F458738

General Info

Members Datasets Scaffolds Average Seq Length
521 229 1042 248

Family's Representative Sequence

Representative Sequence 3300044842|Ga0466957_0285438|Ga0466957_0285438_17_823
Length 268
Sequence MKVAAVVVSHGNAAELDRLLPVLAPQVDELVVVANVPGSVGLVPDGVTLIANETPLGFGANVNRGVAATTAELVCSVNPDATPRGEAIAELRRFLEAHPRAAVAGPAMVYPDGTLQPSRRRFPTVAGTLVRRTPLRLLFDPYRLQRRHYHLGERPTEPVEADWMLGGFLMLRREAFAELGGFDEGFFLYGEDIDLCYRAWRKGWSVWYVPSAVVEHEHRALTDRRLLTRRTLWHWRGILRFVRKHPEQLLGRSGRRASSQARLQRPAR

Samples

Sample ID Description Type Environment
1 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
62 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
63 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
105 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
106 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
118 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
140 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
149 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
150 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
202 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
203 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
204 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
205 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
225 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.04
Metatranscriptomes 0.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.19
Nodule 0
Rhizoplane 16.51
Rhizosphere 82.53
Stem 0
Stem Tuber 0
Unclassified 9.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466957_0285438 3300044842 Bacteria 1106
2 Ga0070683_100005188 3300005329 Bacteria 10841
3 Ga0070683_100052872 3300005329 Bacteria 3764
4 Ga0070683_100096136 3300005329 Bacteria 2786
5 Ga0070680_100005049 3300005336 Bacteria 9953
6 Ga0070680_100039540 3300005336 Bacteria 3816
7 Ga0070680_100270141 3300005336 Unclassified 1440
8 Ga0070680_100374033 3300005336 Bacteria 1213
9 Ga0070682_100026241 3300005337 Bacteria 3485
10 Ga0068868_100062684 3300005338 Bacteria 2948
11 Ga0068868_100635465 3300005338 Bacteria 949
12 Ga0070660_100000141 3300005339 Bacteria 46136
13 Ga0070660_100024094 3300005339 Bacteria 4515
14 Ga0070661_100112769 3300005344 Bacteria 2032
15 Ga0070661_100225379 3300005344 Bacteria 1439
16 Ga0070659_100312658 3300005366 Bacteria 1312
17 Ga0070667_100543109 3300005367 Bacteria 1068
18 Ga0070713_100187956 3300005436 Bacteria 1860
19 Ga0070700_100116201 3300005441 Bacteria 1786
20 Ga0070700_100252283 3300005441 Bacteria 1266
21 Ga0070708_100014388 3300005445 Bacteria 6508
22 Ga0070708_100634216 3300005445 Bacteria 1007
23 Ga0070678_100027697 3300005456 Bacteria 3852
24 Ga0070678_100179189 3300005456 Bacteria 1733
25 Ga0070681_10041034 3300005458 Bacteria 4637
26 Ga0070681_10042080 3300005458 Bacteria 4579
27 Ga0070681_10088841 3300005458 Bacteria 3042
28 Ga0070681_10539957 3300005458 Bacteria 1079
29 Ga0070679_100022274 3300005530 Bacteria 6191
30 Ga0070679_100062902 3300005530 Unclassified 3699
31 Ga0070679_100160381 3300005530 Bacteria 2224
32 Ga0070684_100000113 3300005535 Bacteria 52618
33 Ga0070684_100008888 3300005535 Bacteria 7882
34 Ga0070684_100090157 3300005535 Bacteria 2726
35 Ga0070697_100377146 3300005536 Bacteria 1228
36 Ga0068853_100088001 3300005539 Bacteria 2726
37 Ga0068853_100194209 3300005539 Bacteria 1845
38 Ga0070696_100063962 3300005546 Unclassified 2578
39 Ga0070693_100003773 3300005547 Bacteria 7094
40 Ga0068855_100011118 3300005563 Bacteria 10866
41 Ga0068855_100019982 3300005563 Bacteria 8044
42 Ga0068855_100049393 3300005563 Bacteria 4962
43 Ga0068855_100053412 3300005563 Bacteria 4753
44 Ga0068855_100074336 3300005563 Bacteria 3948
45 Ga0068855_100097623 3300005563 Unclassified 3384
46 Ga0068855_100105678 3300005563 Bacteria 3237
47 Ga0068855_100310396 3300005563 Bacteria 1745
48 Ga0068855_100490826 3300005563 Bacteria 1336
49 Ga0070664_100061418 3300005564 Bacteria 3203
50 Ga0068854_100251950 3300005578 Bacteria 1410
51 Ga0068856_100013077 3300005614 Bacteria 8038
52 Ga0068856_100101101 3300005614 Bacteria 2876
53 Ga0068852_100080757 3300005616 Bacteria 2884
54 Ga0081538_10008294 3300005981 Bacteria 8848
55 Ga0081538_10010453 3300005981 Bacteria 7610
56 Ga0081539_10001497 3300005985 Bacteria 39539
57 Ga0081539_10035930 3300005985 Bacteria 2971
58 Ga0070717_10016542 3300006028 Bacteria 5720
59 Ga0070712_100111552 3300006175 Bacteria 2042
60 Ga0097621_100626845 3300006237 Bacteria 985
61 Ga0068871_100785214 3300006358 Bacteria 877
62 Ga0075428_100239326 3300006844 Unclassified 1958
63 Ga0075430_100366448 3300006846 Bacteria 1189
64 Ga0075431_100243544 3300006847 Bacteria 1828
65 Ga0075433_10109302 3300006852 Bacteria 2453
66 Ga0075434_100249028 3300006871 Bacteria 1796
67 Ga0075429_100495603 3300006880 Bacteria 1070
68 Ga0075436_100244709 3300006914 Unclassified 1276
69 Ga0075435_100178964 3300007076 Bacteria 1792
70 Ga0105240_10038850 3300009093 Bacteria 6102
71 Ga0111539_10508043 3300009094 Bacteria 1404
72 Ga0105245_10002806 3300009098 Bacteria 15671
73 Ga0105245_10174403 3300009098 Bacteria 2050
74 Ga0114129_10001640 3300009147 Bacteria 30409
75 Ga0114129_10010090 3300009147 Bacteria 13466
76 Ga0114129_10047340 3300009147 Bacteria 6043
77 Ga0114129_10136785 3300009147 Bacteria 3361
78 Ga0114129_10451287 3300009147 Unclassified 1686
79 Ga0114129_11396570 3300009147 Bacteria 864
80 Ga0105241_10270345 3300009174 Bacteria 1448
81 Ga0105241_10477063 3300009174 Bacteria 1108
82 Ga0105242_10236211 3300009176 Bacteria 1641
