F458755

General Info

Members Datasets Scaffolds Average Seq Length
521 267 1042 73

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0379486|Ga0496115_0379486_853_1113
Length 86
Sequence VATRTETLEITGIRCERCVHRLAGVLRGHDGLEFANANLMGEVTLSWDDERTDREALLTAMATGGFHEAPAPVSPAASPSGERKVG

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
89 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
90 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
91 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
166 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
167 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
170 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
171 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
174 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
175 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
178 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
179 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
180 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
181 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
182 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
183 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
184 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
202 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
203 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
207 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
228 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
229 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.77
Nodule 0
Rhizoplane 7.49
Rhizosphere 91.55
Stem 0
Stem Tuber 0
Unclassified 41.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0379486 3300048918 Archaea 1150
2 JGI24747J21853_1003021 3300001978 Bacteria 1427
3 JGI24738J21930_10076171 3300002075 Unclassified 699
4 JGI24033J26618_1031753 3300002155 Unclassified 712
5 JGI24751J29686_10058942 3300002459 Unclassified 791
6 Ga0070683_100126386 3300005329 Unclassified 2417
7 Ga0070690_100037337 3300005330 Bacteria 3061
8 Ga0070670_100021366 3300005331 Bacteria 5569
9 Ga0070677_10155076 3300005333 Unclassified 1069
10 Ga0068869_100046443 3300005334 Unclassified 3132
11 Ga0070680_101779957 3300005336 Bacteria 534
12 Ga0070682_100211148 3300005337 Unclassified 1376
13 Ga0070682_101762479 3300005337 Unclassified 539
14 Ga0068868_100681177 3300005338 Unclassified 918
15 Ga0068868_100682112 3300005338 Archaea 918
16 Ga0070689_100021737 3300005340 Bacteria 4781
17 Ga0070689_100854742 3300005340 Unclassified 803
18 Ga0070668_100079460 3300005347 Unclassified 2568
19 Ga0070668_101765978 3300005347 Unclassified 569
20 Ga0070668_102003723 3300005347 Bacteria 534
21 Ga0070675_100106902 3300005354 Bacteria 2362
22 Ga0070675_100126955 3300005354 Unclassified 2171
23 Ga0070675_100244662 3300005354 Bacteria 1568
24 Ga0070675_100407382 3300005354 Unclassified 1214
25 Ga0070671_100097252 3300005355 Unclassified 2469
26 Ga0070671_100672685 3300005355 Unclassified 897
27 Ga0070674_100018268 3300005356 Bacteria 4429
28 Ga0070674_100040351 3300005356 Unclassified 3157
29 Ga0070674_100040566 3300005356 Unclassified 3150
30 Ga0070674_101113731 3300005356 Unclassified 698
31 Ga0070673_100203298 3300005364 Unclassified 1707
32 Ga0070673_100454361 3300005364 Unclassified 1153
33 Ga0070688_100017728 3300005365 Bacteria 4091
34 Ga0070667_100726212 3300005367 Unclassified 920
35 Ga0070709_10381064 3300005434 Unclassified 1048
36 Ga0070714_100145529 3300005435 Bacteria 2131
37 Ga0070713_100823409 3300005436 Unclassified 890
38 Ga0070710_10074874 3300005437 Unclassified 1960
39 Ga0070701_10025373 3300005438 Bacteria 2878
40 Ga0070701_10472174 3300005438 Bacteria 809
41 Ga0070711_100890419 3300005439 Unclassified 759
42 Ga0070705_100280325 3300005440 Unclassified 1185
43 Ga0070705_101592182 3300005440 Unclassified 549
44 Ga0070700_100011967 3300005441 Unclassified 4821
45 Ga0070700_100458194 3300005441 Unclassified 972
46 Ga0070694_100098234 3300005444 Unclassified 2067
47 Ga0070708_101051114 3300005445 Bacteria 763
48 Ga0070663_100066527 3300005455 Bacteria 2611
49 Ga0070678_100029589 3300005456 Bacteria 3753
50 Ga0070678_100074207 3300005456 Bacteria 2556
51 Ga0070678_100153231 3300005456 Bacteria 1859
52 Ga0070678_100218330 3300005456 Bacteria 1584
53 Ga0070678_101122994 3300005456 Unclassified 726
54 Ga0070662_101958668 3300005457 Bacteria 506
55 Ga0070681_11309926 3300005458 Bacteria 647
56 Ga0068867_100078166 3300005459 Unclassified 2488
57 Ga0068867_100145086 3300005459 Bacteria 1859
58 Ga0068867_100550751 3300005459 Unclassified 999
59 Ga0070685_10010311 3300005466 Bacteria 4852
60 Ga0070685_10813552 3300005466 Unclassified 690
61 Ga0070706_100316409 3300005467 Unclassified 1456
62 Ga0070706_100361483 3300005467 Unclassified 1353
63 Ga0070706_101325492 3300005467 Unclassified 660
64 Ga0070707_100004270 3300005468 Bacteria 13381
65 Ga0070698_101234875 3300005471 Unclassified 697
66 Ga0070699_100294620 3300005518 Unclassified 1455
67 Ga0070684_100142611 3300005535 Bacteria 2167
68 Ga0070684_100562556 3300005535 Bacteria 1059
69 Ga0070684_101190518 3300005535 Unclassified 717
