F458735

General Info

Members Datasets Scaffolds Average Seq Length
521 224 1042 134

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0048221|Ga0466963_0048221_764_1225
Length 153
Sequence VRRLLARRRRAHRDRRGGRVLTHGIHHLGVAVDDLDEAVERYRALFGATVEHRERVEDQGVEAASLRVGDSRVELLAPLGPDTPVGKFLANRGPGMHHVAFGVEDVAAELARLRAEGAELIDEEPRRGMFGLEVAFVHPEATGGVLAEFVGDG

Samples

Sample ID Description Type Environment
1 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
100 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
101 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
106 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
126 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
127 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
132 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
138 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
146 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
149 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
150 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
151 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
152 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
171 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
172 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
180 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
207 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 1.54
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 10.94
Rhizosphere 88.29
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466963_0048221 3300044694 Bacteria 2813
2 rootH1_10292968 3300003323 Bacteria 1199
3 Ga0070658_10071776 3300005327 Bacteria 2836
4 Ga0070658_10109472 3300005327 Bacteria 2287
5 Ga0070658_10124950 3300005327 Bacteria 2141
6 Ga0070658_10304636 3300005327 Bacteria 1359
7 Ga0070658_10580596 3300005327 Bacteria 971
8 Ga0070658_11390298 3300005327 Unclassified 609
9 Ga0070683_100044955 3300005329 Bacteria 4075
10 Ga0070683_100110336 3300005329 Bacteria 2595
11 Ga0070683_100444017 3300005329 Bacteria 1238
12 Ga0070683_100968074 3300005329 Bacteria 817
13 Ga0070680_100135895 3300005336 Bacteria 2060
14 Ga0070680_100170778 3300005336 Bacteria 1829
15 Ga0070680_100196018 3300005336 Bacteria 1703
16 Ga0070680_100202225 3300005336 Bacteria 1675
17 Ga0070680_100433042 3300005336 Bacteria 1123
18 Ga0070682_100204048 3300005337 Bacteria 1396
19 Ga0070682_100205321 3300005337 Bacteria 1393
20 Ga0070682_100450471 3300005337 Bacteria 986
21 Ga0070660_100000984 3300005339 Bacteria 19070
22 Ga0070660_100003072 3300005339 Bacteria 11477
23 Ga0070660_100200934 3300005339 Bacteria 1617
24 Ga0070660_100632815 3300005339 Bacteria 895
25 Ga0070661_100018627 3300005344 Bacteria 4939
26 Ga0070661_100025172 3300005344 Bacteria 4275
27 Ga0070661_100140443 3300005344 Bacteria 1820
28 Ga0070661_101051707 3300005344 Bacteria 677
29 Ga0070661_101383773 3300005344 Bacteria 592
30 Ga0070671_100030132 3300005355 Bacteria 4477
31 Ga0070671_100300522 3300005355 Unclassified 1367
32 Ga0070674_100134782 3300005356 Bacteria 1846
33 Ga0070673_101725403 3300005364 Unclassified 593
34 Ga0070659_100036698 3300005366 Bacteria 3821
35 Ga0070659_100267777 3300005366 Bacteria 1419
36 Ga0070659_100479742 3300005366 Bacteria 1058
37 Ga0070659_101852279 3300005366 Bacteria 541
38 Ga0070709_10236343 3300005434 Unclassified 1310
39 Ga0070714_100126462 3300005435 Bacteria 2279
40 Ga0070714_100714110 3300005435 Bacteria 968
41 Ga0070714_100898596 3300005435 Bacteria 860
42 Ga0070714_102354563 3300005435 Bacteria 518
43 Ga0070713_100184638 3300005436 Bacteria 1876
44 Ga0070711_100035801 3300005439 Bacteria 3322
45 Ga0070711_100085561 3300005439 Bacteria 2259
46 Ga0070711_100094144 3300005439 Bacteria 2165
47 Ga0070711_100217910 3300005439 Bacteria 1482
48 Ga0070663_100445763 3300005455 Unclassified 1066
49 Ga0070663_101618528 3300005455 Bacteria 578
50 Ga0070678_100127182 3300005456 Bacteria 2019
51 Ga0070681_10027300 3300005458 Bacteria 5739
52 Ga0070681_10052495 3300005458 Bacteria 4066
53 Ga0070681_10060785 3300005458 Bacteria 3754
54 Ga0070681_10136672 3300005458 Bacteria 2381
55 Ga0070681_11906731 3300005458 Unclassified 522
56 Ga0070706_100232044 3300005467 Bacteria 1723
57 Ga0070706_102056342 3300005467 Unclassified 517
58 Ga0070707_100162991 3300005468 Bacteria 2172
59 Ga0070707_100454313 3300005468 Bacteria 1242
60 Ga0070698_100819855 3300005471 Bacteria 875
61 Ga0070699_100516033 3300005518 Unclassified 1086
62 Ga0070679_100038964 3300005530 Bacteria 4725
63 Ga0070679_100161586 3300005530 Bacteria 2214
64 Ga0070679_100183435 3300005530 Bacteria 2065
65 Ga0070679_100194584 3300005530 Bacteria 1995
66 Ga0070679_100265153 3300005530 Bacteria 1673
67 Ga0070679_100452484 3300005530 Bacteria 1229
68 Ga0070679_101927993 3300005530 Bacteria 539
69 Ga0070684_100133970 3300005535 Bacteria 2237
70 Ga0070684_100513152 3300005535 Bacteria 1111
71 Ga0070684_100672445 3300005535 Bacteria 964
72 Ga0070684_101310683 3300005535 Unclassified 682
73 Ga0068853_100080607 3300005539 Bacteria 2848