83 Ga0105242_10484100 3300009176 Bacteria 1173
84 Ga0105242_10682848 3300009176 Bacteria 1002
85 Ga0105237_10373675 3300009545 Bacteria 1430
86 Ga0105238_10023085 3300009551 Bacteria 6344
87 Ga0105238_10738784 3300009551 Bacteria 998
88 Ga0105249_10137799 3300009553 Bacteria 2338
89 Ga0105239_10285181 3300010375 Bacteria 1859
90 Ga0157370_10010500 3300013104 Bacteria 9753
91 Ga0157370_10015785 3300013104 Bacteria 7665
92 Ga0157370_10061578 3300013104 Bacteria 3561
93 Ga0157370_10102421 3300013104 Bacteria 2681
94 Ga0157369_10002221 3300013105 Bacteria 23375
95 Ga0157369_10003174 3300013105 Bacteria 19621
96 Ga0157369_10027208 3300013105 Bacteria 6341
97 Ga0157369_10234738 3300013105 Unclassified 1917
98 Ga0157369_10559490 3300013105 Bacteria 1182
99 Ga0157374_10208498 3300013296 Bacteria 1916
100 Ga0157374_10294814 3300013296 Bacteria 1604
101 Ga0157374_10488501 3300013296 Bacteria 1235
102 Ga0157378_10162962 3300013297 Bacteria 2086
103 Ga0163162_10642960 3300013306 Bacteria 1185
104 Ga0157372_10152634 3300013307 Bacteria 2667
105 Ga0157372_10757022 3300013307 Bacteria 1129
106 Ga0157372_11240094 3300013307 Bacteria 861
107 Ga0157375_10187329 3300013308 Bacteria 2223
108 Ga0157375_10850516 3300013308 Bacteria 1059
109 Ga0157379_10541264 3300014968 Bacteria 1083
110 Ga0157376_10113646 3300014969 Unclassified 2388
111 Ga0206354_10310690 3300020081 Bacteria 1658
112 Ga0206354_11113244 3300020081 Unclassified 2232
113 Ga0206353_10758145 3300020082 Bacteria 5098
114 Ga0206353_10967932 3300020082 Bacteria 3018
115 Ga0206353_11404529 3300020082 Bacteria 6949
116 Ga0213873_10018467 3300021358 Bacteria 1604
117 Ga0213876_10082864 3300021384 Bacteria 1697
118 Ga0213871_10006416 3300021441 Bacteria 2486
119 Ga0207688_10202917 3300025901 Bacteria 1189
120 Ga0207705_10148261 3300025909 Bacteria 1756
121 Ga0207705_10489167 3300025909 Unclassified 955
122 Ga0207707_10024369 3300025912 Bacteria 5295
123 Ga0207707_10110895 3300025912 Bacteria 2398
124 Ga0207671_10240676 3300025914 Bacteria 1421
125 Ga0207693_10033211 3300025915 Bacteria 4072
126 Ga0207663_10177439 3300025916 Bacteria 1518
127 Ga0207663_10455340 3300025916 Bacteria 987
128 Ga0207660_10053230 3300025917 Bacteria 2884
129 Ga0207660_10078728 3300025917 Bacteria 2416
130 Ga0207657_10000109 3300025919 Bacteria 80516
131 Ga0207657_10000392 3300025919 Bacteria 46205
132 Ga0207657_10013534 3300025919 Bacteria 8001
133 Ga0207657_10066637 3300025919 Unclassified 3064
134 Ga0207657_10227345 3300025919 Bacteria 1493
135 Ga0207649_10125053 3300025920 Bacteria 1739
136 Ga0207652_10094947 3300025921 Bacteria 2626
137 Ga0207652_10129855 3300025921 Bacteria 2247
138 Ga0207652_10424931 3300025921 Bacteria 1198
139 Ga0207659_10150154 3300025926 Bacteria 1819
140 Ga0207687_10003628 3300025927 Bacteria 10399
141 Ga0207664_10437330 3300025929 Bacteria 1166
142 Ga0207690_10042417 3300025932 Bacteria 2988
143 Ga0207686_10184286 3300025934 Bacteria 1483
144 Ga0207686_10291235 3300025934 Bacteria 1209
145 Ga0207709_10287271 3300025935 Bacteria 1217
146 Ga0207669_10252199 3300025937 Bacteria 1315
147 Ga0207704_10383501 3300025938 Bacteria 1104
148 Ga0207661_10003509 3300025944 Bacteria 10893
149 Ga0207661_10018287 3300025944 Bacteria 5206
150 Ga0207661_10064810 3300025944 Bacteria 2964
151 Ga0207661_10164668 3300025944 Bacteria 1926
152 Ga0207679_10009425 3300025945 Bacteria 6256
153 Ga0207667_10042303 3300025949 Bacteria 4843
154 Ga0207667_10058566 3300025949 Bacteria 4039
155 Ga0207667_10289034 3300025949 Bacteria 1675
156 Ga0207640_10341975 3300025981 Bacteria 1199
157 Ga0207678_10268511 3300026067 Bacteria 1463
158 Ga0207702_10003758 3300026078 Bacteria 13709
159 Ga0207702_10007088 3300026078 Bacteria 9590
160 Ga0207702_10144777 3300026078 Bacteria 2155
161 Ga0207683_10026029 3300026121 Bacteria 5052
162 Ga0207683_10452610 3300026121 Bacteria 1184
163 Ga0207698_10586310 3300026142 Unclassified 1097
164 Ga0265318_10010926 3300028577 Bacteria 3934
165 Ga0265318_10111917 3300028577 Bacteria 1004
166 Ga0265318_10132281 3300028577 Bacteria 917
167 Ga0265338_10026652 3300028800 Bacteria 5820
168 Ga0265338_10333572 3300028800 Bacteria 1095
169 Ga0265320_10122515 3300031240 Unclassified 1185
170 Ga0265340_10133091 3300031247 Bacteria 1139
171 Ga0265340_10187366 3300031247 Bacteria 934
172 Ga0265339_10169992 3300031249 Bacteria 1092
173 Ga0265327_10013736 3300031251 Bacteria 5356
174 Ga0265327_10024933 3300031251 Bacteria 3498
175 Ga0265327_10037199 3300031251 Bacteria 2667
176 Ga0265316_10308807 3300031344 Bacteria 1151
177 Ga0307408_100629580 3300031548 Bacteria 957
178 Ga0265313_10088541 3300031595 Bacteria 1394
179 Ga0265342_10232507 3300031712 Bacteria 990
180 Ga0307407_10299393 3300031903 Bacteria 1121
181 Ga0307412_10017858 3300031911 Bacteria 4254
182 Ga0307409_100163691 3300031995 Bacteria 1949
183 Ga0307415_100551340 3300032126 Bacteria 1017
184 Ga0373945_0043508 3300035116 Bacteria 1630
185 Ga0373943_0084127 3300035170 Bacteria 1636
186 Ga0373946_0169229 3300035171 Unclassified 1030
187 Ga0373935_0092463 3300035692 Bacteria 1982
188 Ga0373935_0325686 3300035692 Bacteria 1091
189 Ga0373927_0136537 3300035695 Bacteria 1603
190 Ga0373933_0294036 3300035724 Bacteria 1051
191 Ga0373947_0016358 3300035725 Bacteria 4263
192 Ga0373947_0086631 3300035725 Bacteria 1947
193 Ga0373925_0137311 3300037068 Bacteria 1911
194 Ga0373925_0674723 3300037068 Unclassified 852
195 Ga0395899_0057322 3300037312 Bacteria 2876
