F458653

General Info

Members Datasets Scaffolds Average Seq Length
521 180 1042 241

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100017789|Ga0070680_1000177895
Length 261
Sequence MNQVNSQNNNGGQFKRRATDRPEGKTRVAAVGDLHVHEHSQNLYRDFFANVSLQADVLLLCGDLTNLGLAKEAENLAKDLSAASIPVLGVLGNHDFHSNQADQIKKILADAGLHFLDEETFELGEVGFAGVKGFGGGFEAFMLGAFGEPVLKNFVGEGIEEALKLENALKTLAGKKHLVIATHYSPIAATVAGEPPEIFPFLGCSRLAETIDRFNNVRAVFHGHAHHGSTQGKTLKGVPVFNCALELLNRSEGKKYASLEI

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
143 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
144 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
166 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
167 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
168 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
169 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
170 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
171 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
172 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
173 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
176 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
177 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
178 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
179 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
180 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.58
Nodule 0
Rhizoplane 1.54
Rhizosphere 97.5
Stem 0
Stem Tuber 0
Unclassified 2.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100017789 3300005336 Bacteria 5607
2 JGI24736J21556_1001695 3300001904 Bacteria 3985
3 JGI24740J21852_10003822 3300001979 Bacteria 6546
4 JGI24739J22299_10002585 3300001989 Bacteria 6974
5 JGI24737J22298_10000516 3300001990 Bacteria 13557
6 JGI24737J22298_10006978 3300001990 Bacteria 3829
7 JGI24737J22298_10022460 3300001990 Bacteria 2006
8 JGI24737J22298_10055251 3300001990 Bacteria 1200
9 JGI24743J22301_10002675 3300001991 Bacteria 2723
10 JGI24735J21928_10002444 3300002067 Bacteria 6451
11 JGI24738J21930_10007375 3300002075 Bacteria 2540
12 Ga0065712_10023045 3300005290 Bacteria 1929
13 Ga0070658_10048110 3300005327 Bacteria 3451
14 Ga0070658_10070035 3300005327 Bacteria 2870
15 Ga0070658_10070314 3300005327 Bacteria 2865
16 Ga0070658_10104148 3300005327 Bacteria 2347
17 Ga0070658_10148807 3300005327 Bacteria 1959
18 Ga0070658_10164017 3300005327 Bacteria 1865
19 Ga0070658_10229253 3300005327 Bacteria 1572
20 Ga0070658_10359425 3300005327 Bacteria 1247
21 Ga0070676_10014057 3300005328 Bacteria 4392
22 Ga0070676_10058544 3300005328 Bacteria 2284
23 Ga0070683_100004543 3300005329 Bacteria 11454
24 Ga0070683_100027461 3300005329 Bacteria 5133
25 Ga0070670_100034596 3300005331 Bacteria 4348
26 Ga0070670_100041100 3300005331 Bacteria 3974
27 Ga0070670_100261186 3300005331 Bacteria 1510
28 Ga0070670_100372645 3300005331 Bacteria 1257
29 Ga0070677_10060177 3300005333 Bacteria 1564
30 Ga0070677_10075256 3300005333 Bacteria 1431
31 Ga0068869_100118271 3300005334 Bacteria 2024
32 Ga0068869_100175360 3300005334 Bacteria 1677
33 Ga0068869_100209113 3300005334 Bacteria 1542
34 Ga0070666_10004398 3300005335 Bacteria 8582
35 Ga0070666_10008463 3300005335 Bacteria 6391
36 Ga0070666_10039195 3300005335 Bacteria 3157
37 Ga0070680_100002832 3300005336 Bacteria 12894
38 Ga0070680_100024105 3300005336 Bacteria 4855
39 Ga0070680_100059815 3300005336 Bacteria 3118
40 Ga0070680_100074876 3300005336 Bacteria 2786
41 Ga0070680_100075588 3300005336 Bacteria 2772
42 Ga0070680_100090935 3300005336 Bacteria 2526
43 Ga0070680_100206129 3300005336 Bacteria 1658
44 Ga0070680_100254743 3300005336 Bacteria 1484
45 Ga0070682_100013108 3300005337 Bacteria 4761
46 Ga0070682_100335725 3300005337 Bacteria 1122
47 Ga0070682_100550705 3300005337 Bacteria 903
48 Ga0068868_100417698 3300005338 Bacteria 1161
49 Ga0070660_100008979 3300005339 Bacteria 7011
50 Ga0070660_100052492 3300005339 Bacteria 3143
51 Ga0070660_100083997 3300005339 Bacteria 2503
52 Ga0070660_100137342 3300005339 Bacteria 1959
53 Ga0070691_10011843 3300005341 Bacteria 3990
54 Ga0070691_10150598 3300005341 Bacteria 1192
55 Ga0070661_100043362 3300005344 Bacteria 3286
56 Ga0070661_100279598 3300005344 Bacteria 1294
57 Ga0070661_100299334 3300005344 Bacteria 1252
58 Ga0070692_10005219 3300005345 Bacteria 5507
59 Ga0070668_100001722 3300005347 Bacteria 15896
60 Ga0070668_100042105 3300005347 Bacteria 3500
61 Ga0070669_100061797 3300005353 Bacteria 2753
62 Ga0070675_100585456 3300005354 Bacteria 1011
63 Ga0070671_100000356 3300005355 Bacteria 31426
64 Ga0070671_100021653 3300005355 Bacteria 5251
65 Ga0070671_100077299 3300005355 Unclassified 2781
66 Ga0070671_100101439 3300005355 Bacteria 2414