74 Ga0068853_100398598 3300005539 Bacteria 1288
75 Ga0068853_101190603 3300005539 Bacteria 736
76 Ga0070696_100073312 3300005546 Bacteria 2412
77 Ga0070696_100267889 3300005546 Bacteria 1298
78 Ga0070665_100006267 3300005548 Bacteria 12161
79 Ga0068855_100038428 3300005563 Bacteria 5687
80 Ga0068855_100083165 3300005563 Bacteria 3708
81 Ga0068855_100129663 3300005563 Bacteria 2881
82 Ga0068855_100182824 3300005563 Bacteria 2369
83 Ga0068855_100343058 3300005563 Bacteria 1646
84 Ga0068855_100375978 3300005563 Bacteria 1561
85 Ga0070664_100412000 3300005564 Bacteria 1237
86 Ga0068857_100151392 3300005577 Bacteria 2102
87 Ga0068856_100082953 3300005614 Bacteria 3182
88 Ga0068856_100199967 3300005614 Bacteria 2013
89 Ga0068856_101430398 3300005614 Bacteria 706
90 Ga0068852_100385059 3300005616 Bacteria 1376
91 Ga0068852_100943737 3300005616 Bacteria 881
92 Ga0070715_10857495 3300006163 Bacteria 556
93 Ga0070716_100693840 3300006173 Bacteria 777
94 Ga0070712_100034010 3300006175 Bacteria 3453
95 Ga0070712_100389350 3300006175 Unclassified 1149
96 Ga0097621_100105033 3300006237 Bacteria 2381
97 Ga0097621_100433161 3300006237 Unclassified 1182
98 Ga0068871_100285407 3300006358 Unclassified 1445
99 Ga0075433_10549309 3300006852 Bacteria 1015
100 Ga0075434_100013677 3300006871 Bacteria 7736
101 Ga0075434_100373841 3300006871 Unclassified 1446
102 Ga0075435_100004708 3300007076 Bacteria 9415
103 Ga0075435_101455486 3300007076 Bacteria 601
104 Ga0105240_10184412 3300009093 Bacteria 2459
105 Ga0105240_10233307 3300009093 Bacteria 2137
106 Ga0105240_10919546 3300009093 Bacteria 940
107 Ga0105245_10024661 3300009098 Bacteria 5283
108 Ga0105243_10239752 3300009148 Bacteria 1613
109 Ga0105241_10613432 3300009174 Bacteria 984
110 Ga0105241_10682185 3300009174 Bacteria 936
111 Ga0105241_11664555 3300009174 Bacteria 619
112 Ga0105241_11915669 3300009174 Bacteria 581
113 Ga0105248_10395052 3300009177 Bacteria 1557
114 Ga0105237_10051886 3300009545 Bacteria 4119
115 Ga0105237_10399314 3300009545 Bacteria 1379
116 Ga0105237_11769648 3300009545 Bacteria 625
117 Ga0105238_10036125 3300009551 Bacteria 5022
118 Ga0105238_10091271 3300009551 Unclassified 3033
119 Ga0105239_10093789 3300010375 Bacteria 3315
120 Ga0105239_11301305 3300010375 Bacteria 838
121 Ga0157373_10036098 3300013100 Bacteria 3548
122 Ga0157371_10538129 3300013102 Unclassified 865
123 Ga0157371_10626933 3300013102 Bacteria 801
124 Ga0157370_10103812 3300013104 Bacteria 2660
125 Ga0157370_10255348 3300013104 Bacteria 1621
126 Ga0157370_10404787 3300013104 Bacteria 1256
127 Ga0157370_10406221 3300013104 Bacteria 1253
128 Ga0157369_10078044 3300013105 Bacteria 3548
129 Ga0157369_10103318 3300013105 Bacteria 3036
130 Ga0157369_10378061 3300013105 Bacteria 1470
131 Ga0157369_10493880 3300013105 Bacteria 1266
132 Ga0157369_11813542 3300013105 Unclassified 619
133 Ga0157374_10474181 3300013296 Bacteria 1254
134 Ga0157374_10494395 3300013296 Bacteria 1227
135 Ga0157374_10543509 3300013296 Bacteria 1169
136 Ga0157378_10560519 3300013297 Unclassified 1149
137 Ga0157372_10075424 3300013307 Bacteria 3805
138 Ga0157372_10101705 3300013307 Bacteria 3281
139 Ga0157372_10408108 3300013307 Bacteria 1583
140 Ga0157372_10922575 3300013307 Bacteria 1013
141 Ga0157372_11871855 3300013307 Bacteria 690
142 Ga0157375_10031575 3300013308 Bacteria 5009
143 Ga0157375_11651607 3300013308 Unclassified 758
144 Ga0157376_10122094 3300014969 Bacteria 2310
145 Ga0197907_11168919 3300020069 Bacteria 2619
146 Ga0206356_10824180 3300020070 Bacteria 2217
147 Ga0206356_11505166 3300020070 Bacteria 2301
148 Ga0206354_10875370 3300020081 Bacteria 1764
149 Ga0206354_10959969 3300020081 Bacteria 1623
150 Ga0206353_10361018 3300020082 Bacteria 3733
151 Ga0206353_11188271 3300020082 Bacteria 1092
152 Ga0206353_11241608 3300020082 Bacteria 3416
153 Ga0213876_10440322 3300021384 Unclassified 693
154 Ga0207692_10096616 3300025898 Bacteria 1613
155 Ga0207647_10170945 3300025904 Unclassified 1265
156 Ga0207685_10207848 3300025905 Bacteria 924
157 Ga0207705_10010740 3300025909 Bacteria 6647
158 Ga0207705_10116303 3300025909 Unclassified 1980
159 Ga0207705_10517098 3300025909 Bacteria 927
160 Ga0207705_10869010 3300025909 Unclassified 699
161 Ga0207684_10363788 3300025910 Bacteria 1245
162 Ga0207654_10040492 3300025911 Bacteria 2626
163 Ga0207707_10038673 3300025912 Bacteria 4169
164 Ga0207707_10064418 3300025912 Bacteria 3190
165 Ga0207707_10127427 3300025912 Bacteria 2226
166 Ga0207707_10282733 3300025912 Bacteria 1437
167 Ga0207695_10523286 3300025913 Bacteria 1068
168 Ga0207695_10721834 3300025913 Bacteria 877
169 Ga0207695_10889855 3300025913 Bacteria 770
170 Ga0207671_10163475 3300025914 Bacteria 1725
171 Ga0207671_11367496 3300025914 Bacteria 550
172 Ga0207693_10033769 3300025915 Bacteria 4036
173 Ga0207693_10126164 3300025915 Unclassified 2012
174 Ga0207663_10017655 3300025916 Bacteria 3982
175 Ga0207663_10040265 3300025916 Bacteria 2839
176 Ga0207663_10275996 3300025916 Bacteria 1247