196 Ga0395899_0158708 3300037312 Bacteria 1599
197 Ga0395899_0171636 3300037312 Bacteria 1527
198 Ga0395899_0226922 3300037312 Bacteria 1291
199 Ga0395899_0235371 3300037312 Unclassified 1263
200 Ga0395899_0242535 3300037312 Bacteria 1240
201 Ga0395900_0008396 3300037418 Bacteria 10629
202 Ga0395900_0021761 3300037418 Bacteria 6556
203 Ga0395900_0023659 3300037418 Bacteria 6285
204 Ga0395900_0122972 3300037418 Bacteria 2662
205 Ga0395900_0125283 3300037418 Bacteria 2635
206 Ga0395900_0145641 3300037418 Bacteria 2422
207 Ga0395900_0209576 3300037418 Bacteria 1968
208 Ga0395900_0247059 3300037418 Bacteria 1787
209 Ga0395900_0395868 3300037418 Bacteria 1346
210 Ga0395898_0012581 3300037466 Bacteria 8750
211 Ga0395898_0016687 3300037466 Bacteria 7506
212 Ga0395898_0039071 3300037466 Bacteria 4700
213 Ga0395898_0067882 3300037466 Bacteria 3452
214 Ga0395898_0079826 3300037466 Bacteria 3156
215 Ga0395898_0096794 3300037466 Bacteria 2835
216 Ga0395898_0173217 3300037466 Unclassified 2063
217 Ga0395898_0430097 3300037466 Unclassified 1258
218 Ga0395905_0012600 3300037471 Bacteria 8134
219 Ga0395905_0030043 3300037471 Bacteria 5122
220 Ga0395905_0063883 3300037471 Bacteria 3445
221 Ga0395905_0086643 3300037471 Bacteria 2936
222 Ga0395905_0096742 3300037471 Bacteria 2772
223 Ga0395905_0138027 3300037471 Bacteria 2294
224 Ga0395901_0005273 3300038443 Bacteria 13056
225 Ga0395901_0008010 3300038443 Bacteria 10669
226 Ga0395901_0010355 3300038443 Bacteria 9445
227 Ga0395901_0022023 3300038443 Bacteria 6532
228 Ga0395901_0028650 3300038443 Bacteria 5728
229 Ga0395901_0055169 3300038443 Bacteria 4132
230 Ga0395901_0089518 3300038443 Bacteria 3221
231 Ga0395901_0103608 3300038443 Bacteria 2985
232 Ga0395901_0109586 3300038443 Bacteria 2899
233 Ga0395901_0117926 3300038443 Bacteria 2789
234 Ga0395901_0125418 3300038443 Bacteria 2698
235 Ga0395901_0147561 3300038443 Bacteria 2472
236 Ga0395901_0418294 3300038443 Bacteria 1375
237 Ga0395901_0448770 3300038443 Bacteria 1319
238 Ga0395901_0477461 3300038443 Bacteria 1272
239 Ga0395901_0588679 3300038443 Unclassified 1123
240 Ga0436365_1316994 3300039437 Bacteria 4506
241 Ga0436360_1056216 3300039438 Bacteria 1960
242 Ga0436363_1447489 3300039450 Bacteria 3353
243 Ga0436363_1452270 3300039450 Bacteria 2263
244 Ga0436362_0979155 3300039453 Bacteria 4906
245 Ga0466969_0050144 3300044656 Bacteria 2058
246 Ga0466965_0011015 3300044683 Bacteria 4229
247 Ga0466966_0013838 3300044684 Bacteria 5339
248 Ga0466966_0104530 3300044684 Bacteria 1749
249 Ga0466966_0151509 3300044684 Bacteria 1414
250 Ga0466963_0025700 3300044694 Bacteria 3758
251 Ga0466963_0044265 3300044694 Bacteria 2930
252 Ga0466963_0052494 3300044694 Bacteria 2705
253 Ga0466963_0123817 3300044694 Bacteria 1781
254 Ga0466964_0002355 3300044706 Bacteria 6713
255 Ga0466964_0015072 3300044706 Bacteria 2944
256 Ga0466964_0101835 3300044706 Bacteria 1267
257 Ga0466971_0005160 3300044719 Bacteria 5654
258 Ga0466971_0068332 3300044719 Bacteria 1611
259 Ga0466968_0060178 3300044735 Bacteria 1637
260 Ga0466968_0112621 3300044735 Bacteria 1225
261 Ga0466970_0041954 3300044765 Bacteria 2433
262 Ga0466970_0183477 3300044765 Bacteria 1161
263 Ga0466970_0259916 3300044765 Bacteria 974
264 Ga0466957_0009429 3300044842 Bacteria 5573
265 Ga0466957_0260683 3300044842 Bacteria 1155
266 Ga0466957_0263988 3300044842 Unclassified 1148
267 Ga0466960_0003795 3300044901 Bacteria 5854
268 Ga0466960_0326002 3300044901 Bacteria 871
269 Ga0466959_0001765 3300045049 Bacteria 13483
270 Ga0466959_0010144 3300045049 Bacteria 6721
271 Ga0466959_0017553 3300045049 Bacteria 5247
272 Ga0466959_0084777 3300045049 Bacteria 2281
273 Ga0466959_0108970 3300045049 Bacteria 1978
274 Ga0466958_0022809 3300045836 Bacteria 3669
275 Ga0466958_0159921 3300045836 Bacteria 1423
276 Ga0466967_0005063 3300045976 Bacteria 9041
277 Ga0466967_0011914 3300045976 Bacteria 6621
278 Ga0466967_0024001 3300045976 Bacteria 5007
279 Ga0466967_0025452 3300045976 Bacteria 4881
280 Ga0466967_0026301 3300045976 Bacteria 4818
281 Ga0466967_0055957 3300045976 Bacteria 3476
282 Ga0466967_0112781 3300045976 Bacteria 2500
283 Ga0466967_0113219 3300045976 Bacteria 2495
284 Ga0466967_0176866 3300045976 Bacteria 2010
285 Ga0466967_0383361 3300045976 Bacteria 1365
286 Ga0466967_0473365 3300045976 Bacteria 1226
287 Ga0466967_0810175 3300045976 Bacteria 930
288 Ga0495592_0136028 3300046454 Unclassified 1714
289 Ga0495629_0013044 3300046459 Bacteria 6005
290 Ga0495641_0007424 3300046461 Bacteria 6845
291 Ga0495641_0183372 3300046461 Bacteria 937
292 Ga0495641_0186768 3300046461 Bacteria 928
293 Ga0495651_0032322 3300046462 Bacteria 4082
294 Ga0495651_0066219 3300046462 Bacteria 2758
295 Ga0495651_0084866 3300046462 Bacteria 2385
296 Ga0495653_0045365 3300046463 Bacteria 3408
297 Ga0495653_0052264 3300046463 Bacteria 3132
298 Ga0495653_0263953 3300046463 Bacteria 1137
299 Ga0495582_0000257 3300046473 Bacteria 29665
300 Ga0495582_0117608 3300046473 Bacteria 1496
301 Ga0495639_0004139 3300046475 Bacteria 6215
302 Ga0495662_0006168 3300046476 Bacteria 5992
303 Ga0495608_0012978 3300046511 Bacteria 5779
304 Ga0495618_0084290 3300046514 Unclassified 2031
305 Ga0495628_0346624 3300046516 Unclassified 1092
306 Ga0495630_0172724 3300046517 Bacteria 1647
307 Ga0495630_0207282 3300046517 Bacteria 1496
308 Ga0495652_0048321 3300046529 Bacteria 3646
309 Ga0495652_0308112 3300046529 Bacteria 1148
310 Ga0495665_0000792 3300046531 Bacteria 16534
311 Ga0495640_0095668 3300046533 Unclassified 1955