67 Ga0070671_100212376 3300005355 Bacteria 1641
68 Ga0070671_100272876 3300005355 Bacteria 1438
69 Ga0070674_100026908 3300005356 Bacteria 3764
70 Ga0070674_100050415 3300005356 Bacteria 2866
71 Ga0070673_100034152 3300005364 Bacteria 3845
72 Ga0070673_100049665 3300005364 Bacteria 3276
73 Ga0070673_100110353 3300005364 Bacteria 2280
74 Ga0070673_100672477 3300005364 Bacteria 949
75 Ga0070659_100006176 3300005366 Bacteria 8652
76 Ga0070659_100006604 3300005366 Bacteria 8378
77 Ga0070659_100048048 3300005366 Bacteria 3350
78 Ga0070659_100057373 3300005366 Bacteria 3071
79 Ga0070659_100205224 3300005366 Bacteria 1623
80 Ga0070667_100007755 3300005367 Bacteria 8901
81 Ga0070667_100632870 3300005367 Bacteria 987
82 Ga0070694_100006035 3300005444 Bacteria 7352
83 Ga0070663_100117736 3300005455 Bacteria 2003
84 Ga0070663_100705631 3300005455 Bacteria 858
85 Ga0070678_100045272 3300005456 Bacteria 3147
86 Ga0070662_100000934 3300005457 Bacteria 17887
87 Ga0070662_100020026 3300005457 Bacteria 4553
88 Ga0070662_100023086 3300005457 Bacteria 4269
89 Ga0070662_100040673 3300005457 Bacteria 3311
90 Ga0070662_100375244 3300005457 Bacteria 1170
91 Ga0070662_100518520 3300005457 Bacteria 996
92 Ga0070681_10022967 3300005458 Bacteria 6268
93 Ga0070681_10052690 3300005458 Bacteria 4059
94 Ga0070681_10104457 3300005458 Bacteria 2776
95 Ga0070681_10179446 3300005458 Unclassified 2039
96 Ga0068867_100022390 3300005459 Bacteria 4518
97 Ga0070679_100019119 3300005530 Bacteria 6656
98 Ga0070679_100128418 3300005530 Bacteria 2516
99 Ga0070679_100324543 3300005530 Bacteria 1488
100 Ga0070679_100328547 3300005530 Bacteria 1478
101 Ga0070684_100018778 3300005535 Bacteria 5704
102 Ga0070684_100088490 3300005535 Bacteria 2751
103 Ga0070684_100122832 3300005535 Bacteria 2337
104 Ga0070684_100773049 3300005535 Unclassified 897
105 Ga0068853_100013566 3300005539 Bacteria 6659
106 Ga0068853_100113277 3300005539 Bacteria 2411
107 Ga0068853_100154977 3300005539 Bacteria 2064
108 Ga0068853_100239319 3300005539 Bacteria 1663
109 Ga0068853_100356800 3300005539 Bacteria 1361
110 Ga0070672_100003756 3300005543 Bacteria 9884
111 Ga0070672_100047604 3300005543 Bacteria 3328
112 Ga0070672_100212366 3300005543 Bacteria 1621
113 Ga0070672_100231958 3300005543 Bacteria 1551
114 Ga0070686_100518856 3300005544 Bacteria 927
115 Ga0070665_100000785 3300005548 Bacteria 41798
116 Ga0070665_100039319 3300005548 Bacteria 4756
117 Ga0070665_100066920 3300005548 Bacteria 3604
118 Ga0070665_100112733 3300005548 Bacteria 2722
119 Ga0070665_100244592 3300005548 Bacteria 1794
120 Ga0068855_100109945 3300005563 Bacteria 3164
121 Ga0068855_100146633 3300005563 Bacteria 2686
122 Ga0068855_100489067 3300005563 Bacteria 1338
123 Ga0068855_100635711 3300005563 Bacteria 1148
124 Ga0070664_100008409 3300005564 Bacteria 8344
125 Ga0070664_100010296 3300005564 Bacteria 7589
126 Ga0070664_100016335 3300005564 Bacteria 6085
127 Ga0070664_100054916 3300005564 Bacteria 3381
128 Ga0070664_100096360 3300005564 Bacteria 2567
129 Ga0070664_100124299 3300005564 Bacteria 2262
130 Ga0070664_100166721 3300005564 Bacteria 1952
131 Ga0070664_100267608 3300005564 Bacteria 1539
132 Ga0068857_100002586 3300005577 Bacteria 14838
133 Ga0068857_100003808 3300005577 Bacteria 12698
134 Ga0068857_100020457 3300005577 Bacteria 5821
135 Ga0068857_100093683 3300005577 Bacteria 2690
136 Ga0068857_100117208 3300005577 Bacteria 2396
137 Ga0068854_100008007 3300005578 Bacteria 6772
138 Ga0068854_100011702 3300005578 Bacteria 5722
139 Ga0068854_100034443 3300005578 Bacteria 3537
140 Ga0068854_100054803 3300005578 Bacteria 2869
141 Ga0068854_100363801 3300005578 Bacteria 1187
142 Ga0068854_100396647 3300005578 Bacteria 1141
143 Ga0068856_100006069 3300005614 Bacteria 11869
144 Ga0068856_100054644 3300005614 Bacteria 3940
145 Ga0068856_100160212 3300005614 Bacteria 2260
146 Ga0068856_100201105 3300005614 Bacteria 2007
147 Ga0068852_100000359 3300005616 Bacteria 30741
148 Ga0068852_100040441 3300005616 Bacteria 3933
149 Ga0068852_100084370 3300005616 Bacteria 2827
150 Ga0068852_100156205 3300005616 Bacteria 2125
151 Ga0068852_100192206 3300005616 Bacteria 1926
152 Ga0068852_100289806 3300005616 Bacteria 1581
153 Ga0068852_100337247 3300005616 Bacteria 1468
154 Ga0068859_100054346 3300005617 Bacteria 4027
155 Ga0068859_100151788 3300005617 Bacteria 2392
156 Ga0068859_100449002 3300005617 Bacteria 1385
157 Ga0068851_10157935 3300005834 Bacteria 1244
158 Ga0068863_100007285 3300005841 Bacteria 10834
159 Ga0068863_100009332 3300005841 Bacteria 9573
160 Ga0068863_100467244 3300005841 Bacteria 1239
161 Ga0068858_100016229 3300005842 Bacteria 6997
162 Ga0068858_100149307 3300005842 Bacteria 2196