70 Ga0070672_100096470 3300005543 Bacteria 2392
71 Ga0070672_100933725 3300005543 Unclassified 767
72 Ga0070686_100029807 3300005544 Bacteria 3324
73 Ga0070686_100031796 3300005544 Bacteria 3230
74 Ga0070695_100257423 3300005545 Bacteria 1273
75 Ga0070695_101740911 3300005545 Unclassified 522
76 Ga0070696_100233008 3300005546 Unclassified 1386
77 Ga0070693_100009443 3300005547 Bacteria 4851
78 Ga0070693_100790609 3300005547 Unclassified 702
79 Ga0070693_101221074 3300005547 Unclassified 578
80 Ga0070665_100121838 3300005548 Bacteria 2609
81 Ga0070665_102224230 3300005548 Bacteria 552
82 Ga0070704_101583958 3300005549 Unclassified 604
83 Ga0070664_100055280 3300005564 Bacteria 3369
84 Ga0068857_100524306 3300005577 Bacteria 1114
85 Ga0068857_100567072 3300005577 Unclassified 1071
86 Ga0068857_102238258 3300005577 Bacteria 537
87 Ga0068854_100275313 3300005578 Unclassified 1353
88 Ga0068856_100491044 3300005614 Unclassified 1249
89 Ga0070702_100370397 3300005615 Bacteria 1015
90 Ga0070702_100408207 3300005615 Bacteria 974
91 Ga0070702_100997363 3300005615 Unclassified 663
92 Ga0068859_101193959 3300005617 Unclassified 838
93 Ga0068859_102978741 3300005617 Archaea 518
94 Ga0068864_100028818 3300005618 Bacteria 4697
95 Ga0068866_10161731 3300005718 Bacteria 1306
96 Ga0068866_10336440 3300005718 Unclassified 955
97 Ga0068866_10377706 3300005718 Unclassified 908
98 Ga0068870_10002293 3300005840 Bacteria 7948
99 Ga0068870_10058114 3300005840 Bacteria 2070
100 Ga0068870_10916825 3300005840 Unclassified 620
101 Ga0068870_10939729 3300005840 Unclassified 613
102 Ga0081538_10157635 3300005981 Unclassified 1015
103 Ga0081540_1005963 3300005983 Bacteria 8978
104 Ga0081540_1010007 3300005983 Bacteria 6454
105 Ga0081539_10001695 3300005985 Bacteria 35543
106 Ga0070717_10285851 3300006028 Unclassified 1463
107 Ga0075365_10157139 3300006038 Unclassified 1583
108 Ga0075365_10444852 3300006038 Bacteria 915
109 Ga0075364_10344788 3300006051 Unclassified 1015
110 Ga0070715_10149286 3300006163 Unclassified 1143
111 Ga0070712_100282073 3300006175 Bacteria 1338
112 Ga0097621_100788971 3300006237 Unclassified 879
113 Ga0097621_101247618 3300006237 Unclassified 701
114 Ga0097621_101989435 3300006237 Bacteria 555
115 Ga0068871_100260184 3300006358 Unclassified 1513
116 Ga0068871_101697953 3300006358 Unclassified 599
117 Ga0068871_102025407 3300006358 Unclassified 548
118 Ga0075428_100258479 3300006844 Bacteria 1875
119 Ga0075428_102110038 3300006844 Unclassified 583
120 Ga0075430_100198466 3300006846 Bacteria 1666
121 Ga0075430_101075537 3300006846 Unclassified 662
122 Ga0075431_100106023 3300006847 Bacteria 2899
123 Ga0075431_100992450 3300006847 Bacteria 807
124 Ga0075431_101521081 3300006847 Unclassified 627
125 Ga0075431_101719452 3300006847 Unclassified 584
126 Ga0075433_10146498 3300006852 Bacteria 2099
127 Ga0075433_10246476 3300006852 Bacteria 1586
128 Ga0075433_10860688 3300006852 Unclassified 791
129 Ga0075434_100057508 3300006871 Bacteria 3865
130 Ga0075434_100286030 3300006871 Unclassified 1668
131 Ga0075434_100581771 3300006871 Unclassified 1139
132 Ga0075429_100350399 3300006880 Bacteria 1293
133 Ga0068865_100013978 3300006881 Bacteria 5093
134 Ga0068865_100044578 3300006881 Bacteria 3036
135 Ga0068865_100727052 3300006881 Bacteria 851
136 Ga0068865_100849229 3300006881 Bacteria 791
137 Ga0075436_100063835 3300006914 Bacteria 2545
138 Ga0075436_100139120 3300006914 Bacteria 1705
139 Ga0075436_100961988 3300006914 Unclassified 640
140 Ga0097620_101193863 3300006931 Unclassified 838
141 Ga0097620_102978869 3300006931 Archaea 518
142 Ga0075435_100037368 3300007076 Bacteria 3866
143 Ga0075435_100171597 3300007076 Bacteria 1830
144 Ga0075435_100247466 3300007076 Unclassified 1517
145 Ga0075435_100897011 3300007076 Unclassified 773
146 Ga0111539_10033850 3300009094 Bacteria 6200
147 Ga0111539_10058882 3300009094 Bacteria 4557
148 Ga0111539_11837412 3300009094 Unclassified 702
149 Ga0111539_12622513 3300009094 Unclassified 584
150 Ga0105245_10073805 3300009098 Unclassified 3103
151 Ga0105245_10774930 3300009098 Bacteria 996
152 Ga0114129_10029356 3300009147 Bacteria 7790
153 Ga0114129_10238762 3300009147 Bacteria 2444
154 Ga0114129_10317512 3300009147 Bacteria 2072
155 Ga0114129_10380656 3300009147 Bacteria 1864
156 Ga0114129_10399143 3300009147 Unclassified 1812
157 Ga0114129_10827433 3300009147 Bacteria 1179
158 Ga0114129_11416012 3300009147 Bacteria 857
159 Ga0114129_12501385 3300009147 Unclassified 617
160 Ga0114129_12822701 3300009147 Bacteria 577
161 Ga0105243_10099251 3300009148 Unclassified 2413
162 Ga0105243_10109654 3300009148 Bacteria 2306
163 Ga0105243_10537110 3300009148 Bacteria 1115
164 Ga0105243_10870413 3300009148 Bacteria 894
165 Ga0105243_11925314 3300009148 Bacteria 624
166 Ga0105241_10015698 3300009174 Bacteria 5548
167 Ga0105242_10020189 3300009176 Bacteria 5223
168 Ga0105242_10179960 3300009176 Bacteria 1865
169 Ga0105242_10733992 3300009176 Unclassified 970
170 Ga0105242_11142037 3300009176 Bacteria 795
171 Ga0105249_10481967 3300009553 Unclassified 1283
172 Ga0105249_10586848 3300009553 Bacteria 1168