312 Ga0495586_0016481 3300046535 Bacteria 3930
313 Ga0495586_0140568 3300046535 Bacteria 1355
314 Ga0495587_0031366 3300046536 Bacteria 3218
315 Ga0495645_0169345 3300046543 Bacteria 1504
316 Ga0495667_0014527 3300046559 Bacteria 5318
317 Ga0495667_0236836 3300046559 Bacteria 1163
318 Ga0495634_0009943 3300046642 Bacteria 6991
319 Ga0495634_0205772 3300046642 Bacteria 1220
320 Ga0495634_0276956 3300046642 Unclassified 1020
321 Ga0495635_0017044 3300046663 Bacteria 5073
322 Ga0495635_0043327 3300046663 Bacteria 3106
323 Ga0495635_0117348 3300046663 Unclassified 1816
324 Ga0495635_0293909 3300046663 Bacteria 1090
325 Ga0495599_0084244 3300046678 Unclassified 1985
326 Ga0495599_0094703 3300046678 Bacteria 1863
327 Ga0495623_0017810 3300046679 Bacteria 4588
328 Ga0495658_0032782 3300046683 Bacteria 2839
329 Ga0495613_0027113 3300046689 Bacteria 4263
330 Ga0495613_0140016 3300046689 Bacteria 1729
331 Ga0495613_0189326 3300046689 Unclassified 1455
332 Ga0495613_0238193 3300046689 Bacteria 1273
333 Ga0495624_0005119 3300046690 Bacteria 9474
334 Ga0495624_0236965 3300046690 Unclassified 1105
335 Ga0495600_0019411 3300046809 Bacteria 4341
336 Ga0495600_0195047 3300046809 Unclassified 1301
337 Ga0495581_0443697 3300047315 Unclassified 756
338 Ga0495604_0029940 3300047317 Bacteria 4329
339 Ga0495604_0090714 3300047317 Bacteria 2269
340 Ga0495674_0044363 3300047319 Bacteria 3954
341 Ga0495674_0121814 3300047319 Unclassified 2203
342 Ga0495676_0000193 3300047321 Bacteria 48356
343 Ga0495676_0050699 3300047321 Bacteria 3327
344 Ga0495676_0249611 3300047321 Bacteria 1211
345 Ga0495680_0018388 3300047322 Bacteria 5935
346 Ga0495680_0022267 3300047322 Bacteria 5285
347 Ga0495680_0102064 3300047322 Bacteria 2136
348 Ga0495675_0063820 3300047444 Bacteria 2330
349 Ga0495684_0004181 3300047471 Bacteria 11272
350 Ga0495593_0007583 3300047673 Bacteria 6337
351 Ga0495602_0058579 3300048088 Bacteria 3370
352 Ga0495602_0066677 3300048088 Bacteria 3100
353 Ga0495614_0022533 3300048089 Unclassified 2718
354 Ga0496100_0006642 3300048903 Bacteria 6324
355 Ga0496100_0008024 3300048903 Bacteria 5866
356 Ga0496100_0036098 3300048903 Bacteria 3115
357 Ga0496100_0091930 3300048903 Bacteria 2072
358 Ga0496100_0126319 3300048903 Bacteria 1795
359 Ga0496100_0353575 3300048903 Bacteria 1110
360 Ga0496100_0396832 3300048903 Unclassified 1050
361 Ga0496101_0000954 3300048904 Bacteria 17087
362 Ga0496101_0001440 3300048904 Bacteria 14200
363 Ga0496101_0011244 3300048904 Bacteria 5929
364 Ga0496101_0014692 3300048904 Bacteria 5268
365 Ga0496101_0030113 3300048904 Bacteria 3803
366 Ga0496101_0129824 3300048904 Bacteria 1913
367 Ga0496101_0210428 3300048904 Unclassified 1506
368 Ga0496101_0227720 3300048904 Bacteria 1448
369 Ga0496102_0001263 3300048905 Bacteria 22823
370 Ga0496102_0004581 3300048905 Bacteria 11684
371 Ga0496102_0096481 3300048905 Bacteria 2741
372 Ga0496102_0172977 3300048905 Bacteria 2033
373 Ga0496102_0177473 3300048905 Bacteria 2006
374 Ga0496102_0217601 3300048905 Bacteria 1800
375 Ga0496102_0429140 3300048905 Bacteria 1241
376 Ga0496103_0016967 3300048906 Bacteria 4350
377 Ga0496103_0093532 3300048906 Bacteria 1898
378 Ga0496103_0180802 3300048906 Bacteria 1356
379 Ga0496104_0001043 3300048907 Bacteria 23668
380 Ga0496104_0003142 3300048907 Bacteria 14232
381 Ga0496104_0070546 3300048907 Bacteria 3321
382 Ga0496104_0203854 3300048907 Bacteria 1890
383 Ga0496104_0323006 3300048907 Bacteria 1456
384 Ga0496104_0816566 3300048907 Bacteria 838
385 Ga0496105_0000516 3300048908 Bacteria 25503
386 Ga0496105_0024458 3300048908 Bacteria 4907
387 Ga0496105_0033841 3300048908 Bacteria 4200
388 Ga0496105_0143691 3300048908 Bacteria 1963
389 Ga0496105_0315137 3300048908 Bacteria 1255
390 Ga0496106_0001101 3300048909 Bacteria 19982
391 Ga0496106_0067626 3300048909 Bacteria 2724
392 Ga0496107_0002968 3300048910 Bacteria 11230
393 Ga0496107_0030241 3300048910 Bacteria 3860
394 Ga0496107_0182367 3300048910 Bacteria 1559
395 Ga0496107_0420538 3300048910 Bacteria 994
396 Ga0496108_0000939 3300048911 Bacteria 22748
397 Ga0496108_0006437 3300048911 Bacteria 9520
398 Ga0496108_0034920 3300048911 Bacteria 4178
399 Ga0496108_0080333 3300048911 Bacteria 2762
400 Ga0496108_0626658 3300048911 Bacteria 936
401 Ga0496109_0000515 3300048912 Bacteria 32878
402 Ga0496109_0001455 3300048912 Bacteria 19626
403 Ga0496109_0121001 3300048912 Bacteria 2439
404 Ga0496109_0224649 3300048912 Bacteria 1766
405 Ga0496109_0400158 3300048912 Unclassified 1297
406 Ga0496109_0403884 3300048912 Bacteria 1291
407 Ga0496109_0672935 3300048912 Unclassified 972
408 Ga0496109_0760536 3300048912 Bacteria 907
409 Ga0496110_0000329 3300048913 Bacteria 31635
410 Ga0496110_0001622 3300048913 Bacteria 16491
411 Ga0496110_0006010 3300048913 Bacteria 9559
412 Ga0496110_0089725 3300048913 Bacteria 2748
413 Ga0496110_0108385 3300048913 Bacteria 2493
414 Ga0496110_0777382 3300048913 Bacteria 861
415 Ga0496111_0005990 3300048914 Bacteria 7851
416 Ga0496111_0007108 3300048914 Bacteria 7314
417 Ga0496111_0028073 3300048914 Bacteria 3986
418 Ga0496111_0050489 3300048914 Bacteria 3001
419 Ga0496111_0055594 3300048914 Bacteria 2863
420 Ga0496111_0435533 3300048914 Bacteria 968
421 Ga0496112_0012244 3300048915 Bacteria 7876
422 Ga0496112_0014059 3300048915 Bacteria 7410
423 Ga0496112_0090923 3300048915 Bacteria 3021
424 Ga0496112_0103025 3300048915 Bacteria 2824
425 Ga0496112_0316188 3300048915 Bacteria 1506
426 Ga0496113_0061235 3300048916 Bacteria 2840