163 Ga0068860_100010706 3300005843 Bacteria 9059
164 Ga0068860_100056437 3300005843 Bacteria 3733
165 Ga0068862_100011729 3300005844 Bacteria 7234
166 Ga0068862_100070566 3300005844 Bacteria 3016
167 Ga0075369_10076445 3300006186 Bacteria 1480
168 Ga0075366_10309701 3300006195 Bacteria 966
169 Ga0068871_100022169 3300006358 Bacteria 4896
170 Ga0068865_100205528 3300006881 Bacteria 1531
171 Ga0097620_100054352 3300006931 Bacteria 4027
172 Ga0097620_100151795 3300006931 Bacteria 2392
173 Ga0097620_100448967 3300006931 Bacteria 1385
174 Ga0105240_10016809 3300009093 Bacteria 9894
175 Ga0105240_10025845 3300009093 Bacteria 7709
176 Ga0105240_10145811 3300009093 Bacteria 2825
177 Ga0105245_10244946 3300009098 Bacteria 1739
178 Ga0105245_10320585 3300009098 Bacteria 1526
179 Ga0105247_10091365 3300009101 Bacteria 1933
180 Ga0105243_10359722 3300009148 Bacteria 1339
181 Ga0105248_10057325 3300009177 Bacteria 4372
182 Ga0105248_10098737 3300009177 Bacteria 3290
183 Ga0105248_10329054 3300009177 Bacteria 1721
184 Ga0105248_10956230 3300009177 Bacteria 967
185 Ga0105237_10042154 3300009545 Bacteria 4604
186 Ga0105238_10119960 3300009551 Bacteria 2610
187 Ga0105249_10017784 3300009553 Bacteria 6316
188 Ga0105249_10259941 3300009553 Bacteria 1725
189 Ga0105239_10148946 3300010375 Bacteria 2611
190 Ga0105246_10297822 3300011119 Bacteria 1301
191 Ga0157373_10111595 3300013100 Bacteria 1922
192 Ga0157373_10130426 3300013100 Bacteria 1768
193 Ga0157373_10158733 3300013100 Bacteria 1591
194 Ga0157373_10175940 3300013100 Bacteria 1506
195 Ga0157373_10653687 3300013100 Unclassified 768
196 Ga0157371_10030105 3300013102 Bacteria 3917
197 Ga0157371_10032822 3300013102 Bacteria 3734
198 Ga0157371_10036023 3300013102 Bacteria 3544
199 Ga0157371_10065405 3300013102 Bacteria 2575
200 Ga0157371_10093240 3300013102 Bacteria 2134
201 Ga0157371_10153300 3300013102 Bacteria 1644
202 Ga0157371_10254692 3300013102 Bacteria 1264
203 Ga0157370_10038763 3300013104 Bacteria 4609
204 Ga0157370_10127084 3300013104 Bacteria 2379
205 Ga0157370_10205614 3300013104 Unclassified 1826
206 Ga0157369_10028677 3300013105 Bacteria 6157
207 Ga0157369_10047399 3300013105 Bacteria 4666
208 Ga0157369_10102017 3300013105 Bacteria 3058
209 Ga0157369_10143971 3300013105 Bacteria 2520
210 Ga0157378_10302723 3300013297 Bacteria 1548
211 Ga0163162_10053327 3300013306 Bacteria 4064
212 Ga0163162_10477624 3300013306 Bacteria 1378
213 Ga0157372_10194114 3300013307 Bacteria 2352
214 Ga0157372_10710188 3300013307 Bacteria 1170
215 Ga0157372_10779485 3300013307 Bacteria 1111
216 Ga0163163_10010877 3300014325 Bacteria 8219
217 Ga0163161_10074917 3300017792 Bacteria 2483
218 Ga0163161_10381566 3300017792 Bacteria 1127
219 Ga0213875_10028062 3300021388 Bacteria 2676
220 Ga0207656_10134578 3300025321 Unclassified 1160
221 Ga0207682_10038974 3300025893 Bacteria 1930
222 Ga0207682_10075448 3300025893 Bacteria 1435
223 Ga0207682_10116080 3300025893 Bacteria 1183
224 Ga0207680_10043513 3300025903 Bacteria 2634
225 Ga0207680_10254010 3300025903 Bacteria 1215
226 Ga0207647_10000236 3300025904 Bacteria 45200
227 Ga0207647_10010505 3300025904 Bacteria 6538
228 Ga0207647_10013156 3300025904 Bacteria 5749
229 Ga0207645_10003729 3300025907 Bacteria 11460
230 Ga0207645_10029230 3300025907 Bacteria 3554
231 Ga0207643_10269707 3300025908 Bacteria 1053
232 Ga0207705_10000997 3300025909 Bacteria 23105
233 Ga0207705_10008082 3300025909 Bacteria 7710
234 Ga0207705_10084562 3300025909 Bacteria 2316
235 Ga0207705_10149170 3300025909 Bacteria 1751
236 Ga0207705_10203595 3300025909 Bacteria 1500
237 Ga0207705_10444321 3300025909 Unclassified 1005
238 Ga0207707_10202193 3300025912 Bacteria 1732
239 Ga0207707_10306646 3300025912 Bacteria 1372
240 Ga0207707_10365738 3300025912 Bacteria 1241
241 Ga0207695_10003088 3300025913 Bacteria 23842
242 Ga0207695_10111188 3300025913 Bacteria 2719
243 Ga0207695_10269307 3300025913 Bacteria 1599
244 Ga0207671_10360882 3300025914 Bacteria 1153
245 Ga0207660_10000036 3300025917 Bacteria 65280
246 Ga0207660_10006681 3300025917 Bacteria 7477
247 Ga0207660_10036958 3300025917 Bacteria 3399
248 Ga0207660_10087988 3300025917 Bacteria 2296
249 Ga0207660_10090826 3300025917 Bacteria 2263
250 Ga0207660_10259534 3300025917 Bacteria 1374
251 Ga0207657_10003350 3300025919 Bacteria 17139
252 Ga0207657_10003711 3300025919 Bacteria 16232
253 Ga0207657_10005535 3300025919 Bacteria 13186
254 Ga0207657_10018082 3300025919 Bacteria 6744
255 Ga0207657_10060767 3300025919 Bacteria 3242
256 Ga0207657_10063241 3300025919 Bacteria 3165
257 Ga0207657_10187584 3300025919 Bacteria 1669
258 Ga0207657_10430597 3300025919 Bacteria 1036
259 Ga0207649_10021479 3300025920 Bacteria 3717