177 Ga0207660_10061608 3300025917 Bacteria 2700
178 Ga0207660_10217866 3300025917 Bacteria 1497
179 Ga0207660_10626540 3300025917 Bacteria 877
180 Ga0207660_10682973 3300025917 Bacteria 837
181 Ga0207660_11368481 3300025917 Bacteria 574
182 Ga0207657_10001116 3300025919 Bacteria 28490
183 Ga0207657_10001688 3300025919 Bacteria 23805
184 Ga0207657_10002091 3300025919 Bacteria 21596
185 Ga0207657_10033596 3300025919 Bacteria 4623
186 Ga0207657_10088832 3300025919 Bacteria 2582
187 Ga0207649_10038182 3300025920 Unclassified 2906
188 Ga0207649_10131369 3300025920 Bacteria 1701
189 Ga0207649_10707967 3300025920 Bacteria 781
190 Ga0207652_10103705 3300025921 Bacteria 2515
191 Ga0207652_10384210 3300025921 Bacteria 1267
192 Ga0207652_10398240 3300025921 Bacteria 1242
193 Ga0207652_10453181 3300025921 Bacteria 1156
194 Ga0207652_10662697 3300025921 Unclassified 933
195 Ga0207652_10812430 3300025921 Bacteria 830
196 Ga0207646_10195486 3300025922 Bacteria 1827
197 Ga0207646_10234348 3300025922 Bacteria 1658
198 Ga0207646_10911309 3300025922 Bacteria 779
199 Ga0207694_10076218 3300025924 Bacteria 2626
200 Ga0207687_10050996 3300025927 Bacteria 2883
201 Ga0207700_10128892 3300025928 Bacteria 2062
202 Ga0207700_10663819 3300025928 Bacteria 930
203 Ga0207664_10195708 3300025929 Bacteria 1742
204 Ga0207664_10871841 3300025929 Unclassified 809
205 Ga0207644_10041728 3300025931 Bacteria 3248
206 Ga0207644_10993597 3300025931 Bacteria 704
207 Ga0207690_10027844 3300025932 Bacteria 3575
208 Ga0207690_10678221 3300025932 Bacteria 846
209 Ga0207690_10773675 3300025932 Unclassified 792
210 Ga0207709_10063287 3300025935 Bacteria 2318
211 Ga0207665_11478093 3300025939 Unclassified 540
212 Ga0207661_10041610 3300025944 Bacteria 3618
213 Ga0207661_10223529 3300025944 Bacteria 1665
214 Ga0207661_10360498 3300025944 Bacteria 1313
215 Ga0207679_10238423 3300025945 Bacteria 1540
216 Ga0207679_11346888 3300025945 Bacteria 655
217 Ga0207667_10136703 3300025949 Bacteria 2524
218 Ga0207667_10151851 3300025949 Bacteria 2383
219 Ga0207667_10268765 3300025949 Bacteria 1743
220 Ga0207667_10358952 3300025949 Bacteria 1486
221 Ga0207667_10796846 3300025949 Bacteria 942
222 Ga0207640_10163253 3300025981 Bacteria 1651
223 Ga0207640_11925520 3300025981 Bacteria 535
224 Ga0207639_10174636 3300026041 Bacteria 1823
225 Ga0207639_10181110 3300026041 Bacteria 1792
226 Ga0207639_10521594 3300026041 Bacteria 1088
227 Ga0207678_10434199 3300026067 Unclassified 1140
228 Ga0207678_10490590 3300026067 Bacteria 1070
229 Ga0207702_10044324 3300026078 Bacteria 3738
230 Ga0207702_11490721 3300026078 Bacteria 670
231 Ga0207674_10005383 3300026116 Bacteria 15230
232 Ga0207674_10480200 3300026116 Bacteria 1201
233 Ga0207683_10182178 3300026121 Bacteria 1905
234 Ga0207698_10111341 3300026142 Bacteria 2295
235 Ga0207698_10186403 3300026142 Bacteria 1843
236 Ga0268266_10157046 3300028379 Bacteria 2055
237 Ga0265334_10084034 3300028573 Bacteria 1169
238 Ga0265322_10013088 3300028654 Bacteria 2401
239 Ga0265322_10014767 3300028654 Bacteria 2257
240 Ga0265338_10041239 3300028800 Bacteria 4320
241 Ga0265328_10218183 3300031239 Unclassified 726
242 Ga0265340_10069006 3300031247 Bacteria 1678
243 Ga0265339_10281725 3300031249 Bacteria 797
244 Ga0265331_10037099 3300031250 Bacteria 2388
245 Ga0265327_10113942 3300031251 Bacteria 1288
246 Ga0265327_10165318 3300031251 Bacteria 1019
247 Ga0265316_10043923 3300031344 Bacteria 3557
248 Ga0265316_10129976 3300031344 Bacteria 1897
249 Ga0265316_10333048 3300031344 Bacteria 1101
250 Ga0265314_10030085 3300031711 Bacteria 4024
251 Ga0265314_10231530 3300031711 Bacteria 1071
252 Ga0373926_0279742 3300035083 Bacteria 650
253 Ga0373944_0000546 3300035089 Bacteria 8875
254 Ga0373923_0034633 3300035111 Bacteria 2051
255 Ga0373936_0077702 3300035113 Bacteria 1377
256 Ga0373945_0001992 3300035116 Bacteria 6342
257 Ga0373953_0082163 3300035117 Bacteria 1341
258 Ga0373954_0035967 3300035118 Bacteria 2298
259 Ga0373943_0161109 3300035170 Bacteria 1221
260 Ga0373946_0003881 3300035171 Bacteria 5314
261 Ga0373955_0325221 3300035172 Bacteria 929
262 Ga0373935_0037892 3300035692 Bacteria 3018
263 Ga0373927_0046630 3300035695 Bacteria 2804
264 Ga0373933_0986223 3300035724 Bacteria 555
265 Ga0373947_0003461 3300035725 Bacteria 9331
266 Ga0373937_0164894 3300036401 Bacteria 2077
267 Ga0373925_0002437 3300037068 Bacteria 14925
268 Ga0395899_0282984 3300037312 Bacteria 1128
269 Ga0395900_0243487 3300037418 Bacteria 1803
270 Ga0395900_0558762 3300037418 Bacteria 1088
271 Ga0395900_0936333 3300037418 Viruses 788
272 Ga0395898_0009120 3300037466 Bacteria 10449
273 Ga0395898_0147220 3300037466 Bacteria 2254
274 Ga0395898_0159006 3300037466 Bacteria 2161
275 Ga0436364_0197195 3300037853 Bacteria 2562
276 Ga0395901_0199366 3300038443 Bacteria 2098
277 Ga0395901_0348694 3300038443 Bacteria 1528
278 Ga0436365_0886660 3300039437 Bacteria 1268
279 Ga0439448_0206687 3300042005 Bacteria 689
280 Ga0466969_0020610 3300044656 Bacteria 3413