427 Ga0496114_0000252 3300048917 Bacteria 38765
428 Ga0496114_0000623 3300048917 Bacteria 26186
429 Ga0496114_0012631 3300048917 Bacteria 6765
430 Ga0496114_0027928 3300048917 Bacteria 4626
431 Ga0496114_0045510 3300048917 Bacteria 3646
432 Ga0496114_0051837 3300048917 Bacteria 3417
433 Ga0496114_0524402 3300048917 Bacteria 1047
434 Ga0496114_0634700 3300048917 Bacteria 940
435 Ga0496115_0000516 3300048918 Bacteria 30049
436 Ga0496115_0005752 3300048918 Bacteria 9027
437 Ga0496115_0031737 3300048918 Bacteria 4164
438 Ga0496115_0223106 3300048918 Bacteria 1555
439 Ga0496115_0442373 3300048918 Bacteria 1051
440 Ga0501031_0001012 3300049568 Bacteria 17044
441 Ga0501032_0017546 3300049569 Bacteria 5024
442 Ga0501033_0008261 3300049570 Bacteria 8061
443 Ga0501034_0614073 3300049571 Bacteria 992
444 Ga0501034_0694278 3300049571 Bacteria 917
445 Ga0501036_0013339 3300049572 Bacteria 6825
446 Ga0501036_0226790 3300049572 Bacteria 1568
447 Ga0501037_0033305 3300049573 Bacteria 3806
448 Ga0501038_0024708 3300049574 Bacteria 5357
449 Ga0501039_0016224 3300049575 Bacteria 5707
450 Ga0501040_0045210 3300049576 Bacteria 3002
451 Ga0501040_0048392 3300049576 Bacteria 2906
452 Ga0501040_0380693 3300049576 Bacteria 1012
453 Ga0501041_0002723 3300049577 Bacteria 10080
454 Ga0501042_0026323 3300049578 Bacteria 4088
455 Ga0501042_0259668 3300049578 Bacteria 1254
456 Ga0501043_0033274 3300049579 Bacteria 4055
457 Ga0501046_0008852 3300049580 Bacteria 8744
458 Ga0501046_0544429 3300049580 Bacteria 828
459 Ga0501047_0095718 3300049581 Bacteria 2848
460 Ga0501047_0186919 3300049581 Bacteria 1937
461 Ga0501047_0201772 3300049581 Bacteria 1850
462 Ga0501048_0048398 3300049582 Bacteria 3032
463 Ga0501048_0357915 3300049582 Bacteria 1041
464 Ga0501067_0000441 3300049583 Bacteria 22733
465 Ga0501067_0070324 3300049583 Bacteria 1938
466 Ga0501068_0008359 3300049584 Bacteria 5756
467 Ga0501069_0046792 3300049585 Bacteria 2400
468 Ga0501070_0000336 3300049586 Bacteria 42631
469 Ga0501070_0025673 3300049586 Bacteria 4943
470 Ga0501070_0025798 3300049586 Bacteria 4931
471 Ga0501070_0323143 3300049586 Bacteria 1255
472 Ga0501070_0370563 3300049586 Bacteria 1161
473 Ga0501071_0002640 3300049587 Bacteria 10976
474 Ga0501072_0090939 3300049588 Bacteria 2423
475 Ga0501073_0056388 3300049589 Bacteria 2748
476 Ga0501074_0011616 3300049590 Bacteria 6400
477 Ga0501075_0054546 3300049591 Unclassified 3007
478 Ga0501075_0062903 3300049591 Bacteria 2797
479 Ga0501076_0013188 3300049592 Bacteria 6191
480 Ga0501076_0165574 3300049592 Bacteria 1802
481 Ga0501077_0005427 3300049593 Bacteria 7755
482 Ga0501077_0098213 3300049593 Unclassified 1856
483 Ga0501079_0069536 3300049741 Bacteria 2717
484 Ga0501079_0132147 3300049741 Unclassified 1942
485 Ga0501079_0157150 3300049741 Bacteria 1772
486 Ga0501079_0530414 3300049741 Bacteria 926
487 Ga0501080_0014317 3300049742 Bacteria 7304
488 Ga0501080_0049729 3300049742 Bacteria 3902
489 Ga0501080_0435459 3300049742 Bacteria 1177
490 Ga0501080_0463572 3300049742 Bacteria 1135
491 Ga0501080_0585958 3300049742 Bacteria 991
492 Ga0501080_0612048 3300049742 Unclassified 966
493 Ga0501081_0017689 3300049743 Bacteria 4723
494 Ga0501083_0295375 3300049744 Bacteria 1054
495 Ga0501035_0028450 3300049822 Bacteria 5100
496 Ga0501035_0293109 3300049822 Bacteria 1373
497 Ga0501045_0020844 3300049824 Bacteria 4685
498 Ga0501045_0128330 3300049824 Bacteria 1885
499 Ga0501045_0223936 3300049824 Unclassified 1400
500 nmdc:mga00v17_171098_c1 3300050491 Bacteria 1400
501 nmdc:mga05p37_11677_c1 3300050507 Bacteria 10467
502 nmdc:mga05p37_24402_c1 3300050507 Bacteria 7348
503 nmdc:mga05p37_8461_c1 3300050507 Bacteria 12166
504 nmdc:mga06r32_81667_c1 3300050510 Bacteria 3148
505 nmdc:mga08y16_369068_c1 3300050511 Bacteria 1472
506 nmdc:mga0n895_153971_c1 3300050512 Bacteria 2329
507 nmdc:mga0n895_561590_c1 3300050512 Unclassified 1146
508 Ga0495601_0151167 3300053077 Bacteria 1516
509 Ga0495601_0291756 3300053077 Unclassified 1063
510 Ga0495595_0347440 3300053084 Unclassified 748
511 Ga0495619_0008266 3300053085 Bacteria 6581
512 Ga0495619_0028179 3300053085 Bacteria 3622
513 Ga0495619_0413830 3300053085 Unclassified 930
514 Ga0501084_0036507 3300054114 Bacteria 4104
515 Ga0501084_0068192 3300054114 Bacteria 2978
516 Ga0501082_0005549 3300060353 Bacteria 10953
517 Ga0466962_0000925 3300061719 Bacteria 13294
518 Ga0466962_0007226 3300061719 Bacteria 5322
519 Ga0530510_0001367 3300061734 Bacteria 16309
520 Ga0530510_0201987 3300061734 Unclassified 1476
521 Ga0530510_0342136 3300061734 Bacteria 1123
522 Ga0466957_0285438
523 Ga0070683_100005188
524 Ga0070683_100052872
525 Ga0070683_100096136
526 Ga0070680_100005049
527 Ga0070680_100039540
528 Ga0070680_100270141
529 Ga0070680_100374033
530 Ga0070682_100026241
531 Ga0068868_100062684
532 Ga0068868_100635465
533 Ga0070660_100000141
534 Ga0070660_100024094
535 Ga0070661_100112769
536 Ga0070661_100225379
537 Ga0070659_100312658
538 Ga0070667_100543109
539 Ga0070713_100187956
540 Ga0070700_100116201
541 Ga0070700_100252283
542 Ga0070708_100014388
543 Ga0070708_100634216
544 Ga0070678_100027697
545 Ga0070678_100179189
546 Ga0070681_10041034
547 Ga0070681_10042080
548 Ga0070681_10088841
549 Ga0070681_10539957
550 Ga0070679_100022274
551 Ga0070679_100062902
552 Ga0070679_100160381
553 Ga0070684_100000113
554 Ga0070684_100008888
555 Ga0070684_100090157
556 Ga0070697_100377146
557 Ga0068853_100088001
558 Ga0068853_100194209
559 Ga0070696_100063962