260 Ga0207649_10077305 3300025920 Bacteria 2144
261 Ga0207649_10218770 3300025920 Bacteria 1355
262 Ga0207652_10013954 3300025921 Bacteria 6505
263 Ga0207652_10037013 3300025921 Bacteria 4128
264 Ga0207652_10038778 3300025921 Bacteria 4040
265 Ga0207652_10505217 3300025921 Bacteria 1088
266 Ga0207681_10003196 3300025923 Bacteria 10277
267 Ga0207681_10154312 3300025923 Bacteria 1724
268 Ga0207694_10033382 3300025924 Bacteria 3942
269 Ga0207650_10087558 3300025925 Bacteria 2373
270 Ga0207650_10106413 3300025925 Bacteria 2166
271 Ga0207650_10183373 3300025925 Bacteria 1669
272 Ga0207650_10195740 3300025925 Bacteria 1617
273 Ga0207650_10222784 3300025925 Bacteria 1519
274 Ga0207659_10496154 3300025926 Bacteria 1033
275 Ga0207659_10638448 3300025926 Bacteria 909
276 Ga0207664_10379932 3300025929 Bacteria 1254
277 Ga0207644_10001168 3300025931 Bacteria 16836
278 Ga0207644_10037035 3300025931 Bacteria 3429
279 Ga0207644_10039438 3300025931 Bacteria 3334
280 Ga0207644_10321890 3300025931 Bacteria 1250
281 Ga0207690_10004787 3300025932 Bacteria 7983
282 Ga0207690_10011588 3300025932 Bacteria 5267
283 Ga0207690_10095791 3300025932 Bacteria 2109
284 Ga0207690_10096700 3300025932 Bacteria 2100
285 Ga0207690_10104610 3300025932 Bacteria 2028
286 Ga0207690_10178647 3300025932 Bacteria 1596
287 Ga0207690_10555268 3300025932 Bacteria 934
288 Ga0207706_10000576 3300025933 Bacteria 39094
289 Ga0207706_10004800 3300025933 Bacteria 12661
290 Ga0207706_10012835 3300025933 Bacteria 7627
291 Ga0207706_10022092 3300025933 Bacteria 5710
292 Ga0207706_10037745 3300025933 Bacteria 4288
293 Ga0207706_10227103 3300025933 Bacteria 1634
294 Ga0207706_10340579 3300025933 Bacteria 1304
295 Ga0207709_10121501 3300025935 Bacteria 1764
296 Ga0207704_10003598 3300025938 Bacteria 7035
297 Ga0207691_10031650 3300025940 Bacteria 4936
298 Ga0207691_10032745 3300025940 Bacteria 4845
299 Ga0207691_10058988 3300025940 Bacteria 3490
300 Ga0207691_10222577 3300025940 Bacteria 1636
301 Ga0207711_10171051 3300025941 Bacteria 1971
302 Ga0207711_10295845 3300025941 Bacteria 1492
303 Ga0207711_10360685 3300025941 Bacteria 1346
304 Ga0207689_10020415 3300025942 Bacteria 5575
305 Ga0207661_10010292 3300025944 Bacteria 6726
306 Ga0207661_10315391 3300025944 Bacteria 1404
307 Ga0207661_10438505 3300025944 Bacteria 1188
308 Ga0207679_10029114 3300025945 Bacteria 3842
309 Ga0207679_10054075 3300025945 Bacteria 2954
310 Ga0207679_10114175 3300025945 Bacteria 2138
311 Ga0207679_10330031 3300025945 Bacteria 1323
312 Ga0207667_10015220 3300025949 Bacteria 8747
313 Ga0207667_10027825 3300025949 Bacteria 6148
314 Ga0207667_10074252 3300025949 Bacteria 3533
315 Ga0207667_10256165 3300025949 Bacteria 1790
316 Ga0207667_10402196 3300025949 Bacteria 1394
317 Ga0207667_10409979 3300025949 Bacteria 1379
318 Ga0207667_10441462 3300025949 Bacteria 1323
319 Ga0207651_10014205 3300025960 Bacteria 4590
320 Ga0207651_10041482 3300025960 Bacteria 3055
321 Ga0207651_10146987 3300025960 Bacteria 1829
322 Ga0207712_10000146 3300025961 Bacteria 73378
323 Ga0207668_10000070 3300025972 Bacteria 78666
324 Ga0207668_10554454 3300025972 Bacteria 996
325 Ga0207640_10000668 3300025981 Bacteria 20054
326 Ga0207640_10031181 3300025981 Bacteria 3291
327 Ga0207640_10109286 3300025981 Bacteria 1956
328 Ga0207640_10333066 3300025981 Bacteria 1213
329 Ga0207658_10015323 3300025986 Bacteria 5259
330 Ga0207658_10250246 3300025986 Bacteria 1505
331 Ga0207658_10504372 3300025986 Bacteria 1078
332 Ga0207658_10505522 3300025986 Bacteria 1077
333 Ga0207677_10208173 3300026023 Bacteria 1560
334 Ga0207677_10208409 3300026023 Unclassified 1559
335 Ga0207703_10127662 3300026035 Bacteria 2192
336 Ga0207639_10112574 3300026041 Bacteria 2221
337 Ga0207639_10228852 3300026041 Bacteria 1610
338 Ga0207639_10253221 3300026041 Bacteria 1536
339 Ga0207639_10471903 3300026041 Bacteria 1142
340 Ga0207678_10003447 3300026067 Bacteria 14247
341 Ga0207678_10007192 3300026067 Bacteria 9868
342 Ga0207678_10098530 3300026067 Bacteria 2497
343 Ga0207678_10141227 3300026067 Bacteria 2055
344 Ga0207678_10149660 3300026067 Bacteria 1993
345 Ga0207702_10005497 3300026078 Bacteria 11083
346 Ga0207702_10063402 3300026078 Bacteria 3160
347 Ga0207702_10467850 3300026078 Bacteria 1225
348 Ga0207641_10058434 3300026088 Bacteria 3282
349 Ga0207648_10020744 3300026089 Bacteria 5915
350 Ga0207648_10500789 3300026089 Bacteria 1111
351 Ga0207676_10683545 3300026095 Bacteria 993
352 Ga0207674_10000308 3300026116 Bacteria 62120
353 Ga0207674_10000588 3300026116 Bacteria 47795
354 Ga0207674_10005528 3300026116 Bacteria 15004
355 Ga0207674_10013160 3300026116 Bacteria 9207
356 Ga0207674_10456337 3300026116 Bacteria 1235