173 Ga0105249_12165184 3300009553 Unclassified 629
174 Ga0105239_10268507 3300010375 Unclassified 1918
175 Ga0105239_11676514 3300010375 Unclassified 736
176 Ga0105246_10088357 3300011119 Bacteria 2227
177 Ga0105246_10603972 3300011119 Bacteria 948
178 Ga0157329_1045239 3300012491 Unclassified 506
179 Ga0157319_1003245 3300012497 Unclassified 993
180 Ga0157339_1023425 3300012505 Unclassified 674
181 Ga0157326_1002420 3300012513 Unclassified 1998
182 Ga0157373_10278508 3300013100 Unclassified 1185
183 Ga0157374_10215823 3300013296 Unclassified 1882
184 Ga0157375_10004686 3300013308 Bacteria 11898
185 Ga0157375_10854252 3300013308 Bacteria 1056
186 Ga0157375_12248215 3300013308 Bacteria 650
187 Ga0157375_13095873 3300013308 Unclassified 555
188 Ga0163163_10070051 3300014325 Bacteria 3492
189 Ga0163163_10639955 3300014325 Bacteria 1127
190 Ga0157380_10377561 3300014326 Unclassified 1336
191 Ga0157380_10525596 3300014326 Bacteria 1155
192 Ga0157380_12134337 3300014326 Unclassified 623
193 Ga0157377_10013609 3300014745 Unclassified 4122
194 Ga0157379_10167265 3300014968 Unclassified 1985
195 Ga0157376_10015770 3300014969 Bacteria 5718
196 Ga0157376_10567571 3300014969 Bacteria 1125
197 Ga0157376_11717081 3300014969 Unclassified 663
198 Ga0207697_10280562 3300025315 Unclassified 738
199 Ga0207692_10220395 3300025898 Unclassified 1124
200 Ga0207642_10017009 3300025899 Archaea 2755
201 Ga0207642_10065533 3300025899 Bacteria 1707
202 Ga0207688_10001622 3300025901 Bacteria 11875
203 Ga0207685_10004515 3300025905 Bacteria 3552
204 Ga0207699_10706267 3300025906 Bacteria 738
205 Ga0207645_10052308 3300025907 Unclassified 2609
206 Ga0207643_10001368 3300025908 Bacteria 14056
207 Ga0207643_10009768 3300025908 Bacteria 5150
208 Ga0207643_10023538 3300025908 Bacteria 3396
209 Ga0207684_11687306 3300025910 Unclassified 511
210 Ga0207654_10382895 3300025911 Unclassified 975
211 Ga0207707_10981100 3300025912 Unclassified 694
212 Ga0207693_10246748 3300025915 Bacteria 1401
213 Ga0207663_10010033 3300025916 Bacteria 5020
214 Ga0207663_10033784 3300025916 Bacteria 3051
215 Ga0207660_10165636 3300025917 Bacteria 1708
216 Ga0207652_10408907 3300025921 Unclassified 1224
217 Ga0207646_10002759 3300025922 Bacteria 20509
218 Ga0207681_11206060 3300025923 Unclassified 636
219 Ga0207650_10075056 3300025925 Unclassified 2550
220 Ga0207650_10146234 3300025925 Bacteria 1862
221 Ga0207659_10187982 3300025926 Bacteria 1642
222 Ga0207659_10305478 3300025926 Unclassified 1308
223 Ga0207659_10408185 3300025926 Unclassified 1137
224 Ga0207687_10060328 3300025927 Unclassified 2675
225 Ga0207700_10878496 3300025928 Unclassified 802
226 Ga0207664_10029088 3300025929 Bacteria 4205
227 Ga0207664_10066876 3300025929 Bacteria 2882
228 Ga0207644_10173051 3300025931 Unclassified 1687
229 Ga0207706_10263993 3300025933 Unclassified 1503
230 Ga0207706_11305910 3300025933 Bacteria 599
231 Ga0207686_10153321 3300025934 Bacteria 1607
232 Ga0207686_10404291 3300025934 Bacteria 1041
233 Ga0207686_10417019 3300025934 Bacteria 1026
234 Ga0207686_10719728 3300025934 Bacteria 795
235 Ga0207709_10040569 3300025935 Bacteria 2788
236 Ga0207709_11145169 3300025935 Bacteria 640
237 Ga0207709_11744888 3300025935 Bacteria 518
238 Ga0207670_11877174 3300025936 Unclassified 509
239 Ga0207669_10024948 3300025937 Bacteria 3222
240 Ga0207669_10103662 3300025937 Unclassified 1887
241 Ga0207669_10160766 3300025937 Bacteria 1586
242 Ga0207669_10287189 3300025937 Bacteria 1244
243 Ga0207704_10075960 3300025938 Bacteria 2151
244 Ga0207665_10002447 3300025939 Bacteria 12534
245 Ga0207691_10018551 3300025940 Bacteria 6594
246 Ga0207691_10270193 3300025940 Unclassified 1464
247 Ga0207691_11155229 3300025940 Unclassified 643
248 Ga0207689_10027320 3300025942 Bacteria 4778
249 Ga0207661_10143756 3300025944 Unclassified 2055
250 Ga0207679_10077704 3300025945 Unclassified 2526
251 Ga0207667_10779645 3300025949 Archaea 954
252 Ga0207651_10124762 3300025960 Bacteria 1960
253 Ga0207651_10693309 3300025960 Bacteria 897
254 Ga0207712_10549892 3300025961 Bacteria 993
255 Ga0207668_10321424 3300025972 Unclassified 1284
256 Ga0207640_10163799 3300025981 Bacteria 1649
257 Ga0207677_10470066 3300026023 Bacteria 1081
258 Ga0207678_10007890 3300026067 Bacteria 9392
259 Ga0207708_10409119 3300026075 Bacteria 1123
260 Ga0207708_10568747 3300026075 Unclassified 957
261 Ga0207702_10551895 3300026078 Unclassified 1127
262 Ga0207641_10289805 3300026088 Unclassified 1543
263 Ga0207648_10062209 3300026089 Unclassified 3255
264 Ga0207648_10096602 3300026089 Bacteria 2585
265 Ga0207648_11099253 3300026089 Bacteria 746
266 Ga0207676_10076798 3300026095 Unclassified 2700
267 Ga0207674_10025009 3300026116 Bacteria 6373
268 Ga0207674_10510956 3300026116 Bacteria 1161
269 Ga0207675_100066241 3300026118 Unclassified 3375
270 Ga0207683_10004201 3300026121 Bacteria 12445
271 Ga0207683_10024380 3300026121 Bacteria 5210
272 Ga0207683_10092150 3300026121 Bacteria 2700
273 Ga0207683_10274563 3300026121 Bacteria 1540
274 Ga0207683_10328355 3300026121 Bacteria 1402
275 Ga0207428_10121400 3300027907 Unclassified 2003
276 Ga0207428_11092877 3300027907 Unclassified 558