281 Ga0466965_0043874 3300044683 Bacteria 2209
282 Ga0466966_0064461 3300044684 Bacteria 2306
283 Ga0466966_0070585 3300044684 Bacteria 2190
284 Ga0466966_0129382 3300044684 Bacteria 1547
285 Ga0466961_0003261 3300044693 Bacteria 10104
286 Ga0466961_0004978 3300044693 Bacteria 8356
287 Ga0466961_0070676 3300044693 Bacteria 2216
288 Ga0466963_0005929 3300044694 Bacteria 7193
289 Ga0466963_0014022 3300044694 Bacteria 4937
290 Ga0466963_0022115 3300044694 Bacteria 4023
291 Ga0466963_0025079 3300044694 Bacteria 3799
292 Ga0466963_0025670 3300044694 Bacteria 3760
293 Ga0466963_0126468 3300044694 Bacteria 1762
294 Ga0466963_0156188 3300044694 Bacteria 1586
295 Ga0466963_0328294 3300044694 Bacteria 1077
296 Ga0466963_0473234 3300044694 Bacteria 884
297 Ga0466963_0502978 3300044694 Unclassified 856
298 Ga0466963_0768003 3300044694 Bacteria 680
299 Ga0466963_0828839 3300044694 Bacteria 652
300 Ga0466964_0002699 3300044706 Bacteria 6359
301 Ga0466964_0027347 3300044706 Bacteria 2239
302 Ga0466964_0031295 3300044706 Bacteria 2109
303 Ga0466971_0004887 3300044719 Bacteria 5794
304 Ga0466971_0009151 3300044719 Bacteria 4331
305 Ga0466968_0042180 3300044735 Bacteria 1928
306 Ga0466968_0077623 3300044735 Bacteria 1455
307 Ga0466968_0106750 3300044735 Bacteria 1255
308 Ga0466968_0376331 3300044735 Bacteria 693
309 Ga0466970_0131126 3300044765 Bacteria 1377
310 Ga0466970_0480204 3300044765 Bacteria 714
311 Ga0466957_0000806 3300044842 Bacteria 15982
312 Ga0466957_0009673 3300044842 Bacteria 5504
313 Ga0466957_0026641 3300044842 Bacteria 3431
314 Ga0466957_0049029 3300044842 Bacteria 2567
315 Ga0466957_0555728 3300044842 Bacteria 800
316 Ga0466960_0853466 3300044901 Bacteria 553
317 Ga0466959_0022707 3300045049 Bacteria 4639
318 Ga0466959_0023901 3300045049 Bacteria 4524
319 Ga0466959_0048000 3300045049 Bacteria 3139
320 Ga0466959_0167664 3300045049 Bacteria 1541
321 Ga0466959_0347908 3300045049 Bacteria 1011
322 Ga0466959_0484999 3300045049 Bacteria 836
323 Ga0466958_0004015 3300045836 Bacteria 7711
324 Ga0466958_0021540 3300045836 Bacteria 3769
325 Ga0466958_0033010 3300045836 Bacteria 3082
326 Ga0466958_0196388 3300045836 Bacteria 1283
327 Ga0466958_0682111 3300045836 Bacteria 669
328 Ga0466958_1104734 3300045836 Bacteria 518
329 Ga0466967_0001528 3300045976 Bacteria 13533
330 Ga0466967_0002124 3300045976 Bacteria 12152
331 Ga0466967_0005982 3300045976 Bacteria 8541
332 Ga0466967_0010806 3300045976 Bacteria 6870
333 Ga0466967_0012474 3300045976 Bacteria 6503
334 Ga0466967_0012764 3300045976 Bacteria 6452
335 Ga0466967_0023094 3300045976 Bacteria 5091
336 Ga0466967_0041414 3300045976 Bacteria 3971
337 Ga0466967_0048701 3300045976 Bacteria 3702
338 Ga0466967_0093171 3300045976 Bacteria 2740
339 Ga0466967_0200538 3300045976 Bacteria 1890
340 Ga0466967_0202212 3300045976 Bacteria 1882
341 Ga0466967_0252031 3300045976 Bacteria 1686
342 Ga0466967_0426715 3300045976 Bacteria 1293
343 Ga0466967_0703477 3300045976 Bacteria 1001
344 Ga0495592_0210113 3300046454 Bacteria 1307
345 Ga0495592_0405884 3300046454 Bacteria 862
346 Ga0495603_0169910 3300046455 Bacteria 1263
347 Ga0495629_0003387 3300046459 Bacteria 12054
348 Ga0495641_0000633 3300046461 Bacteria 29676
349 Ga0495641_0021983 3300046461 Bacteria 3199
350 Ga0495641_0101373 3300046461 Bacteria 1285
351 Ga0495641_0158818 3300046461 Unclassified 1011
352 Ga0495641_0493766 3300046461 Bacteria 558
353 Ga0495651_0012020 3300046462 Bacteria 6663
354 Ga0495651_0933407 3300046462 Bacteria 529
355 Ga0495653_0022263 3300046463 Bacteria 5129
356 Ga0495653_0103126 3300046463 Bacteria 2063
357 Ga0495653_0200444 3300046463 Bacteria 1355
358 Ga0495653_0402830 3300046463 Bacteria 869
359 Ga0495582_0000593 3300046473 Bacteria 19988
360 Ga0495605_0319266 3300046474 Bacteria 655
361 Ga0495639_0000351 3300046475 Bacteria 22247
362 Ga0495662_0004310 3300046476 Bacteria 7152
363 Ga0495664_0048707 3300046477 Bacteria 2516
364 Ga0495664_0159991 3300046477 Unclassified 1366
365 Ga0495594_0485641 3300046499 Bacteria 702
366 Ga0495608_0038693 3300046511 Bacteria 3201
367 Ga0495618_0060532 3300046514 Bacteria 2401
368 Ga0495628_0280397 3300046516 Bacteria 1238
369 Ga0495628_0561716 3300046516 Bacteria 818
370 Ga0495630_0004840 3300046517 Bacteria 9446
371 Ga0495630_0022949 3300046517 Bacteria 4610
372 Ga0495666_0025846 3300046526 Bacteria 2898
373 Ga0495652_0040935 3300046529 Bacteria 4002
374 Ga0495652_0623413 3300046529 Bacteria 733
375 Ga0495652_0861882 3300046529 Unclassified 600
376 Ga0495665_0001881 3300046531 Bacteria 11342
377 Ga0495640_0030091 3300046533 Bacteria 3891
378 Ga0495640_0043853 3300046533 Bacteria 3112
379 Ga0495640_0063623 3300046533 Bacteria 2498
380 Ga0495586_0192126 3300046535 Bacteria 1156
381 Ga0495587_0011724 3300046536 Bacteria 5547
382 Ga0495587_0133096 3300046536 Bacteria 1421
383 Ga0495587_0653578 3300046536 Bacteria 577
384 Ga0495645_0050375 3300046543 Bacteria 3032
385 Ga0495645_0153864 3300046543 Bacteria 1595
386 Ga0495645_0289184 3300046543 Bacteria 1075