357 Ga0207683_10038904 3300026121 Bacteria 4148
358 Ga0207698_10000810 3300026142 Bacteria 18164
359 Ga0207698_10007179 3300026142 Bacteria 6977
360 Ga0207698_10013352 3300026142 Bacteria 5416
361 Ga0207698_10139657 3300026142 Bacteria 2085
362 Ga0207698_10156242 3300026142 Bacteria 1988
363 Ga0207698_10870440 3300026142 Bacteria 907
364 Ga0268266_10000315 3300028379 Bacteria 76532
365 Ga0268266_10026841 3300028379 Bacteria 4900
366 Ga0268266_10046453 3300028379 Bacteria 3717
367 Ga0268266_10145361 3300028379 Bacteria 2131
368 Ga0268265_10091866 3300028380 Bacteria 2428
369 Ga0268265_10144348 3300028380 Bacteria 1997
370 Ga0268264_10000594 3300028381 Bacteria 43886
371 Ga0268264_10029964 3300028381 Bacteria 4461
372 Ga0307413_10348321 3300031824 Bacteria 1142
373 Ga0307410_10049410 3300031852 Bacteria 2823
374 Ga0307410_10264613 3300031852 Bacteria 1342
375 Ga0307407_10084962 3300031903 Bacteria 1924
376 Ga0307407_10429015 3300031903 Bacteria 954
377 Ga0307409_100159027 3300031995 Bacteria 1973
378 Ga0307409_100172265 3300031995 Bacteria 1906
379 Ga0307409_100304777 3300031995 Bacteria 1484
380 Ga0307409_100308057 3300031995 Bacteria 1476
381 Ga0307416_100151308 3300032002 Bacteria 2128
382 Ga0307416_100998776 3300032002 Bacteria 940
383 Ga0307411_10173060 3300032005 Bacteria 1630
384 Ga0307411_10322190 3300032005 Unclassified 1248
385 Ga0307415_100065278 3300032126 Bacteria 2536
386 Ga0307415_100201831 3300032126 Bacteria 1578
387 Ga0395899_0029587 3300037312 Bacteria 4120
388 Ga0395899_0057076 3300037312 Bacteria 2883
389 Ga0395899_0068290 3300037312 Bacteria 2606
390 Ga0395899_0071324 3300037312 Bacteria 2542
391 Ga0395899_0076577 3300037312 Bacteria 2441
392 Ga0395899_0148915 3300037312 Bacteria 1660
393 Ga0395899_0294899 3300037312 Bacteria 1099
394 Ga0395899_0351790 3300037312 Bacteria 985
395 Ga0395900_0013457 3300037418 Bacteria 8359
396 Ga0395900_0019940 3300037418 Bacteria 6835
397 Ga0395900_0028782 3300037418 Bacteria 5695
398 Ga0395900_0037639 3300037418 Bacteria 4987
399 Ga0395900_0058568 3300037418 Bacteria 3965
400 Ga0395900_0078956 3300037418 Bacteria 3381
401 Ga0395900_0080310 3300037418 Bacteria 3351
402 Ga0395900_0089711 3300037418 Bacteria 3160
403 Ga0395900_0104330 3300037418 Bacteria 2912
404 Ga0395900_0126484 3300037418 Bacteria 2621
405 Ga0395900_0132756 3300037418 Bacteria 2551
406 Ga0395900_0134902 3300037418 Bacteria 2528
407 Ga0395900_0147433 3300037418 Bacteria 2406
408 Ga0395900_0147586 3300037418 Bacteria 2404
409 Ga0395900_0149301 3300037418 Bacteria 2388
410 Ga0395900_0160545 3300037418 Bacteria 2293
411 Ga0395900_0168866 3300037418 Bacteria 2228
412 Ga0395900_0212965 3300037418 Bacteria 1950
413 Ga0395900_0525604 3300037418 Bacteria 1130
414 Ga0395898_0015669 3300037466 Bacteria 7768
415 Ga0395898_0026494 3300037466 Bacteria 5832
416 Ga0395898_0044139 3300037466 Bacteria 4391
417 Ga0395898_0048249 3300037466 Bacteria 4177
418 Ga0395898_0081641 3300037466 Bacteria 3116
419 Ga0395898_0104476 3300037466 Bacteria 2717
420 Ga0395898_0110182 3300037466 Bacteria 2639
421 Ga0395898_0163858 3300037466 Bacteria 2127
422 Ga0395898_0457946 3300037466 Bacteria 1214
423 Ga0395898_0730987 3300037466 Unclassified 931
424 Ga0395898_0771160 3300037466 Bacteria 902
425 Ga0395905_0000092 3300037471 Bacteria 149300
426 Ga0395905_0003297 3300037471 Bacteria 17333
427 Ga0395905_0005797 3300037471 Bacteria 12548
428 Ga0395905_0009472 3300037471 Bacteria 9516
429 Ga0395905_0020293 3300037471 Bacteria 6295
430 Ga0395905_0023269 3300037471 Bacteria 5857
431 Ga0395905_0023834 3300037471 Bacteria 5778
432 Ga0395905_0024934 3300037471 Bacteria 5642
433 Ga0395905_0026754 3300037471 Bacteria 5440
434 Ga0395905_0032730 3300037471 Bacteria 4887
435 Ga0395905_0081148 3300037471 Bacteria 3039
436 Ga0395905_0107856 3300037471 Bacteria 2614
437 Ga0395905_0128484 3300037471 Bacteria 2383
438 Ga0395905_0159589 3300037471 Bacteria 2120
439 Ga0395905_0164975 3300037471 Bacteria 2081
440 Ga0395905_0204608 3300037471 Bacteria 1850
441 Ga0395905_0234135 3300037471 Bacteria 1717
442 Ga0395905_0260118 3300037471 Bacteria 1620
443 Ga0395905_0402614 3300037471 Bacteria 1263
444 Ga0395905_0492634 3300037471 Bacteria 1125
445 Ga0395905_0628520 3300037471 Bacteria 976
446 Ga0395905_0833716 3300037471 Bacteria 825
447 Ga0436364_0965911 3300037853 Bacteria 1633
448 Ga0395901_0007482 3300038443 Bacteria 11028
449 Ga0395901_0032200 3300038443 Bacteria 5411
450 Ga0395901_0037682 3300038443 Bacteria 5000
451 Ga0395901_0039031 3300038443 Bacteria 4912
452 Ga0395901_0056367 3300038443 Bacteria 4087
453 Ga0395901_0068260 3300038443 Bacteria 3704
454 Ga0395901_0077345 3300038443 Bacteria 3473
