc:mga0k408_24_c2 nmdc:mga0k408_24_c2_21892_22503 203
520 3300050496 nmdc:mga07m45_119239_c1 nmdc:mga07m45_119239_c1_881_1498 203
521 3300050516 nmdc:mga0sz30_19388_c1 nmdc:mga0sz30_19388_c1_562_1173 203
522 3300060353 Ga0501082_0316989 Ga0501082_0316989_301_912 203

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00574

CLP_protease

Clp protease

62

243

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p81-assembly1.cif.gz_K crystal structure of clpp from bacillus subtilis in complex with adep2 (compact state) 0.9927 24 197
2zl2-assembly1.cif.gz_J crystal structure of h.pylori clpp in complex with the peptide nvlgftq 0.9906 25 197
3hln-assembly2.cif.gz_T crystal structure of clpp a153c mutant with inter-heptamer disulfide bonds 0.9895 25 199
6hwn-assembly1.cif.gz_G-2 structure of thermus thermophilus clpp in complex with a tripeptide. 0.9893 9 199
6mx2-assembly8.cif.gz_H crystal structure of clpp1 from clostridium difficile 630. 0.9893 24 199
ID Description Score Start End Superfamily
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9869 25 199 3.90.226.10
af_Q2PMR0_6_196_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9665 11 198 3.90.226.10
1yg8S00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9597 25 199 3.90.226.10
af_A0A0R0FC89_136_330_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9539 11 202 3.90.226.10
af_Q2PMR0_6_196_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9467 11 198 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A428VV44-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 1.003 26 123 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117
AF-A0A4V2G9R4-F1-model_v4 ATP-dependent Clp protease proteolytic subunit (EC 3.4.21.92) (Endopeptidase Clp) 0.9971 26 196 GO:0004176
GO:0004252
GO:0005737
GO:0006515
GO:0009368
GO:0051117
AF-C6TL65-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9971 28 126 GO:0004176
GO:0004252
GO:0006508
GO:0009532
AF-A0A421AJB6-F1-model_v4 deleted 0.9952 26 198
AF-A0A1H2VC78-F1-model_v4 ATP-dependent Clp protease proteolytic subunit 0.9952 107 196 GO:0004176
GO:0004252
GO:0006515
GO:0009368
GO:0051117

Feature Viewer

pLDDT pTM Quality
92.11 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map