277 Ga0268266_10352905 3300028379 Unclassified 1382
278 Ga0307405_10860479 3300031731 Unclassified 764
279 Ga0307407_10183083 3300031903 Unclassified 1390
280 Ga0307407_10329860 3300031903 Unclassified 1074
281 Ga0307409_100743133 3300031995 Unclassified 984
282 Ga0307409_102130867 3300031995 Bacteria 590
283 Ga0307416_100315467 3300032002 Unclassified 1562
284 Ga0307416_101091670 3300032002 Unclassified 902
285 Ga0307415_100335242 3300032126 Unclassified 1267
286 Ga0307415_100363381 3300032126 Unclassified 1223
287 Ga0373930_0006869 3300034816 Bacteria 1941
288 Ga0373959_0120069 3300034820 Unclassified 642
289 Ga0373928_0060243 3300035084 Unclassified 916
290 Ga0373929_0043966 3300035085 Unclassified 1002
291 Ga0373949_0045395 3300035090 Unclassified 1092
292 Ga0373949_0278032 3300035090 Bacteria 525
293 Ga0373951_0072716 3300035091 Bacteria 878
294 Ga0373932_0009927 3300035112 Bacteria 2296
295 Ga0373939_0013831 3300035114 Bacteria 2083
296 Ga0373941_0150571 3300035115 Bacteria 853
297 Ga0373960_0058830 3300035121 Unclassified 1160
298 Ga0373961_0423891 3300035241 Unclassified 514
299 Ga0373962_0097531 3300035242 Unclassified 913
300 Ga0373931_0154442 3300035691 Bacteria 1340
301 Ga0395899_0106567 3300037312 Bacteria 2018
302 Ga0395900_0257842 3300037418 Unclassified 1742
303 Ga0395900_0278968 3300037418 Unclassified 1664
304 Ga0395900_0305396 3300037418 Unclassified 1576
305 Ga0395900_0859231 3300037418 Unclassified 832
306 Ga0395898_0064380 3300037466 Bacteria 3556
307 Ga0395898_0244408 3300037466 Bacteria 1711
308 Ga0395898_1119405 3300037466 Bacteria 720
309 Ga0395905_0128976 3300037471 Bacteria 2378
310 Ga0395905_0178266 3300037471 Unclassified 1995
311 Ga0395905_0376271 3300037471 Bacteria 1314
312 Ga0395901_0083956 3300038443 Bacteria 3329
313 Ga0395901_0154532 3300038443 Bacteria 2410
314 Ga0395901_0424967 3300038443 Unclassified 1362
315 Ga0451855_0888854 3300041511 Bacteria 574
316 Ga0439448_0063805 3300042005 Bacteria 1220
317 Ga0439455_0050235 3300042012 Bacteria 1088
318 Ga0439456_026315 3300042013 Bacteria 1237
319 Ga0439463_168852 3300042016 Unclassified 567
320 Ga0450920_023618 3300042122 Bacteria 1192
321 Ga0450907_017800 3300042146 Bacteria 1186
322 Ga0450918_019398 3300042531 Bacteria 1186
323 Ga0453683_0981057 3300044673 Unclassified 561
324 Ga0466963_0010216 3300044694 Bacteria 5677
325 Ga0466963_0042115 3300044694 Unclassified 2997
326 Ga0466968_0218947 3300044735 Bacteria 896
327 Ga0466960_0571206 3300044901 Unclassified 669
328 Ga0451576_0138734 3300045051 Unclassified 2536
329 Ga0451576_0855775 3300045051 Bacteria 954
330 Ga0466967_0509286 3300045976 Bacteria 1182
331 Ga0466967_1524066 3300045976 Bacteria 666
332 Ga0495617_285823 3300046452 Unclassified 505
333 Ga0495603_0069819 3300046455 Unclassified 2066
334 Ga0495603_0340348 3300046455 Unclassified 861
335 Ga0495603_0400812 3300046455 Unclassified 786
336 Ga0495641_0128026 3300046461 Unclassified 1133
337 Ga0495641_0518073 3300046461 Unclassified 544
338 Ga0495582_0054842 3300046473 Bacteria 2197
339 Ga0495605_0144345 3300046474 Bacteria 1066
340 Ga0495605_0401609 3300046474 Bacteria 570
341 Ga0495605_0414251 3300046474 Bacteria 559
342 Ga0495639_0627023 3300046475 Unclassified 553
343 Ga0495584_0080229 3300046491 Bacteria 1642
344 Ga0495584_0208378 3300046491 Bacteria 994
345 Ga0495584_0273044 3300046491 Bacteria 859
346 Ga0495584_0280408 3300046491 Unclassified 847
347 Ga0495585_0109575 3300046492 Unclassified 1470
348 Ga0495594_0859816 3300046499 Unclassified 510
349 Ga0495607_0250121 3300046501 Unclassified 854
350 Ga0495616_0403974 3300046513 Bacteria 561
351 Ga0495644_0041064 3300046523 Unclassified 1743
352 Ga0495644_0257303 3300046523 Bacteria 679
353 Ga0495663_0063825 3300046525 Unclassified 1162
354 Ga0495663_0124723 3300046525 Bacteria 865
355 Ga0495642_0444068 3300046528 Unclassified 573
356 Ga0495598_0135276 3300046537 Bacteria 849
357 Ga0495609_0332313 3300046538 Bacteria 615
358 Ga0495667_0289621 3300046559 Bacteria 1039
359 Ga0495656_0103382 3300046615 Unclassified 1321
360 Ga0495656_0151408 3300046615 Bacteria 1121
361 Ga0495656_0460064 3300046615 Bacteria 671
362 Ga0495656_0556484 3300046615 Unclassified 612
363 Ga0495668_0725981 3300046616 Bacteria 550
364 Ga0495634_0312774 3300046642 Bacteria 947
365 Ga0495659_0290540 3300046664 Unclassified 689
366 Ga0495647_0183636 3300046681 Bacteria 911
367 Ga0495658_0213712 3300046683 Archaea 1206
368 Ga0495613_0783894 3300046689 Unclassified 623
369 Ga0495613_0957362 3300046689 Unclassified 552
370 Ga0495670_0149476 3300046691 Unclassified 1225
371 Ga0495636_0617664 3300047318 Bacteria 531
372 Ga0495674_0573055 3300047319 Unclassified 897
373 Ga0495680_0276637 3300047322 Archaea 1184
374 Ga0496100_0347288 3300048903 Bacteria 1120
375 Ga0496100_0481433 3300048903 Unclassified 954
376 Ga0496100_1188763 3300048903 Bacteria 601
377 Ga0496101_0177162 3300048904 Unclassified 1640
378 Ga0496101_0848492 3300048904 Bacteria 720
379 Ga0496101_1133494 3300048904 Unclassified 614
380 Ga0496102_0008266 3300048905 Bacteria 8913
381 Ga0496102_0444867 3300048905 Unclassified 1216