455 Ga0395901_0125782 3300038443 Bacteria 2694
456 Ga0395901_0130719 3300038443 Bacteria 2638
457 Ga0395901_0195304 3300038443 Bacteria 2122
458 Ga0395901_0305253 3300038443 Bacteria 1649
459 Ga0395901_0419999 3300038443 Bacteria 1371
460 Ga0395901_0557530 3300038443 Bacteria 1161
461 Ga0395901_0796860 3300038443 Bacteria 934
462 Ga0439445_0004503 3300042004 Bacteria 3157
463 Ga0439432_010282 3300042006 Unclassified 3246
464 Ga0439449_0057483 3300042007 Bacteria 1436
465 Ga0466969_0009319 3300044656 Bacteria 5204
466 Ga0466969_0009620 3300044656 Bacteria 5123
467 Ga0466966_0005560 3300044684 Bacteria 8284
468 Ga0466966_0101876 3300044684 Bacteria 1775
469 Ga0466961_0031913 3300044693 Bacteria 3385
470 Ga0466963_0006530 3300044694 Bacteria 6907
471 Ga0466963_0107834 3300044694 Bacteria 1910
472 Ga0466963_0116278 3300044694 Bacteria 1838
473 Ga0466963_0172000 3300044694 Bacteria 1510
474 Ga0466963_0362281 3300044694 Bacteria 1021
475 Ga0466971_0007854 3300044719 Bacteria 4646
476 Ga0466971_0030999 3300044719 Bacteria 2394
477 Ga0466970_0094904 3300044765 Unclassified 1621
478 Ga0466957_0002271 3300044842 Bacteria 10298
479 Ga0466957_0012693 3300044842 Bacteria 4881
480 Ga0466957_0118534 3300044842 Bacteria 1686
481 Ga0466959_0012141 3300045049 Bacteria 6215
482 Ga0466959_0084310 3300045049 Bacteria 2287
483 Ga0466959_0135985 3300045049 Bacteria 1740
484 Ga0466958_0000227 3300045836 Bacteria 21319
485 Ga0466958_0007060 3300045836 Bacteria 6147
486 Ga0466958_0085474 3300045836 Bacteria 1946
487 Ga0466967_0005250 3300045976 Bacteria 8928
488 Ga0466967_0011212 3300045976 Bacteria 6775
489 Ga0466967_0035204 3300045976 Bacteria 4259
490 Ga0466967_0216753 3300045976 Bacteria 1817
491 Ga0466967_0543027 3300045976 Bacteria 1144
492 Ga0495642_0195739 3300046528 Bacteria 881
493 Ga0495669_0059984 3300046684 Bacteria 1719
494 Ga0495669_0433422 3300046684 Bacteria 638
495 Ga0496100_0174928 3300048903 Bacteria 1549
496 Ga0496101_0128237 3300048904 Bacteria 1924
497 Ga0496106_0220447 3300048909 Bacteria 1513
498 Ga0496107_0106193 3300048910 Bacteria 2062
499 Ga0496109_0089604 3300048912 Bacteria 2844
500 Ga0496111_0081904 3300048914 Bacteria 2356
501 Ga0496114_0178383 3300048917 Bacteria 1854
502 Ga0496115_0000775 3300048918 Bacteria 23430
503 Ga0501067_0134812 3300049583 Bacteria 1375
504 Ga0501209_014279 3300049656 Bacteria 1741
505 Ga0501216_003999 3300049660 Bacteria 2171
506 Ga0501223_017476 3300049663 Bacteria 1415
507 Ga0501227_017842 3300049665 Bacteria 1606
508 Ga0501233_067381 3300049668 Unclassified 901
509 Ga0501249_006034 3300049679 Bacteria 2487
510 Ga0501249_028397 3300049679 Bacteria 1240
511 Ga0501258_007301 3300049687 Bacteria 1114
512 Ga0501221_004956 3300049704 Bacteria 2217
513 Ga0501225_0018043 3300049705 Bacteria 1958
514 Ga0501268_003853 3300049765 Bacteria 2081
515 Ga0501268_012758 3300049765 Bacteria 1348
516 Ga0501272_003228 3300049769 Bacteria 1649
517 Ga0501273_003061 3300049770 Bacteria 1747
518 Ga0501204_007611 3300049850 Bacteria 1221
519 nmdc:mga0sz30_40541_c1 3300050516 Bacteria 1957
520 Ga0466962_0003849 3300061719 Bacteria 7171
521 Ga0466962_0169684 3300061719 Bacteria 1062
522 Ga0070680_100017789
523 JGI24736J21556_1001695
524 JGI24740J21852_10003822
525 JGI24739J22299_10002585
526 JGI24737J22298_10000516
527 JGI24737J22298_10006978
528 JGI24737J22298_10022460
529 JGI24737J22298_10055251
530 JGI24743J22301_10002675
531 JGI24735J21928_10002444
532 JGI24738J21930_10007375
533 Ga0065712_10023045
534 Ga0070658_10048110
535 Ga0070658_10070035
536 Ga0070658_10070314
537 Ga0070658_10104148
538 Ga0070658_10148807
539 Ga0070658_10164017
540 Ga0070658_10229253
541 Ga0070658_10359425
542 Ga0070676_10014057
543 Ga0070676_10058544
544 Ga0070683_100004543
545 Ga0070683_100027461
546 Ga0070670_100034596
547 Ga0070670_100041100
548 Ga0070670_100261186
549 Ga0070670_100372645
550 Ga0070677_10060177
551 Ga0070677_10075256
552 Ga0068869_100118271
553 Ga0068869_100175360
554 Ga0068869_100209113
555 Ga0070666_10004398
556 Ga0070666_10008463
557 Ga0070666_10039195
558 Ga0070680_100002832
559 Ga0070680_100024105
560 Ga0070680_100059815
561 Ga0070680_100074876
562 Ga0070680_100075588
563 Ga0070680_100090935
564 Ga0070680_100206129
565 Ga0070680_100254743
566 Ga0070682_100013108
567 Ga0070682_100335725
568 Ga0070682_100550705
569 Ga0068868_100417698
570 Ga0070660_100008979
571 Ga0070660_100052492
572 Ga0070660_100083997
573 Ga0070660_100137342
574 Ga0070691_10011843
575 Ga0070691_10150598
576 Ga0070661_100043362
577 Ga0070661_100279598
578 Ga0070661_100299334
579 Ga0070692_10005219
580 Ga0070668_100001722
581 Ga0070668_100042105
582 Ga0070669_100061797
583 Ga0070675_100585456
584 Ga0070671_100000356
585 Ga0070671_100021653