387 Ga0495645_0447533 3300046543 Bacteria 815
388 Ga0495667_0008763 3300046559 Bacteria 6875
389 Ga0495635_0064835 3300046663 Bacteria 2507
390 Ga0495635_0086990 3300046663 Bacteria 2138
391 Ga0495657_0024924 3300046675 Bacteria 4251
392 Ga0495657_0026071 3300046675 Bacteria 4144
393 Ga0495657_0189289 3300046675 Unclassified 1259
394 Ga0495599_0047734 3300046678 Bacteria 2683
395 Ga0495646_0039558 3300046680 Bacteria 2907
396 Ga0495646_0446355 3300046680 Bacteria 668
397 Ga0495647_0006569 3300046681 Bacteria 3857
398 Ga0495658_0000218 3300046683 Bacteria 32890
399 Ga0495658_0067310 3300046683 Bacteria 2071
400 Ga0495613_0004067 3300046689 Bacteria 10938
401 Ga0495613_0033728 3300046689 Bacteria 3802
402 Ga0495613_0164673 3300046689 Bacteria 1576
403 Ga0495624_0007538 3300046690 Bacteria 7634
404 Ga0495624_0115561 3300046690 Bacteria 1649
405 Ga0495600_0049127 3300046809 Bacteria 2752
406 Ga0495600_0067020 3300046809 Bacteria 2346
407 Ga0495581_0001068 3300047315 Bacteria 14869
408 Ga0495604_0006669 3300047317 Bacteria 9150
409 Ga0495604_0022214 3300047317 Bacteria 5064
410 Ga0495674_0021113 3300047319 Bacteria 6025
411 Ga0495674_0290067 3300047319 Bacteria 1338
412 Ga0495676_0001243 3300047321 Bacteria 21860
413 Ga0495680_0011821 3300047322 Bacteria 7710
414 Ga0495680_0013740 3300047322 Bacteria 7047
415 Ga0495680_0026776 3300047322 Bacteria 4748
416 Ga0495680_0049561 3300047322 Bacteria 3289
417 Ga0495684_0036796 3300047471 Bacteria 3753
418 Ga0495684_0167417 3300047471 Bacteria 1636
419 Ga0495684_0323948 3300047471 Bacteria 1101
420 Ga0495593_0000941 3300047673 Bacteria 16968
421 Ga0495602_0118562 3300048088 Bacteria 2134
422 Ga0495602_0181118 3300048088 Unclassified 1625
423 Ga0495602_0782331 3300048088 Bacteria 642
424 Ga0495614_0074580 3300048089 Bacteria 1465
425 Ga0496100_0000294 3300048903 Bacteria 24866
426 Ga0496100_0014177 3300048903 Bacteria 4620
427 Ga0496100_0124813 3300048903 Bacteria 1805
428 Ga0496100_0179853 3300048903 Bacteria 1529
429 Ga0496100_0197734 3300048903 Bacteria 1463
430 Ga0496100_0799283 3300048903 Unclassified 739
431 Ga0496101_0001985 3300048904 Bacteria 12410
432 Ga0496101_0008135 3300048904 Bacteria 6844
433 Ga0496101_0060250 3300048904 Bacteria 2753
434 Ga0496102_0003757 3300048905 Bacteria 12836
435 Ga0496102_0045237 3300048905 Bacteria 3996
436 Ga0496102_0151564 3300048905 Bacteria 2179
437 Ga0496102_0848164 3300048905 Bacteria 836
438 Ga0496103_0308770 3300048906 Bacteria 1017
439 Ga0496104_0009257 3300048907 Bacteria 8759
440 Ga0496104_0063442 3300048907 Bacteria 3504
441 Ga0496104_0366989 3300048907 Bacteria 1352
442 Ga0496105_0001034 3300048908 Bacteria 19232
443 Ga0496105_0010552 3300048908 Bacteria 7267
444 Ga0496105_0113100 3300048908 Bacteria 2240
445 Ga0496106_0000725 3300048909 Bacteria 23756
446 Ga0496106_0004542 3300048909 Bacteria 10284
447 Ga0496106_0021434 3300048909 Bacteria 4798
448 Ga0496107_0002354 3300048910 Bacteria 12217
449 Ga0496107_0041079 3300048910 Bacteria 3321
450 Ga0496107_0220078 3300048910 Unclassified 1412
451 Ga0496107_0638131 3300048910 Bacteria 785
452 Ga0496108_0018198 3300048911 Bacteria 5751
453 Ga0496108_0461585 3300048911 Bacteria 1109
454 Ga0496109_0008773 3300048912 Bacteria 8608
455 Ga0496109_0458134 3300048912 Bacteria 1204
456 Ga0496110_0017465 3300048913 Bacteria 6002
457 Ga0496110_0133658 3300048913 Bacteria 2241
458 Ga0496110_0807721 3300048913 Bacteria 842
459 Ga0496111_0019200 3300048914 Bacteria 4744
460 Ga0496111_0057098 3300048914 Bacteria 2826
461 Ga0496111_0126384 3300048914 Unclassified 1890
462 Ga0496111_0590756 3300048914 Unclassified 813
463 Ga0496112_0001848 3300048915 Bacteria 16642
464 Ga0496112_0014336 3300048915 Bacteria 7346
465 Ga0496112_0017459 3300048915 Bacteria 6741
466 Ga0496112_0027536 3300048915 Bacteria 5480
467 Ga0496112_0207993 3300048915 Bacteria 1914
468 Ga0496112_0801757 3300048915 Bacteria 866
469 Ga0496112_0958023 3300048915 Unclassified 776
470 Ga0496112_0987059 3300048915 Bacteria 762
471 Ga0496113_0008653 3300048916 Bacteria 6640
472 Ga0496113_0017025 3300048916 Bacteria 5036
473 Ga0496113_0273194 3300048916 Bacteria 1351
474 Ga0496114_0000447 3300048917 Bacteria 30276
475 Ga0496114_0059771 3300048917 Bacteria 3184
476 Ga0496114_0782137 3300048917 Bacteria 833
477 Ga0496114_1237918 3300048917 Bacteria 633
478 Ga0496115_0002381 3300048918 Bacteria 13483
479 Ga0496115_0038020 3300048918 Bacteria 3818
480 Ga0496115_0041822 3300048918 Bacteria 3649
481 Ga0496115_0378527 3300048918 Bacteria 1151
482 Ga0501039_0188139 3300049575 Unclassified 1624
483 Ga0501046_0209581 3300049580 Bacteria 1447
484 Ga0501046_0424808 3300049580 Bacteria 958
485 Ga0501047_0033892 3300049581 Bacteria 4929
486 Ga0501047_0427100 3300049581 Bacteria 1156
487 Ga0501047_0513617 3300049581 Bacteria 1024
488 Ga0501067_0023426 3300049583 Bacteria 3421
489 Ga0501067_0207434 3300049583 Bacteria 1091
490 Ga0501069_0001543 3300049585 Bacteria 11384
491 Ga0501069_0218484 3300049585 Bacteria 1107
492 Ga0501069_0239692 3300049585 Bacteria 1057