382 Ga0496102_0543190 3300048905 Bacteria 1085
383 Ga0496102_0777469 3300048905 Unclassified 880
384 Ga0496103_0027011 3300048906 Bacteria 3476
385 Ga0496104_0075674 3300048907 Bacteria 3205
386 Ga0496104_0944485 3300048907 Bacteria 767
387 Ga0496104_0989400 3300048907 Bacteria 745
388 Ga0496105_0072423 3300048908 Bacteria 2847
389 Ga0496105_0159933 3300048908 Bacteria 1849
390 Ga0496105_1211339 3300048908 Unclassified 555
391 Ga0496106_0064960 3300048909 Bacteria 2777
392 Ga0496107_0772365 3300048910 Unclassified 704
393 Ga0496107_1266519 3300048910 Unclassified 528
394 Ga0496107_1385590 3300048910 Unclassified 501
395 Ga0496108_0098565 3300048911 Unclassified 2491
396 Ga0496108_0276198 3300048911 Unclassified 1463
397 Ga0496109_0043528 3300048912 Bacteria 4070
398 Ga0496109_0109951 3300048912 Unclassified 2562
399 Ga0496109_1334037 3300048912 Bacteria 653
400 Ga0496110_0058124 3300048913 Unclassified 3406
401 Ga0496110_0231765 3300048913 Unclassified 1680
402 Ga0496110_1433650 3300048913 Bacteria 600
403 Ga0496110_1787690 3300048913 Bacteria 525
404 Ga0496112_0267762 3300048915 Bacteria 1657
405 Ga0496112_0485969 3300048915 Unclassified 1171
406 Ga0496113_0693563 3300048916 Unclassified 813
407 Ga0496114_0003753 3300048917 Bacteria 11706
408 Ga0496114_0082381 3300048917 Bacteria 2719
409 Ga0496114_0403011 3300048917 Archaea 1211
410 Ga0496115_0133221 3300048918 Bacteria 2048
411 Ga0496115_0910604 3300048918 Bacteria 677
412 Ga0501031_0107984 3300049568 Bacteria 1817
413 Ga0501031_0574986 3300049568 Bacteria 725
414 Ga0501031_0819930 3300049568 Unclassified 596
415 Ga0501036_0336937 3300049572 Bacteria 1260
416 Ga0501038_0636126 3300049574 Bacteria 804
417 Ga0501038_0778705 3300049574 Bacteria 712
418 Ga0501039_0037357 3300049575 Bacteria 3748
419 Ga0501039_0147802 3300049575 Bacteria 1847
420 Ga0501039_0673904 3300049575 Bacteria 809
421 Ga0501039_1162608 3300049575 Unclassified 597
422 Ga0501040_0227384 3300049576 Bacteria 1328
423 Ga0501040_0293128 3300049576 Bacteria 1163
424 Ga0501040_0692895 3300049576 Archaea 737
425 Ga0501041_0224218 3300049577 Unclassified 1180
426 Ga0501041_0485117 3300049577 Bacteria 786
427 Ga0501042_0016796 3300049578 Bacteria 5033
428 Ga0501042_0106316 3300049578 Bacteria 2020
429 Ga0501042_0116816 3300049578 Bacteria 1921
430 Ga0501046_0362059 3300049580 Bacteria 1052
431 Ga0501048_0064209 3300049582 Bacteria 2597
432 Ga0501048_0172134 3300049582 Bacteria 1534
433 Ga0501067_0175731 3300049583 Bacteria 1192
434 Ga0501067_0221177 3300049583 Bacteria 1054
435 Ga0501067_0666012 3300049583 Unclassified 584
436 Ga0501068_0146108 3300049584 Bacteria 1484
437 Ga0501068_0343801 3300049584 Bacteria 958
438 Ga0501068_0985841 3300049584 Unclassified 556
439 Ga0501069_0180667 3300049585 Bacteria 1219
440 Ga0501069_0715666 3300049585 Bacteria 604
441 Ga0501071_0007629 3300049587 Bacteria 7128
442 Ga0501071_0088016 3300049587 Bacteria 2279
443 Ga0501071_0105772 3300049587 Bacteria 2078
444 Ga0501071_0397466 3300049587 Unclassified 1052
445 Ga0501071_0606825 3300049587 Bacteria 841
446 Ga0501072_0126732 3300049588 Bacteria 2034
447 Ga0501072_0183995 3300049588 Bacteria 1667
448 Ga0501072_0232486 3300049588 Bacteria 1469
449 Ga0501072_0308511 3300049588 Bacteria 1258
450 Ga0501072_0702440 3300049588 Bacteria 795
451 Ga0501072_0969363 3300049588 Bacteria 663
452 Ga0501074_0064626 3300049590 Bacteria 2634
453 Ga0501074_0391279 3300049590 Bacteria 986
454 Ga0501074_0421135 3300049590 Bacteria 947
455 Ga0501074_0673101 3300049590 Unclassified 731
456 Ga0501075_0189617 3300049591 Bacteria 1568
457 Ga0501076_0001971 3300049592 Bacteria 14012
458 Ga0501076_0074843 3300049592 Bacteria 2714
459 Ga0501076_0169871 3300049592 Bacteria 1777
460 Ga0501077_0044999 3300049593 Bacteria 2804
461 Ga0501079_0096247 3300049741 Bacteria 2295
462 Ga0501079_0862377 3300049741 Bacteria 713
463 Ga0501080_0305666 3300049742 Unclassified 1442
464 Ga0501080_0473422 3300049742 Bacteria 1121
465 Ga0501081_0035229 3300049743 Bacteria 3407
466 Ga0501081_0149045 3300049743 Bacteria 1680
467 Ga0501081_0917433 3300049743 Bacteria 661
468 Ga0501083_0317710 3300049744 Bacteria 1013
469 Ga0501083_0520075 3300049744 Bacteria 775
470 Ga0501044_0792792 3300049823 Bacteria 827
471 Ga0501045_0026675 3300049824 Bacteria 4157
472 Ga0501045_0442297 3300049824 Bacteria 967
473 nmdc:mga0yw44_1071279_c1 3300050492 Bacteria 545
474 nmdc:mga05p37_193269_c1 3300050507 Bacteria 2469
475 nmdc:mga05p37_436525_c1 3300050507 Bacteria 1520
476 nmdc:mga05p37_495941_c1 3300050507 Bacteria 1403
477 nmdc:mga05p37_50115_c1 3300050507 Bacteria 5134
478 nmdc:mga05p37_518794_c1 3300050507 Bacteria 1363
479 nmdc:mga05p37_90520_c1 3300050507 Bacteria 3770
480 nmdc:mga09592_289913_c1 3300050508 Bacteria 1419
481 nmdc:mga06r32_1995184_c1 3300050510 Unclassified 514
482 nmdc:mga06r32_809403_c1 3300050510 Unclassified 897
483 nmdc:mga08y16_1724442_c1 3300050511 Unclassified 581
484 nmdc:mga08y16_192427_c1 3300050511 Bacteria 2115
485 nmdc:mga08y16_620001_c1 3300050511 Bacteria 1089
486 nmdc:mga08y16_71368_c1 3300050511 Bacteria 3619
487 nmdc:mga0n895_151796_c1 3300050512 Bacteria 2347