586 Ga0070671_100077299
587 Ga0070671_100101439
588 Ga0070671_100212376
589 Ga0070671_100272876
590 Ga0070674_100026908
591 Ga0070674_100050415
592 Ga0070673_100034152
593 Ga0070673_100049665
594 Ga0070673_100110353
595 Ga0070673_100672477
596 Ga0070659_100006176
597 Ga0070659_100006604
598 Ga0070659_100048048
599 Ga0070659_100057373
600 Ga0070659_100205224
601 Ga0070667_100007755
602 Ga0070667_100632870
603 Ga0070694_100006035
604 Ga0070663_100117736
605 Ga0070663_100705631
606 Ga0070678_100045272
607 Ga0070662_100000934
608 Ga0070662_100020026
609 Ga0070662_100023086
610 Ga0070662_100040673
611 Ga0070662_100375244
612 Ga0070662_100518520
613 Ga0070681_10022967
614 Ga0070681_10052690
615 Ga0070681_10104457
616 Ga0070681_10179446
617 Ga0068867_100022390
618 Ga0070679_100019119
619 Ga0070679_100128418
620 Ga0070679_100324543
621 Ga0070679_100328547
622 Ga0070684_100018778
623 Ga0070684_100088490
624 Ga0070684_100122832
625 Ga0070684_100773049
626 Ga0068853_100013566
627 Ga0068853_100113277
628 Ga0068853_100154977
629 Ga0068853_100239319
630 Ga0068853_100356800
631 Ga0070672_100003756
632 Ga0070672_100047604
633 Ga0070672_100212366
634 Ga0070672_100231958
635 Ga0070686_100518856
636 Ga0070665_100000785
637 Ga0070665_100039319
638 Ga0070665_100066920
639 Ga0070665_100112733
640 Ga0070665_100244592
641 Ga0068855_100109945
642 Ga0068855_100146633
643 Ga0068855_100489067
644 Ga0068855_100635711
645 Ga0070664_100008409
646 Ga0070664_100010296
647 Ga0070664_100016335
648 Ga0070664_100054916
649 Ga0070664_100096360
650 Ga0070664_100124299
651 Ga0070664_100166721
652 Ga0070664_100267608
653 Ga0068857_100002586
654 Ga0068857_100003808
655 Ga0068857_100020457
656 Ga0068857_100093683
657 Ga0068857_100117208
658 Ga0068854_100008007
659 Ga0068854_100011702
660 Ga0068854_100034443
661 Ga0068854_100054803
662 Ga0068854_100363801
663 Ga0068854_100396647
664 Ga0068856_100006069
665 Ga0068856_100054644
666 Ga0068856_100160212
667 Ga0068856_100201105
668 Ga0068852_100000359
669 Ga0068852_100040441
670 Ga0068852_100084370
671 Ga0068852_100156205
672 Ga0068852_100192206
673 Ga0068852_100289806
674 Ga0068852_100337247
675 Ga0068859_100054346
676 Ga0068859_100151788
677 Ga0068859_100449002
678 Ga0068851_10157935
679 Ga0068863_100007285
680 Ga0068863_100009332
681 Ga0068863_100467244
682 Ga0068858_100016229
683 Ga0068858_100149307
684 Ga0068860_100010706
685 Ga0068860_100056437
686 Ga0068862_100011729
687 Ga0068862_100070566
688 Ga0075369_10076445
689 Ga0075366_10309701
690 Ga0068871_100022169
691 Ga0068865_100205528
692 Ga0097620_100054352
693 Ga0097620_100151795
694 Ga0097620_100448967
695 Ga0105240_10016809
696 Ga0105240_10025845
697 Ga0105240_10145811
698 Ga0105245_10244946
699 Ga0105245_10320585
700 Ga0105247_10091365
701 Ga0105243_10359722
702 Ga0105248_10057325
703 Ga0105248_10098737
704 Ga0105248_10329054
705 Ga0105248_10956230
706 Ga0105237_10042154
707 Ga0105238_10119960
708 Ga0105249_10017784
709 Ga0105249_10259941
710 Ga0105239_10148946
711 Ga0105246_10297822
712 Ga0157373_10111595
713 Ga0157373_10130426
714 Ga0157373_10158733
715 Ga0157373_10175940
716 Ga0157373_10653687
717 Ga0157371_10030105
718 Ga0157371_10032822
719 Ga0157371_10036023
720 Ga0157371_10065405
721 Ga0157371_10093240
722 Ga0157371_10153300
723 Ga0157371_10254692
724 Ga0157370_10038763
725 Ga0157370_10127084
726 Ga0157370_10205614
727 Ga0157369_10028677
728 Ga0157369_10047399
729 Ga0157369_10102017
730 Ga0157369_10143971
731 Ga0157378_10302723
732 Ga0163162_10053327
733 Ga0163162_10477624
734 Ga0157372_10194114
735 Ga0157372_10710188
736 Ga0157372_10779485
737 Ga0163163_10010877
738 Ga0163161_10074917
739 Ga0163161_10381566
740 Ga0213875_10028062
741 Ga0207656_10134578
742 Ga0207682_10038974
743 Ga0207682_10075448
744 Ga0207682_10116080
745 Ga0207680_10043513
746 Ga0207680_10254010
747 Ga0207647_10000236
748 Ga0207647_10010505
749 Ga0207647_10013156
750 Ga0207645_10003729
751 Ga0207645_10029230
752 Ga0207643_10269707
753 Ga0207705_10000997
754 Ga0207705_10008082
755 Ga0207705_10084562
756 Ga0207705_10149170
757 Ga0207705_10203595
758 Ga0207705_10444321
759 Ga0207707_10202193
760 Ga0207707_10306646
761 Ga0207707_10365738
762 Ga0207695_10003088
763 Ga0207695_10111188
764 Ga0207695_10269307
765 Ga0207671_10360882
766 Ga0207660_10000036
767 Ga0207660_10006681
768 Ga0207660_10036958
769 Ga0207660_10087988
770 Ga0207660_10090826
771 Ga0207660_10259534
772 Ga0207657_10003350
773 Ga0207657_10003711
774 Ga0207657_10005535
775 Ga0207657_10018082
776 Ga0207657_10060767
777 Ga0207657_10063241
778 Ga0207657_10187584
779 Ga0207657_10430597
780 Ga0207649_10021479
781 Ga0207649_10077305
782 Ga0207649_10218770
783 Ga0207652_10013954
784 Ga0207652_10037013