493 Ga0501070_0002208 3300049586 Bacteria 17093
494 Ga0501070_0375440 3300049586 Bacteria 1152
495 Ga0501074_0102282 3300049590 Bacteria 2051
496 Ga0501074_0884520 3300049590 Unclassified 629
497 Ga0501075_0350496 3300049591 Bacteria 1125
498 Ga0501080_0032889 3300049742 Bacteria 4839
499 Ga0501080_0312337 3300049742 Bacteria 1424
500 Ga0501080_1182577 3300049742 Bacteria 658
501 Ga0501035_0158555 3300049822 Bacteria 1960
502 Ga0501035_0304461 3300049822 Bacteria 1342
503 Ga0501044_0934428 3300049823 Bacteria 741
504 Ga0501045_0459679 3300049824 Bacteria 946
505 nmdc:mga0n895_26009_c1 3300050512 Bacteria 5536
506 nmdc:mga0n895_844571_c1 3300050512 Unclassified 904
507 nmdc:mga0rr50_7613_c1 3300050513 Bacteria 6696
508 nmdc:mga08x19_180437_c1 3300050514 Bacteria 1441
509 nmdc:mga08x19_520921_c1 3300050514 Bacteria 840
510 nmdc:mga0a205_72064_c1 3300050515 Bacteria 3337
511 Ga0495601_0014157 3300053077 Bacteria 4805
512 Ga0495601_0106771 3300053077 Bacteria 1811
513 Ga0495655_0008182 3300053083 Bacteria 1976
514 Ga0495595_0064353 3300053084 Bacteria 1723
515 Ga0495595_0101787 3300053084 Unclassified 1387
516 Ga0495595_0143265 3300053084 Unclassified 1173
517 Ga0495619_0002938 3300053085 Bacteria 11077
518 Ga0495619_0012192 3300053085 Bacteria 5411
519 Ga0466962_0002596 3300061719 Bacteria 8581
520 Ga0466962_0014479 3300061719 Bacteria 3802
521 Ga0530510_0346429 3300061734 Bacteria 1116
522 Ga0466963_0048221
523 rootH1_10292968
524 Ga0070658_10071776
525 Ga0070658_10109472
526 Ga0070658_10124950
527 Ga0070658_10304636
528 Ga0070658_10580596
529 Ga0070658_11390298
530 Ga0070683_100044955
531 Ga0070683_100110336
532 Ga0070683_100444017
533 Ga0070683_100968074
534 Ga0070680_100135895
535 Ga0070680_100170778
536 Ga0070680_100196018
537 Ga0070680_100202225
538 Ga0070680_100433042
539 Ga0070682_100204048
540 Ga0070682_100205321
541 Ga0070682_100450471
542 Ga0070660_100000984
543 Ga0070660_100003072
544 Ga0070660_100200934
545 Ga0070660_100632815
546 Ga0070661_100018627
547 Ga0070661_100025172
548 Ga0070661_100140443
549 Ga0070661_101051707
550 Ga0070661_101383773
551 Ga0070671_100030132
552 Ga0070671_100300522
553 Ga0070674_100134782
554 Ga0070673_101725403
555 Ga0070659_100036698
556 Ga0070659_100267777
557 Ga0070659_100479742
558 Ga0070659_101852279
559 Ga0070709_10236343
560 Ga0070714_100126462
561 Ga0070714_100714110
562 Ga0070714_100898596
563 Ga0070714_102354563
564 Ga0070713_100184638
565 Ga0070711_100035801
566 Ga0070711_100085561
567 Ga0070711_100094144
568 Ga0070711_100217910
569 Ga0070663_100445763
570 Ga0070663_101618528
571 Ga0070678_100127182
572 Ga0070681_10027300
573 Ga0070681_10052495
574 Ga0070681_10060785
575 Ga0070681_10136672
576 Ga0070681_11906731
577 Ga0070706_100232044
578 Ga0070706_102056342
579 Ga0070707_100162991
580 Ga0070707_100454313
581 Ga0070698_100819855
582 Ga0070699_100516033
583 Ga0070679_100038964
584 Ga0070679_100161586
585 Ga0070679_100183435
586 Ga0070679_100194584
587 Ga0070679_100265153
588 Ga0070679_100452484
589 Ga0070679_101927993
590 Ga0070684_100133970
591 Ga0070684_100513152
592 Ga0070684_100672445
593 Ga0070684_101310683
594 Ga0068853_100080607
595 Ga0068853_100398598
596 Ga0068853_101190603
597 Ga0070696_100073312
598 Ga0070696_100267889
599 Ga0070665_100006267
600 Ga0068855_100038428
601 Ga0068855_100083165
602 Ga0068855_100129663
603 Ga0068855_100182824
604 Ga0068855_100343058
605 Ga0068855_100375978
606 Ga0070664_100412000
607 Ga0068857_100151392
608 Ga0068856_100082953
609 Ga0068856_100199967
610 Ga0068856_101430398
611 Ga0068852_100385059
612 Ga0068852_100943737
613 Ga0070715_10857495
614 Ga0070716_100693840
615 Ga0070712_100034010
616 Ga0070712_100389350
617 Ga0097621_100105033
618 Ga0097621_100433161
619 Ga0068871_100285407
620 Ga0075433_10549309
621 Ga0075434_100013677
622 Ga0075434_100373841
623 Ga0075435_100004708
624 Ga0075435_101455486
625 Ga0105240_10184412
626 Ga0105240_10233307
627 Ga0105240_10919546
628 Ga0105245_10024661
629 Ga0105243_10239752
630 Ga0105241_10613432
631 Ga0105241_10682185
632 Ga0105241_11664555
633 Ga0105241_11915669
634 Ga0105248_10395052
635 Ga0105237_10051886
636 Ga0105237_10399314
637 Ga0105237_11769648
638 Ga0105238_10036125
639 Ga0105238_10091271
640 Ga0105239_10093789
641 Ga0105239_11301305
642 Ga0157373_10036098
643 Ga0157371_10538129
644 Ga0157371_10626933
645 Ga0157370_10103812
646 Ga0157370_10255348
647 Ga0157370_10404787
648 Ga0157370_10406221
649 Ga0157369_10078044
650 Ga0157369_10103318
651 Ga0157369_10378061
652 Ga0157369_10493880
653 Ga0157369_11813542
654 Ga0157374_10474181
655 Ga0157374_10494395
656 Ga0157374_10543509
657 Ga0157378_10560519
658 Ga0157372_10075424
659 Ga0157372_10101705
660 Ga0157372_10408108
661 Ga0157372_10922575
662 Ga0157372_11871855
663 Ga0157375_10031575
664 Ga0157375_11651607
665 Ga0157376_10122094
666 Ga0197907_11168919
667 Ga0206356_10824180
668 Ga0206356_11505166
669 Ga0206354_10875370
670 Ga0206354_10959969
671 Ga0206353_10361018
672 Ga0206353_11188271
673 Ga0206353_11241608