488 nmdc:mga0n895_186540_c1 3300050512 Unclassified 2105
489 nmdc:mga0n895_33622_c1 3300050512 Unclassified 4929
490 nmdc:mga0n895_567889_c1 3300050512 Unclassified 1139
491 nmdc:mga0n895_873652_c1 3300050512 Unclassified 886
492 nmdc:mga0rr50_1196057_c1 3300050513 Unclassified 646
493 nmdc:mga0rr50_1296559_c1 3300050513 Unclassified 618
494 nmdc:mga0rr50_306073_c1 3300050513 Bacteria 1330
495 nmdc:mga0rr50_313863_c1 3300050513 Bacteria 1313
496 nmdc:mga08x19_1050203_c1 3300050514 Unclassified 578
497 nmdc:mga08x19_110474_c1 3300050514 Bacteria 1833
498 nmdc:mga08x19_552858_c1 3300050514 Unclassified 814
499 nmdc:mga08x19_579292_c1 3300050514 Bacteria 795
500 nmdc:mga08x19_686223_c1 3300050514 Unclassified 727
501 nmdc:mga0a205_166220_c1 3300050515 Bacteria 2102
502 nmdc:mga0a205_325837_c1 3300050515 Bacteria 1406
503 nmdc:mga0a205_398494_c1 3300050515 Unclassified 1240
504 nmdc:mga0a205_635231_c1 3300050515 Bacteria 919
505 nmdc:mga0a205_83273_c1 3300050515 Bacteria 2544
506 nmdc:mga0a205_841063_c1 3300050515 Unclassified 765
507 Ga0495655_0180534 3300053083 Unclassified 680
508 Ga0495619_0512478 3300053085 Archaea 824
509 Ga0501084_0045652 3300054114 Bacteria 3668
510 Ga0501084_0187406 3300054114 Bacteria 1746
511 Ga0501084_0455518 3300054114 Bacteria 1081
512 Ga0501084_0651821 3300054114 Bacteria 889
513 Ga0501084_0995058 3300054114 Bacteria 705
514 Ga0501082_0062514 3300060353 Bacteria 3205
515 Ga0501082_0266607 3300060353 Bacteria 1490
516 Ga0501082_1224992 3300060353 Bacteria 656
517 Ga0530510_0069276 3300061734 Bacteria 2560
518 Ga0530510_0094250 3300061734 Bacteria 2187
519 Ga0530510_0096247 3300061734 Bacteria 2164
520 Ga0530510_0528200 3300061734 Bacteria 895
521 Ga0530510_1401915 3300061734 Unclassified 536
522 Ga0496115_0379486
523 JGI24747J21853_1003021
524 JGI24738J21930_10076171
525 JGI24033J26618_1031753
526 JGI24751J29686_10058942
527 Ga0070683_100126386
528 Ga0070690_100037337
529 Ga0070670_100021366
530 Ga0070677_10155076
531 Ga0068869_100046443
532 Ga0070680_101779957
533 Ga0070682_100211148
534 Ga0070682_101762479
535 Ga0068868_100681177
536 Ga0068868_100682112
537 Ga0070689_100021737
538 Ga0070689_100854742
539 Ga0070668_100079460
540 Ga0070668_101765978
541 Ga0070668_102003723
542 Ga0070675_100106902
543 Ga0070675_100126955
544 Ga0070675_100244662
545 Ga0070675_100407382
546 Ga0070671_100097252
547 Ga0070671_100672685
548 Ga0070674_100018268
549 Ga0070674_100040351
550 Ga0070674_100040566
551 Ga0070674_101113731
552 Ga0070673_100203298
553 Ga0070673_100454361
554 Ga0070688_100017728
555 Ga0070667_100726212
556 Ga0070709_10381064
557 Ga0070714_100145529
558 Ga0070713_100823409
559 Ga0070710_10074874
560 Ga0070701_10025373
561 Ga0070701_10472174
562 Ga0070711_100890419
563 Ga0070705_100280325
564 Ga0070705_101592182
565 Ga0070700_100011967
566 Ga0070700_100458194
567 Ga0070694_100098234
568 Ga0070708_101051114
569 Ga0070663_100066527
570 Ga0070678_100029589
571 Ga0070678_100074207
572 Ga0070678_100153231
573 Ga0070678_100218330
574 Ga0070678_101122994
575 Ga0070662_101958668
576 Ga0070681_11309926
577 Ga0068867_100078166
578 Ga0068867_100145086
579 Ga0068867_100550751
580 Ga0070685_10010311
581 Ga0070685_10813552
582 Ga0070706_100316409
583 Ga0070706_100361483
584 Ga0070706_101325492
585 Ga0070707_100004270
586 Ga0070698_101234875
587 Ga0070699_100294620
588 Ga0070684_100142611
589 Ga0070684_100562556
590 Ga0070684_101190518
591 Ga0070672_100096470
592 Ga0070672_100933725
593 Ga0070686_100029807
594 Ga0070686_100031796
595 Ga0070695_100257423
596 Ga0070695_101740911
597 Ga0070696_100233008
598 Ga0070693_100009443
599 Ga0070693_100790609
600 Ga0070693_101221074
601 Ga0070665_100121838
602 Ga0070665_102224230
603 Ga0070704_101583958
604 Ga0070664_100055280
605 Ga0068857_100524306
606 Ga0068857_100567072
607 Ga0068857_102238258
608 Ga0068854_100275313
609 Ga0068856_100491044
610 Ga0070702_100370397
611 Ga0070702_100408207
612 Ga0070702_100997363
613 Ga0068859_101193959
614 Ga0068859_102978741
615 Ga0068864_100028818
616 Ga0068866_10161731
617 Ga0068866_10336440
618 Ga0068866_10377706
619 Ga0068870_10002293
620 Ga0068870_10058114
621 Ga0068870_10916825
622 Ga0068870_10939729
623 Ga0081538_10157635
624 Ga0081540_1005963
625 Ga0081540_1010007
626 Ga0081539_10001695
627 Ga0070717_10285851
628 Ga0075365_10157139
629 Ga0075365_10444852
630 Ga0075364_10344788
631 Ga0070715_10149286
632 Ga0070712_100282073
633 Ga0097621_100788971
634 Ga0097621_101247618
635 Ga0097621_101989435
636 Ga0068871_100260184
637 Ga0068871_101697953
638 Ga0068871_102025407
639 Ga0075428_100258479
640 Ga0075428_102110038
641 Ga0075430_100198466
642 Ga0075430_101075537
643 Ga0075431_100106023
644 Ga0075431_100992450
645 Ga0075431_101521081
646 Ga0075431_101719452
647 Ga0075433_10146498
648 Ga0075433_10246476
649 Ga0075433_10860688
650 Ga0075434_100057508
651 Ga0075434_100286030
652 Ga0075434_100581771
653 Ga0075429_100350399
654 Ga0068865_100013978
655 Ga0068865_100044578
656 Ga0068865_100727052
657 Ga0068865_100849229
658 Ga0075436_100063835
659 Ga0075436_100139120
660 Ga0075436_100961988
661 Ga0097620_101193863
662 Ga0097620_102978869
663 Ga0075435_100037368