560 Ga0070693_100003773
561 Ga0068855_100011118
562 Ga0068855_100019982
563 Ga0068855_100049393
564 Ga0068855_100053412
565 Ga0068855_100074336
566 Ga0068855_100097623
567 Ga0068855_100105678
568 Ga0068855_100310396
569 Ga0068855_100490826
570 Ga0070664_100061418
571 Ga0068854_100251950
572 Ga0068856_100013077
573 Ga0068856_100101101
574 Ga0068852_100080757
575 Ga0081538_10008294
576 Ga0081538_10010453
577 Ga0081539_10001497
578 Ga0081539_10035930
579 Ga0070717_10016542
580 Ga0070712_100111552
581 Ga0097621_100626845
582 Ga0068871_100785214
583 Ga0075428_100239326
584 Ga0075430_100366448
585 Ga0075431_100243544
586 Ga0075433_10109302
587 Ga0075434_100249028
588 Ga0075429_100495603
589 Ga0075436_100244709
590 Ga0075435_100178964
591 Ga0105240_10038850
592 Ga0111539_10508043
593 Ga0105245_10002806
594 Ga0105245_10174403
595 Ga0114129_10001640
596 Ga0114129_10010090
597 Ga0114129_10047340
598 Ga0114129_10136785
599 Ga0114129_10451287
600 Ga0114129_11396570
601 Ga0105241_10270345
602 Ga0105241_10477063
603 Ga0105242_10236211
604 Ga0105242_10484100
605 Ga0105242_10682848
606 Ga0105237_10373675
607 Ga0105238_10023085
608 Ga0105238_10738784
609 Ga0105249_10137799
610 Ga0105239_10285181
611 Ga0157370_10010500
612 Ga0157370_10015785
613 Ga0157370_10061578
614 Ga0157370_10102421
615 Ga0157369_10002221
616 Ga0157369_10003174
617 Ga0157369_10027208
618 Ga0157369_10234738
619 Ga0157369_10559490
620 Ga0157374_10208498
621 Ga0157374_10294814
622 Ga0157374_10488501
623 Ga0157378_10162962
624 Ga0163162_10642960
625 Ga0157372_10152634
626 Ga0157372_10757022
627 Ga0157372_11240094
628 Ga0157375_10187329
629 Ga0157375_10850516
630 Ga0157379_10541264
631 Ga0157376_10113646
632 Ga0206354_10310690
633 Ga0206354_11113244
634 Ga0206353_10758145
635 Ga0206353_10967932
636 Ga0206353_11404529
637 Ga0213873_10018467
638 Ga0213876_10082864
639 Ga0213871_10006416
640 Ga0207688_10202917
641 Ga0207705_10148261
642 Ga0207705_10489167
643 Ga0207707_10024369
644 Ga0207707_10110895
645 Ga0207671_10240676
646 Ga0207693_10033211
647 Ga0207663_10177439
648 Ga0207663_10455340
649 Ga0207660_10053230
650 Ga0207660_10078728
651 Ga0207657_10000109
652 Ga0207657_10000392
653 Ga0207657_10013534
654 Ga0207657_10066637
655 Ga0207657_10227345
656 Ga0207649_10125053
657 Ga0207652_10094947
658 Ga0207652_10129855
659 Ga0207652_10424931
660 Ga0207659_10150154
661 Ga0207687_10003628
662 Ga0207664_10437330
663 Ga0207690_10042417
664 Ga0207686_10184286
665 Ga0207686_10291235
666 Ga0207709_10287271
667 Ga0207669_10252199
668 Ga0207704_10383501
669 Ga0207661_10003509
670 Ga0207661_10018287
671 Ga0207661_10064810
672 Ga0207661_10164668
673 Ga0207679_10009425
674 Ga0207667_10042303
675 Ga0207667_10058566
676 Ga0207667_10289034
677 Ga0207640_10341975
678 Ga0207678_10268511
679 Ga0207702_10003758
680 Ga0207702_10007088
681 Ga0207702_10144777
682 Ga0207683_10026029
683 Ga0207683_10452610
684 Ga0207698_10586310
685 Ga0265318_10010926
686 Ga0265318_10111917
687 Ga0265318_10132281
688 Ga0265338_10026652
689 Ga0265338_10333572
690 Ga0265320_10122515
691 Ga0265340_10133091
692 Ga0265340_10187366
693 Ga0265339_10169992
694 Ga0265327_10013736
695 Ga0265327_10024933
696 Ga0265327_10037199
697 Ga0265316_10308807
698 Ga0307408_100629580
699 Ga0265313_10088541
700 Ga0265342_10232507
701 Ga0307407_10299393
702 Ga0307412_10017858
703 Ga0307409_100163691
704 Ga0307415_100551340
705 Ga0373945_0043508
706 Ga0373943_0084127
707 Ga0373946_0169229
708 Ga0373935_0092463
709 Ga0373935_0325686
710 Ga0373927_0136537
711 Ga0373933_0294036
712 Ga0373947_0016358
713 Ga0373947_0086631
714 Ga0373925_0137311
715 Ga0373925_0674723
716 Ga0395899_0057322
717 Ga0395899_0158708
718 Ga0395899_0171636
719 Ga0395899_0226922
720 Ga0395899_0235371
721 Ga0395899_0242535
722 Ga0395900_0008396
723 Ga0395900_0021761
724 Ga0395900_0023659
725 Ga0395900_0122972
726 Ga0395900_0125283
727 Ga0395900_0145641
728 Ga0395900_0209576
729 Ga0395900_0247059
730 Ga0395900_0395868
731 Ga0395898_0012581
732 Ga0395898_0016687
733 Ga0395898_0039071
734 Ga0395898_0067882
735 Ga0395898_0079826
736 Ga0395898_0096794
737 Ga0395898_0173217
738 Ga0395898_0430097
739 Ga0395905_0012600
740 Ga0395905_0030043
741 Ga0395905_0063883
742 Ga0395905_0086643
743 Ga0395905_0096742
744 Ga0395905_0138027
745 Ga0395901_0005273
746 Ga0395901_0008010
747 Ga0395901_0010355
748 Ga0395901_0022023
749 Ga0395901_0028650
750 Ga0395901_0055169
751 Ga0395901_0089518
752 Ga0395901_0103608
753 Ga0395901_0109586
754 Ga0395901_0117926
755 Ga0395901_0125418
756 Ga0395901_0147561
757 Ga0395901_0418294
758 Ga0395901_0448770
759 Ga0395901_0477461
760 Ga0395901_0588679
761 Ga0436365_1316994
762 Ga0436360_1056216
763 Ga0436363_1447489
764 Ga0436363_1452270
765 Ga0436362_0979155
766 Ga0466969_0050144
767 Ga0466965_0011015
768 Ga0466966_0013838
769 Ga0466966_0104530
770 Ga0466966_0151509
771 Ga0466963_0025700
772 Ga0466963_0044265
773 Ga0466963_0052494
774 Ga0466963_0123817
775 Ga0466964_0002355
776 Ga0466964_0015072
777 Ga0466964_0101835
778 Ga0466971_0005160
779 Ga0466971_0068332
780 Ga0466968_0060178
781 Ga0466968_0112621
782 Ga0466970_0041954
783 Ga0466970_0183477
784 Ga0466970_0259916
785 Ga0466957_0009429
786 Ga0466957_0260683
787 Ga0466957_0263988
788 Ga0466960_0003795
789 Ga0466960_0326002
790 Ga0466959_0001765
791 Ga0466959_0010144
792 Ga0466959_0017553
793 Ga0466959_0084777
794 Ga0466959_0108970
795 Ga0466958_0022809
796 Ga0466958_0159921
797 Ga0466967_0005063
798 Ga0466967_0011914
799 Ga0466967_0024001
800 Ga0466967_0025452