674 Ga0213876_10440322
675 Ga0207692_10096616
676 Ga0207647_10170945
677 Ga0207685_10207848
678 Ga0207705_10010740
679 Ga0207705_10116303
680 Ga0207705_10517098
681 Ga0207705_10869010
682 Ga0207684_10363788
683 Ga0207654_10040492
684 Ga0207707_10038673
685 Ga0207707_10064418
686 Ga0207707_10127427
687 Ga0207707_10282733
688 Ga0207695_10523286
689 Ga0207695_10721834
690 Ga0207695_10889855
691 Ga0207671_10163475
692 Ga0207671_11367496
693 Ga0207693_10033769
694 Ga0207693_10126164
695 Ga0207663_10017655
696 Ga0207663_10040265
697 Ga0207663_10275996
698 Ga0207660_10061608
699 Ga0207660_10217866
700 Ga0207660_10626540
701 Ga0207660_10682973
702 Ga0207660_11368481
703 Ga0207657_10001116
704 Ga0207657_10001688
705 Ga0207657_10002091
706 Ga0207657_10033596
707 Ga0207657_10088832
708 Ga0207649_10038182
709 Ga0207649_10131369
710 Ga0207649_10707967
711 Ga0207652_10103705
712 Ga0207652_10384210
713 Ga0207652_10398240
714 Ga0207652_10453181
715 Ga0207652_10662697
716 Ga0207652_10812430
717 Ga0207646_10195486
718 Ga0207646_10234348
719 Ga0207646_10911309
720 Ga0207694_10076218
721 Ga0207687_10050996
722 Ga0207700_10128892
723 Ga0207700_10663819
724 Ga0207664_10195708
725 Ga0207664_10871841
726 Ga0207644_10041728
727 Ga0207644_10993597
728 Ga0207690_10027844
729 Ga0207690_10678221
730 Ga0207690_10773675
731 Ga0207709_10063287
732 Ga0207665_11478093
733 Ga0207661_10041610
734 Ga0207661_10223529
735 Ga0207661_10360498
736 Ga0207679_10238423
737 Ga0207679_11346888
738 Ga0207667_10136703
739 Ga0207667_10151851
740 Ga0207667_10268765
741 Ga0207667_10358952
742 Ga0207667_10796846
743 Ga0207640_10163253
744 Ga0207640_11925520
745 Ga0207639_10174636
746 Ga0207639_10181110
747 Ga0207639_10521594
748 Ga0207678_10434199
749 Ga0207678_10490590
750 Ga0207702_10044324
751 Ga0207702_11490721
752 Ga0207674_10005383
753 Ga0207674_10480200
754 Ga0207683_10182178
755 Ga0207698_10111341
756 Ga0207698_10186403
757 Ga0268266_10157046
758 Ga0265334_10084034
759 Ga0265322_10013088
760 Ga0265322_10014767
761 Ga0265338_10041239
762 Ga0265328_10218183
763 Ga0265340_10069006
764 Ga0265339_10281725
765 Ga0265331_10037099
766 Ga0265327_10113942
767 Ga0265327_10165318
768 Ga0265316_10043923
769 Ga0265316_10129976
770 Ga0265316_10333048
771 Ga0265314_10030085
772 Ga0265314_10231530
773 Ga0373926_0279742
774 Ga0373944_0000546
775 Ga0373923_0034633
776 Ga0373936_0077702
777 Ga0373945_0001992
778 Ga0373953_0082163
779 Ga0373954_0035967
780 Ga0373943_0161109
781 Ga0373946_0003881
782 Ga0373955_0325221
783 Ga0373935_0037892
784 Ga0373927_0046630
785 Ga0373933_0986223
786 Ga0373947_0003461
787 Ga0373937_0164894
788 Ga0373925_0002437
789 Ga0395899_0282984
790 Ga0395900_0243487
791 Ga0395900_0558762
792 Ga0395900_0936333
793 Ga0395898_0009120
794 Ga0395898_0147220
795 Ga0395898_0159006
796 Ga0436364_0197195
797 Ga0395901_0199366
798 Ga0395901_0348694
799 Ga0436365_0886660
800 Ga0439448_0206687
801 Ga0466969_0020610
802 Ga0466965_0043874
803 Ga0466966_0064461
804 Ga0466966_0070585
805 Ga0466966_0129382
806 Ga0466961_0003261
807 Ga0466961_0004978
808 Ga0466961_0070676
809 Ga0466963_0005929
810 Ga0466963_0014022
811 Ga0466963_0022115
812 Ga0466963_0025079
813 Ga0466963_0025670
814 Ga0466963_0126468
815 Ga0466963_0156188
816 Ga0466963_0328294
817 Ga0466963_0473234
818 Ga0466963_0502978
819 Ga0466963_0768003
820 Ga0466963_0828839
821 Ga0466964_0002699
822 Ga0466964_0027347
823 Ga0466964_0031295
824 Ga0466971_0004887
825 Ga0466971_0009151
826 Ga0466968_0042180
827 Ga0466968_0077623
828 Ga0466968_0106750
829 Ga0466968_0376331
830 Ga0466970_0131126
831 Ga0466970_0480204
832 Ga0466957_0000806
833 Ga0466957_0009673
834 Ga0466957_0026641
835 Ga0466957_0049029
836 Ga0466957_0555728
837 Ga0466960_0853466
838 Ga0466959_0022707
839 Ga0466959_0023901
840 Ga0466959_0048000
841 Ga0466959_0167664
842 Ga0466959_0347908
843 Ga0466959_0484999
844 Ga0466958_0004015
845 Ga0466958_0021540
846 Ga0466958_0033010
847 Ga0466958_0196388
848 Ga0466958_0682111
849 Ga0466958_1104734
850 Ga0466967_0001528
851 Ga0466967_0002124
852 Ga0466967_0005982
853 Ga0466967_0010806
854 Ga0466967_0012474
855 Ga0466967_0012764
856 Ga0466967_0023094
857 Ga0466967_0041414
858 Ga0466967_0048701
859 Ga0466967_0093171
860 Ga0466967_0200538
861 Ga0466967_0202212
862 Ga0466967_0252031
863 Ga0466967_0426715
864 Ga0466967_0703477
865 Ga0495592_0210113
866 Ga0495592_0405884
867 Ga0495603_0169910
868 Ga0495629_0003387
869 Ga0495641_0000633
870 Ga0495641_0021983
871 Ga0495641_0101373
872 Ga0495641_0158818
873 Ga0495641_0493766
874 Ga0495651_0012020
875 Ga0495651_0933407
876 Ga0495653_0022263
877 Ga0495653_0103126
878 Ga0495653_0200444
879 Ga0495653_0402830
880 Ga0495582_0000593
881 Ga0495605_0319266
882 Ga0495639_0000351
883 Ga0495662_0004310
884 Ga0495664_0048707
885 Ga0495664_0159991
886 Ga0495594_0485641
887 Ga0495608_0038693
888 Ga0495618_0060532
889 Ga0495628_0280397
890 Ga0495628_0561716
891 Ga0495630_0004840
892 Ga0495630_0022949
893 Ga0495666_0025846
894 Ga0495652_0040935
895 Ga0495652_0623413