664 Ga0075435_100171597
665 Ga0075435_100247466
666 Ga0075435_100897011
667 Ga0111539_10033850
668 Ga0111539_10058882
669 Ga0111539_11837412
670 Ga0111539_12622513
671 Ga0105245_10073805
672 Ga0105245_10774930
673 Ga0114129_10029356
674 Ga0114129_10238762
675 Ga0114129_10317512
676 Ga0114129_10380656
677 Ga0114129_10399143
678 Ga0114129_10827433
679 Ga0114129_11416012
680 Ga0114129_12501385
681 Ga0114129_12822701
682 Ga0105243_10099251
683 Ga0105243_10109654
684 Ga0105243_10537110
685 Ga0105243_10870413
686 Ga0105243_11925314
687 Ga0105241_10015698
688 Ga0105242_10020189
689 Ga0105242_10179960
690 Ga0105242_10733992
691 Ga0105242_11142037
692 Ga0105249_10481967
693 Ga0105249_10586848
694 Ga0105249_12165184
695 Ga0105239_10268507
696 Ga0105239_11676514
697 Ga0105246_10088357
698 Ga0105246_10603972
699 Ga0157329_1045239
700 Ga0157319_1003245
701 Ga0157339_1023425
702 Ga0157326_1002420
703 Ga0157373_10278508
704 Ga0157374_10215823
705 Ga0157375_10004686
706 Ga0157375_10854252
707 Ga0157375_12248215
708 Ga0157375_13095873
709 Ga0163163_10070051
710 Ga0163163_10639955
711 Ga0157380_10377561
712 Ga0157380_10525596
713 Ga0157380_12134337
714 Ga0157377_10013609
715 Ga0157379_10167265
716 Ga0157376_10015770
717 Ga0157376_10567571
718 Ga0157376_11717081
719 Ga0207697_10280562
720 Ga0207692_10220395
721 Ga0207642_10017009
722 Ga0207642_10065533
723 Ga0207688_10001622
724 Ga0207685_10004515
725 Ga0207699_10706267
726 Ga0207645_10052308
727 Ga0207643_10001368
728 Ga0207643_10009768
729 Ga0207643_10023538
730 Ga0207684_11687306
731 Ga0207654_10382895
732 Ga0207707_10981100
733 Ga0207693_10246748
734 Ga0207663_10010033
735 Ga0207663_10033784
736 Ga0207660_10165636
737 Ga0207652_10408907
738 Ga0207646_10002759
739 Ga0207681_11206060
740 Ga0207650_10075056
741 Ga0207650_10146234
742 Ga0207659_10187982
743 Ga0207659_10305478
744 Ga0207659_10408185
745 Ga0207687_10060328
746 Ga0207700_10878496
747 Ga0207664_10029088
748 Ga0207664_10066876
749 Ga0207644_10173051
750 Ga0207706_10263993
751 Ga0207706_11305910
752 Ga0207686_10153321
753 Ga0207686_10404291
754 Ga0207686_10417019
755 Ga0207686_10719728
756 Ga0207709_10040569
757 Ga0207709_11145169
758 Ga0207709_11744888
759 Ga0207670_11877174
760 Ga0207669_10024948
761 Ga0207669_10103662
762 Ga0207669_10160766
763 Ga0207669_10287189
764 Ga0207704_10075960
765 Ga0207665_10002447
766 Ga0207691_10018551
767 Ga0207691_10270193
768 Ga0207691_11155229
769 Ga0207689_10027320
770 Ga0207661_10143756
771 Ga0207679_10077704
772 Ga0207667_10779645
773 Ga0207651_10124762
774 Ga0207651_10693309
775 Ga0207712_10549892
776 Ga0207668_10321424
777 Ga0207640_10163799
778 Ga0207677_10470066
779 Ga0207678_10007890
780 Ga0207708_10409119
781 Ga0207708_10568747
782 Ga0207702_10551895
783 Ga0207641_10289805
784 Ga0207648_10062209
785 Ga0207648_10096602
786 Ga0207648_11099253
787 Ga0207676_10076798
788 Ga0207674_10025009
789 Ga0207674_10510956
790 Ga0207675_100066241
791 Ga0207683_10004201
792 Ga0207683_10024380
793 Ga0207683_10092150
794 Ga0207683_10274563
795 Ga0207683_10328355
796 Ga0207428_10121400
797 Ga0207428_11092877
798 Ga0268266_10352905
799 Ga0307405_10860479
800 Ga0307407_10183083
801 Ga0307407_10329860
802 Ga0307409_100743133
803 Ga0307409_102130867
804 Ga0307416_100315467
805 Ga0307416_101091670
806 Ga0307415_100335242
807 Ga0307415_100363381
808 Ga0373930_0006869
809 Ga0373959_0120069
810 Ga0373928_0060243
811 Ga0373929_0043966
812 Ga0373949_0045395
813 Ga0373949_0278032
814 Ga0373951_0072716
815 Ga0373932_0009927
816 Ga0373939_0013831
817 Ga0373941_0150571
818 Ga0373960_0058830
819 Ga0373961_0423891
820 Ga0373962_0097531
821 Ga0373931_0154442
822 Ga0395899_0106567
823 Ga0395900_0257842
824 Ga0395900_0278968
825 Ga0395900_0305396
826 Ga0395900_0859231
827 Ga0395898_0064380
828 Ga0395898_0244408
829 Ga0395898_1119405
830 Ga0395905_0128976
831 Ga0395905_0178266
832 Ga0395905_0376271
833 Ga0395901_0083956
834 Ga0395901_0154532
835 Ga0395901_0424967
836 Ga0451855_0888854
837 Ga0439448_0063805
838 Ga0439455_0050235
839 Ga0439456_026315
840 Ga0439463_168852
841 Ga0450920_023618
842 Ga0450907_017800
843 Ga0450918_019398
844 Ga0453683_0981057
845 Ga0466963_0010216
846 Ga0466963_0042115
847 Ga0466968_0218947
848 Ga0466960_0571206
849 Ga0451576_0138734
850 Ga0451576_0855775
851 Ga0466967_0509286
852 Ga0466967_1524066
853 Ga0495617_285823
854 Ga0495603_0069819
855 Ga0495603_0340348
856 Ga0495603_0400812
857 Ga0495641_0128026
858 Ga0495641_0518073
859 Ga0495582_0054842
860 Ga0495605_0144345
861 Ga0495605_0401609
862 Ga0495605_0414251
863 Ga0495639_0627023
864 Ga0495584_0080229
865 Ga0495584_0208378
866 Ga0495584_0273044
867 Ga0495584_0280408
868 Ga0495585_0109575
869 Ga0495594_0859816
870 Ga0495607_0250121
871 Ga0495616_0403974
872 Ga0495644_0041064
873 Ga0495644_0257303
874 Ga0495663_0063825
875 Ga0495663_0124723
876 Ga0495642_0444068
877 Ga0495598_0135276
878 Ga0495609_0332313
879 Ga0495667_0289621
880 Ga0495656_0103382
881 Ga0495656_0151408
882 Ga0495656_0460064
883 Ga0495656_0556484
884 Ga0495668_0725981
885 Ga0495634_0312774
886 Ga0495659_0290540
887 Ga0495647_0183636
888 Ga0495658_0213712
889 Ga0495613_0783894