801 Ga0466967_0026301
802 Ga0466967_0055957
803 Ga0466967_0112781
804 Ga0466967_0113219
805 Ga0466967_0176866
806 Ga0466967_0383361
807 Ga0466967_0473365
808 Ga0466967_0810175
809 Ga0495592_0136028
810 Ga0495629_0013044
811 Ga0495641_0007424
812 Ga0495641_0183372
813 Ga0495641_0186768
814 Ga0495651_0032322
815 Ga0495651_0066219
816 Ga0495651_0084866
817 Ga0495653_0045365
818 Ga0495653_0052264
819 Ga0495653_0263953
820 Ga0495582_0000257
821 Ga0495582_0117608
822 Ga0495639_0004139
823 Ga0495662_0006168
824 Ga0495608_0012978
825 Ga0495618_0084290
826 Ga0495628_0346624
827 Ga0495630_0172724
828 Ga0495630_0207282
829 Ga0495652_0048321
830 Ga0495652_0308112
831 Ga0495665_0000792
832 Ga0495640_0095668
833 Ga0495586_0016481
834 Ga0495586_0140568
835 Ga0495587_0031366
836 Ga0495645_0169345
837 Ga0495667_0014527
838 Ga0495667_0236836
839 Ga0495634_0009943
840 Ga0495634_0205772
841 Ga0495634_0276956
842 Ga0495635_0017044
843 Ga0495635_0043327
844 Ga0495635_0117348
845 Ga0495635_0293909
846 Ga0495599_0084244
847 Ga0495599_0094703
848 Ga0495623_0017810
849 Ga0495658_0032782
850 Ga0495613_0027113
851 Ga0495613_0140016
852 Ga0495613_0189326
853 Ga0495613_0238193
854 Ga0495624_0005119
855 Ga0495624_0236965
856 Ga0495600_0019411
857 Ga0495600_0195047
858 Ga0495581_0443697
859 Ga0495604_0029940
860 Ga0495604_0090714
861 Ga0495674_0044363
862 Ga0495674_0121814
863 Ga0495676_0000193
864 Ga0495676_0050699
865 Ga0495676_0249611
866 Ga0495680_0018388
867 Ga0495680_0022267
868 Ga0495680_0102064
869 Ga0495675_0063820
870 Ga0495684_0004181
871 Ga0495593_0007583
872 Ga0495602_0058579
873 Ga0495602_0066677
874 Ga0495614_0022533
875 Ga0496100_0006642
876 Ga0496100_0008024
877 Ga0496100_0036098
878 Ga0496100_0091930
879 Ga0496100_0126319
880 Ga0496100_0353575
881 Ga0496100_0396832
882 Ga0496101_0000954
883 Ga0496101_0001440
884 Ga0496101_0011244
885 Ga0496101_0014692
886 Ga0496101_0030113
887 Ga0496101_0129824
888 Ga0496101_0210428
889 Ga0496101_0227720
890 Ga0496102_0001263
891 Ga0496102_0004581
892 Ga0496102_0096481
893 Ga0496102_0172977
894 Ga0496102_0177473
895 Ga0496102_0217601
896 Ga0496102_0429140
897 Ga0496103_0016967
898 Ga0496103_0093532
899 Ga0496103_0180802
900 Ga0496104_0001043
901 Ga0496104_0003142
902 Ga0496104_0070546
903 Ga0496104_0203854
904 Ga0496104_0323006
905 Ga0496104_0816566
906 Ga0496105_0000516
907 Ga0496105_0024458
908 Ga0496105_0033841
909 Ga0496105_0143691
910 Ga0496105_0315137
911 Ga0496106_0001101
912 Ga0496106_0067626
913 Ga0496107_0002968
914 Ga0496107_0030241
915 Ga0496107_0182367
916 Ga0496107_0420538
917 Ga0496108_0000939
918 Ga0496108_0006437
919 Ga0496108_0034920
920 Ga0496108_0080333
921 Ga0496108_0626658
922 Ga0496109_0000515
923 Ga0496109_0001455
924 Ga0496109_0121001
925 Ga0496109_0224649
926 Ga0496109_0400158
927 Ga0496109_0403884
928 Ga0496109_0672935
929 Ga0496109_0760536
930 Ga0496110_0000329
931 Ga0496110_0001622
932 Ga0496110_0006010
933 Ga0496110_0089725
934 Ga0496110_0108385
935 Ga0496110_0777382
936 Ga0496111_0005990
937 Ga0496111_0007108
938 Ga0496111_0028073
939 Ga0496111_0050489
940 Ga0496111_0055594
941 Ga0496111_0435533
942 Ga0496112_0012244
943 Ga0496112_0014059
944 Ga0496112_0090923
945 Ga0496112_0103025
946 Ga0496112_0316188
947 Ga0496113_0061235
948 Ga0496114_0000252
949 Ga0496114_0000623
950 Ga0496114_0012631
951 Ga0496114_0027928
952 Ga0496114_0045510
953 Ga0496114_0051837
954 Ga0496114_0524402
955 Ga0496114_0634700
956 Ga0496115_0000516
957 Ga0496115_0005752
958 Ga0496115_0031737
959 Ga0496115_0223106
960 Ga0496115_0442373
961 Ga0501031_0001012
962 Ga0501032_0017546
963 Ga0501033_0008261
964 Ga0501034_0614073
965 Ga0501034_0694278
966 Ga0501036_0013339
967 Ga0501036_0226790
968 Ga0501037_0033305
969 Ga0501038_0024708
970 Ga0501039_0016224
971 Ga0501040_0045210
972 Ga0501040_0048392
973 Ga0501040_0380693
974 Ga0501041_0002723
975 Ga0501042_0026323
976 Ga0501042_0259668
977 Ga0501043_0033274
978 Ga0501046_0008852
979 Ga0501046_0544429
980 Ga0501047_0095718
981 Ga0501047_0186919
982 Ga0501047_0201772
983 Ga0501048_0048398
984 Ga0501048_0357915
985 Ga0501067_0000441
986 Ga0501067_0070324
987 Ga0501068_0008359
988 Ga0501069_0046792
989 Ga0501070_0000336
990 Ga0501070_0025673
991 Ga0501070_0025798
992 Ga0501070_0323143
993 Ga0501070_0370563
994 Ga0501071_0002640
995 Ga0501072_0090939
996 Ga0501073_0056388
997 Ga0501074_0011616
998 Ga0501075_0054546
999 Ga0501075_0062903
1000 Ga0501076_0013188
1001 Ga0501076_0165574
1002 Ga0501077_0005427
1003 Ga0501077_0098213
1004 Ga0501079_0069536
1005 Ga0501079_0132147
1006 Ga0501079_0157150
1007 Ga0501079_0530414
1008 Ga0501080_0014317
1009 Ga0501080_0049729
1010 Ga0501080_0435459
1011 Ga0501080_0463572
1012 Ga0501080_0585958
1013 Ga0501080_0612048
1014 Ga0501081_0017689
1015 Ga0501083_0295375
1016 Ga0501035_0028450
1017 Ga0501035_0293109
1018 Ga0501045_0020844
1019 Ga0501045_0128330
1020 Ga0501045_0223936
1021 nmdc:mga00v17_171098_c1
1022 nmdc:mga05p37_11677_c1
1023 nmdc:mga05p37_24402_c1
1024 nmdc:mga05p37_8461_c1
1025 nmdc:mga06r32_81667_c1
1026 nmdc:mga08y16_369068_c1
1027 nmdc:mga0n895_153971_c1
1028 nmdc:mga0n895_561590_c1
1029 Ga0495601_0151167
1030 Ga0495601_0291756
1031 Ga0495595_0347440
1032 Ga0495619_0008266
1033 Ga0495619_0028179
1034 Ga0495619_0413830
1035 Ga0501084_0036507
1036 Ga0501084_0068192
1037 Ga0501082_0005549
1038 Ga0466962_0000925
1039 Ga0466962_0007226
1040 Ga0530510_0001367
1041 Ga0530510_0201987
1042 Ga0530510_0342136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