896 Ga0495652_0861882
897 Ga0495665_0001881
898 Ga0495640_0030091
899 Ga0495640_0043853
900 Ga0495640_0063623
901 Ga0495586_0192126
902 Ga0495587_0011724
903 Ga0495587_0133096
904 Ga0495587_0653578
905 Ga0495645_0050375
906 Ga0495645_0153864
907 Ga0495645_0289184
908 Ga0495645_0447533
909 Ga0495667_0008763
910 Ga0495635_0064835
911 Ga0495635_0086990
912 Ga0495657_0024924
913 Ga0495657_0026071
914 Ga0495657_0189289
915 Ga0495599_0047734
916 Ga0495646_0039558
917 Ga0495646_0446355
918 Ga0495647_0006569
919 Ga0495658_0000218
920 Ga0495658_0067310
921 Ga0495613_0004067
922 Ga0495613_0033728
923 Ga0495613_0164673
924 Ga0495624_0007538
925 Ga0495624_0115561
926 Ga0495600_0049127
927 Ga0495600_0067020
928 Ga0495581_0001068
929 Ga0495604_0006669
930 Ga0495604_0022214
931 Ga0495674_0021113
932 Ga0495674_0290067
933 Ga0495676_0001243
934 Ga0495680_0011821
935 Ga0495680_0013740
936 Ga0495680_0026776
937 Ga0495680_0049561
938 Ga0495684_0036796
939 Ga0495684_0167417
940 Ga0495684_0323948
941 Ga0495593_0000941
942 Ga0495602_0118562
943 Ga0495602_0181118
944 Ga0495602_0782331
945 Ga0495614_0074580
946 Ga0496100_0000294
947 Ga0496100_0014177
948 Ga0496100_0124813
949 Ga0496100_0179853
950 Ga0496100_0197734
951 Ga0496100_0799283
952 Ga0496101_0001985
953 Ga0496101_0008135
954 Ga0496101_0060250
955 Ga0496102_0003757
956 Ga0496102_0045237
957 Ga0496102_0151564
958 Ga0496102_0848164
959 Ga0496103_0308770
960 Ga0496104_0009257
961 Ga0496104_0063442
962 Ga0496104_0366989
963 Ga0496105_0001034
964 Ga0496105_0010552
965 Ga0496105_0113100
966 Ga0496106_0000725
967 Ga0496106_0004542
968 Ga0496106_0021434
969 Ga0496107_0002354
970 Ga0496107_0041079
971 Ga0496107_0220078
972 Ga0496107_0638131
973 Ga0496108_0018198
974 Ga0496108_0461585
975 Ga0496109_0008773
976 Ga0496109_0458134
977 Ga0496110_0017465
978 Ga0496110_0133658
979 Ga0496110_0807721
980 Ga0496111_0019200
981 Ga0496111_0057098
982 Ga0496111_0126384
983 Ga0496111_0590756
984 Ga0496112_0001848
985 Ga0496112_0014336
986 Ga0496112_0017459
987 Ga0496112_0027536
988 Ga0496112_0207993
989 Ga0496112_0801757
990 Ga0496112_0958023
991 Ga0496112_0987059
992 Ga0496113_0008653
993 Ga0496113_0017025
994 Ga0496113_0273194
995 Ga0496114_0000447
996 Ga0496114_0059771
997 Ga0496114_0782137
998 Ga0496114_1237918
999 Ga0496115_0002381
1000 Ga0496115_0038020
1001 Ga0496115_0041822
1002 Ga0496115_0378527
1003 Ga0501039_0188139
1004 Ga0501046_0209581
1005 Ga0501046_0424808
1006 Ga0501047_0033892
1007 Ga0501047_0427100
1008 Ga0501047_0513617
1009 Ga0501067_0023426
1010 Ga0501067_0207434
1011 Ga0501069_0001543
1012 Ga0501069_0218484
1013 Ga0501069_0239692
1014 Ga0501070_0002208
1015 Ga0501070_0375440
1016 Ga0501074_0102282
1017 Ga0501074_0884520
1018 Ga0501075_0350496
1019 Ga0501080_0032889
1020 Ga0501080_0312337
1021 Ga0501080_1182577
1022 Ga0501035_0158555
1023 Ga0501035_0304461
1024 Ga0501044_0934428
1025 Ga0501045_0459679
1026 nmdc:mga0n895_26009_c1
1027 nmdc:mga0n895_844571_c1
1028 nmdc:mga0rr50_7613_c1
1029 nmdc:mga08x19_180437_c1
1030 nmdc:mga08x19_520921_c1
1031 nmdc:mga0a205_72064_c1
1032 Ga0495601_0014157
1033 Ga0495601_0106771
1034 Ga0495655_0008182
1035 Ga0495595_0064353
1036 Ga0495595_0101787
1037 Ga0495595_0143265
1038 Ga0495619_0002938
1039 Ga0495619_0012192
1040 Ga0466962_0002596
1041 Ga0466962_0014479
1042 Ga0530510_0346429

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

136

0.96

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

149

0.93

PF13468

Glyoxalase_3

Glyoxalase-like domain

25

152

0.83

PF18029

Glyoxalase_6

Glyoxalase-like domain

30

141

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.9686 3 134
6xbv-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa 0.9678 3 134
6xbr-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43l) in complex with 2-nitronate-propionyl-coa 0.9677 3 134
6wf7-assembly1.cif.gz_A methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ 0.9675 3 134
6xbt-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (q60a) in complex with 2-nitronate-propionyl-coa 0.9673 3 134
ID Description Score Start End Superfamily
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.95 7 135 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9446 1 135 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9379 1 135 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9159 7 135 3.10.180.10
6qh4A00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8921 6 133 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A538EAF4-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9973 3 133 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9C1Z3-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9955 8 133 GO:0004493
GO:0046491
GO:0046872
AF-A0A7W0S5D7-F1-model_v4 VOC family protein 0.9954 3 76
AF-A0A538GB40-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9851 1 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A7W1H355-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9846 2 135 GO:0004493
GO:0046491
GO:0046872

Map