890 Ga0495613_0957362
891 Ga0495670_0149476
892 Ga0495636_0617664
893 Ga0495674_0573055
894 Ga0495680_0276637
895 Ga0496100_0347288
896 Ga0496100_0481433
897 Ga0496100_1188763
898 Ga0496101_0177162
899 Ga0496101_0848492
900 Ga0496101_1133494
901 Ga0496102_0008266
902 Ga0496102_0444867
903 Ga0496102_0543190
904 Ga0496102_0777469
905 Ga0496103_0027011
906 Ga0496104_0075674
907 Ga0496104_0944485
908 Ga0496104_0989400
909 Ga0496105_0072423
910 Ga0496105_0159933
911 Ga0496105_1211339
912 Ga0496106_0064960
913 Ga0496107_0772365
914 Ga0496107_1266519
915 Ga0496107_1385590
916 Ga0496108_0098565
917 Ga0496108_0276198
918 Ga0496109_0043528
919 Ga0496109_0109951
920 Ga0496109_1334037
921 Ga0496110_0058124
922 Ga0496110_0231765
923 Ga0496110_1433650
924 Ga0496110_1787690
925 Ga0496112_0267762
926 Ga0496112_0485969
927 Ga0496113_0693563
928 Ga0496114_0003753
929 Ga0496114_0082381
930 Ga0496114_0403011
931 Ga0496115_0133221
932 Ga0496115_0910604
933 Ga0501031_0107984
934 Ga0501031_0574986
935 Ga0501031_0819930
936 Ga0501036_0336937
937 Ga0501038_0636126
938 Ga0501038_0778705
939 Ga0501039_0037357
940 Ga0501039_0147802
941 Ga0501039_0673904
942 Ga0501039_1162608
943 Ga0501040_0227384
944 Ga0501040_0293128
945 Ga0501040_0692895
946 Ga0501041_0224218
947 Ga0501041_0485117
948 Ga0501042_0016796
949 Ga0501042_0106316
950 Ga0501042_0116816
951 Ga0501046_0362059
952 Ga0501048_0064209
953 Ga0501048_0172134
954 Ga0501067_0175731
955 Ga0501067_0221177
956 Ga0501067_0666012
957 Ga0501068_0146108
958 Ga0501068_0343801
959 Ga0501068_0985841
960 Ga0501069_0180667
961 Ga0501069_0715666
962 Ga0501071_0007629
963 Ga0501071_0088016
964 Ga0501071_0105772
965 Ga0501071_0397466
966 Ga0501071_0606825
967 Ga0501072_0126732
968 Ga0501072_0183995
969 Ga0501072_0232486
970 Ga0501072_0308511
971 Ga0501072_0702440
972 Ga0501072_0969363
973 Ga0501074_0064626
974 Ga0501074_0391279
975 Ga0501074_0421135
976 Ga0501074_0673101
977 Ga0501075_0189617
978 Ga0501076_0001971
979 Ga0501076_0074843
980 Ga0501076_0169871
981 Ga0501077_0044999
982 Ga0501079_0096247
983 Ga0501079_0862377
984 Ga0501080_0305666
985 Ga0501080_0473422
986 Ga0501081_0035229
987 Ga0501081_0149045
988 Ga0501081_0917433
989 Ga0501083_0317710
990 Ga0501083_0520075
991 Ga0501044_0792792
992 Ga0501045_0026675
993 Ga0501045_0442297
994 nmdc:mga0yw44_1071279_c1
995 nmdc:mga05p37_193269_c1
996 nmdc:mga05p37_436525_c1
997 nmdc:mga05p37_495941_c1
998 nmdc:mga05p37_50115_c1
999 nmdc:mga05p37_518794_c1
1000 nmdc:mga05p37_90520_c1
1001 nmdc:mga09592_289913_c1
1002 nmdc:mga06r32_1995184_c1
1003 nmdc:mga06r32_809403_c1
1004 nmdc:mga08y16_1724442_c1
1005 nmdc:mga08y16_192427_c1
1006 nmdc:mga08y16_620001_c1
1007 nmdc:mga08y16_71368_c1
1008 nmdc:mga0n895_151796_c1
1009 nmdc:mga0n895_186540_c1
1010 nmdc:mga0n895_33622_c1
1011 nmdc:mga0n895_567889_c1
1012 nmdc:mga0n895_873652_c1
1013 nmdc:mga0rr50_1196057_c1
1014 nmdc:mga0rr50_1296559_c1
1015 nmdc:mga0rr50_306073_c1
1016 nmdc:mga0rr50_313863_c1
1017 nmdc:mga08x19_1050203_c1
1018 nmdc:mga08x19_110474_c1
1019 nmdc:mga08x19_552858_c1
1020 nmdc:mga08x19_579292_c1
1021 nmdc:mga08x19_686223_c1
1022 nmdc:mga0a205_166220_c1
1023 nmdc:mga0a205_325837_c1
1024 nmdc:mga0a205_398494_c1
1025 nmdc:mga0a205_635231_c1
1026 nmdc:mga0a205_83273_c1
1027 nmdc:mga0a205_841063_c1
1028 Ga0495655_0180534
1029 Ga0495619_0512478
1030 Ga0501084_0045652
1031 Ga0501084_0187406
1032 Ga0501084_0455518
1033 Ga0501084_0651821
1034 Ga0501084_0995058
1035 Ga0501082_0062514
1036 Ga0501082_0266607
1037 Ga0501082_1224992
1038 Ga0530510_0069276
1039 Ga0530510_0094250
1040 Ga0530510_0096247
1041 Ga0530510_0528200
1042 Ga0530510_1401915

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00403

HMA

Heavy-metal-associated domain

7

67

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ff2-assembly1.cif.gz_B copz metallochaperone 0.928 4 69
3dxs-assembly1.cif.gz_X crystal structure of a copper binding domain from hma7, a p-type atpase 0.9261 5 69
2qif-assembly1.cif.gz_A crystal structure of a metallochaperone with a tetranuclear cu(i) cluster 0.9256 4 70
7si6-assembly1.cif.gz_A structure of atp7b in state 1 0.9146 5 69
1osd-assembly2.cif.gz_B crystal structure of oxidized merp from ralstonia metallidurans ch34 0.9142 2 69
ID Description Score Start End Superfamily
af_A0A0R0FZY9_20_89_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9339 1 69 3.30.70.100
af_G5EE14_248_322_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9312 2 69 3.30.70.100
af_Q54Q77_23_93_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9303 3 69 3.30.70.100
6ff2B00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.928 4 69 3.30.70.100
af_Q5AG51_176_245_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9279 2 68 3.30.70.100
ID Description Score Start End GO Terms
AF-A0A538EKJ2-F1-model_v4 Cation transporter 0.998 2 70 GO:0046872
AF-A0A538F2S3-F1-model_v4 Heavy-metal-associated domain-containing protein 0.9961 3 69 GO:0046872
AF-A0A538CPG0-F1-model_v4 Cation transporter 0.9926 3 71 GO:0046872
AF-A0A7W0Q2G5-F1-model_v4 Cation transporter 0.9926 4 71 GO:0046872
AF-A0A538GUM2-F1-model_v4 Cation transporter 0.9885 1 72 GO:0046872

Map