6

180

0.87

PF02709

Glyco_transf_7C

N-terminal domain of galactosyltransferase

147

219

0.82

PF13632

Glyco_trans_2_3

Glycosyl transferase family group 2

77

262

0.8

PF13641

Glyco_tranf_2_3

Glycosyltransferase like family 2

28

233

0.78

PF11397

GlcNAc

Glycosyltransferase (GlcNAc)

109

266

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nqa-assembly2.cif.gz_B crystal structure of galnac-t4 in complex with the monoglycopeptide 3 0.7676 2 210
6e4r-assembly1.cif.gz_A crystal structure of the drosophila melanogaster polypeptide n-acetylgalactosaminyl transferase pgant9b 0.7646 2 223
5nqa-assembly1.cif.gz_A crystal structure of galnac-t4 in complex with the monoglycopeptide 3 0.7645 2 210
6nqt-assembly1.cif.gz_C galnac-t2 soaked with udp-sugar 0.7591 2 210
1xhb-assembly1.cif.gz_A the crystal structure of udp-galnac: polypeptide alpha-n-acetylgalactosaminyltransferase-t1 0.7524 2 210
ID Description Score Start End Superfamily
af_P9WMY3_4_248_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.849 3 219 3.90.550.10
af_A0A2R8QCE8_89_340_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8394 2 96 3.90.550.10
af_P36667_1_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8102 3 221 3.90.550.10
af_P36667_1_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7683 3 221 3.90.550.10
af_O88422_414_796_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7676 2 234 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7W1N511-F1-model_v4 Glycosyltransferase family 2 protein 0.9811 2 246 GO:0016740
AF-A0A7W1N511-F1-model_v4 Glycosyltransferase family 2 protein 0.9732 2 246 GO:0016740
AF-A0A7W0QL83-F1-model_v4 Glycosyltransferase family 2 protein 0.9416 1 192 GO:0016740
AF-A0A538JIR2-F1-model_v4 Glycosyltransferase family 2 protein 0.9358 1 246 GO:0016740
AF-A0A538LKB4-F1-model_v4 Glycosyltransferase family 2 protein 0.9352 1 246 GO:0016740

Map