785 Ga0207652_10038778
786 Ga0207652_10505217
787 Ga0207681_10003196
788 Ga0207681_10154312
789 Ga0207694_10033382
790 Ga0207650_10087558
791 Ga0207650_10106413
792 Ga0207650_10183373
793 Ga0207650_10195740
794 Ga0207650_10222784
795 Ga0207659_10496154
796 Ga0207659_10638448
797 Ga0207664_10379932
798 Ga0207644_10001168
799 Ga0207644_10037035
800 Ga0207644_10039438
801 Ga0207644_10321890
802 Ga0207690_10004787
803 Ga0207690_10011588
804 Ga0207690_10095791
805 Ga0207690_10096700
806 Ga0207690_10104610
807 Ga0207690_10178647
808 Ga0207690_10555268
809 Ga0207706_10000576
810 Ga0207706_10004800
811 Ga0207706_10012835
812 Ga0207706_10022092
813 Ga0207706_10037745
814 Ga0207706_10227103
815 Ga0207706_10340579
816 Ga0207709_10121501
817 Ga0207704_10003598
818 Ga0207691_10031650
819 Ga0207691_10032745
820 Ga0207691_10058988
821 Ga0207691_10222577
822 Ga0207711_10171051
823 Ga0207711_10295845
824 Ga0207711_10360685
825 Ga0207689_10020415
826 Ga0207661_10010292
827 Ga0207661_10315391
828 Ga0207661_10438505
829 Ga0207679_10029114
830 Ga0207679_10054075
831 Ga0207679_10114175
832 Ga0207679_10330031
833 Ga0207667_10015220
834 Ga0207667_10027825
835 Ga0207667_10074252
836 Ga0207667_10256165
837 Ga0207667_10402196
838 Ga0207667_10409979
839 Ga0207667_10441462
840 Ga0207651_10014205
841 Ga0207651_10041482
842 Ga0207651_10146987
843 Ga0207712_10000146
844 Ga0207668_10000070
845 Ga0207668_10554454
846 Ga0207640_10000668
847 Ga0207640_10031181
848 Ga0207640_10109286
849 Ga0207640_10333066
850 Ga0207658_10015323
851 Ga0207658_10250246
852 Ga0207658_10504372
853 Ga0207658_10505522
854 Ga0207677_10208173
855 Ga0207677_10208409
856 Ga0207703_10127662
857 Ga0207639_10112574
858 Ga0207639_10228852
859 Ga0207639_10253221
860 Ga0207639_10471903
861 Ga0207678_10003447
862 Ga0207678_10007192
863 Ga0207678_10098530
864 Ga0207678_10141227
865 Ga0207678_10149660
866 Ga0207702_10005497
867 Ga0207702_10063402
868 Ga0207702_10467850
869 Ga0207641_10058434
870 Ga0207648_10020744
871 Ga0207648_10500789
872 Ga0207676_10683545
873 Ga0207674_10000308
874 Ga0207674_10000588
875 Ga0207674_10005528
876 Ga0207674_10013160
877 Ga0207674_10456337
878 Ga0207683_10038904
879 Ga0207698_10000810
880 Ga0207698_10007179
881 Ga0207698_10013352
882 Ga0207698_10139657
883 Ga0207698_10156242
884 Ga0207698_10870440
885 Ga0268266_10000315
886 Ga0268266_10026841
887 Ga0268266_10046453
888 Ga0268266_10145361
889 Ga0268265_10091866
890 Ga0268265_10144348
891 Ga0268264_10000594
892 Ga0268264_10029964
893 Ga0307413_10348321
894 Ga0307410_10049410
895 Ga0307410_10264613
896 Ga0307407_10084962
897 Ga0307407_10429015
898 Ga0307409_100159027
899 Ga0307409_100172265
900 Ga0307409_100304777
901 Ga0307409_100308057
902 Ga0307416_100151308
903 Ga0307416_100998776
904 Ga0307411_10173060
905 Ga0307411_10322190
906 Ga0307415_100065278
907 Ga0307415_100201831
908 Ga0395899_0029587
909 Ga0395899_0057076
910 Ga0395899_0068290
911 Ga0395899_0071324
912 Ga0395899_0076577
913 Ga0395899_0148915
914 Ga0395899_0294899
915 Ga0395899_0351790
916 Ga0395900_0013457
917 Ga0395900_0019940
918 Ga0395900_0028782
919 Ga0395900_0037639
920 Ga0395900_0058568
921 Ga0395900_0078956
922 Ga0395900_0080310
923 Ga0395900_0089711
924 Ga0395900_0104330
925 Ga0395900_0126484
926 Ga0395900_0132756
927 Ga0395900_0134902
928 Ga0395900_0147433
929 Ga0395900_0147586
930 Ga0395900_0149301
931 Ga0395900_0160545
932 Ga0395900_0168866
933 Ga0395900_0212965
934 Ga0395900_0525604
935 Ga0395898_0015669
936 Ga0395898_0026494
937 Ga0395898_0044139
938 Ga0395898_0048249
939 Ga0395898_0081641
940 Ga0395898_0104476
941 Ga0395898_0110182
942 Ga0395898_0163858
943 Ga0395898_0457946
944 Ga0395898_0730987
945 Ga0395898_0771160
946 Ga0395905_0000092
947 Ga0395905_0003297
948 Ga0395905_0005797
949 Ga0395905_0009472
950 Ga0395905_0020293
951 Ga0395905_0023269
952 Ga0395905_0023834
953 Ga0395905_0024934
954 Ga0395905_0026754
955 Ga0395905_0032730
956 Ga0395905_0081148
957 Ga0395905_0107856
958 Ga0395905_0128484
959 Ga0395905_0159589
960 Ga0395905_0164975
961 Ga0395905_0204608
962 Ga0395905_0234135
963 Ga0395905_0260118
964 Ga0395905_0402614
965 Ga0395905_0492634
966 Ga0395905_0628520
967 Ga0395905_0833716
968 Ga0436364_0965911
969 Ga0395901_0007482
970 Ga0395901_0032200
971 Ga0395901_0037682
972 Ga0395901_0039031
973 Ga0395901_0056367
974 Ga0395901_0068260
975 Ga0395901_0077345
976 Ga0395901_0125782
977 Ga0395901_0130719
978 Ga0395901_0195304
979 Ga0395901_0305253
980 Ga0395901_0419999
981 Ga0395901_0557530
982 Ga0395901_0796860
983 Ga0439445_0004503
984 Ga0439432_010282
985 Ga0439449_0057483
986 Ga0466969_0009319
987 Ga0466969_0009620
988 Ga0466966_0005560
989 Ga0466966_0101876
990 Ga0466961_0031913
991 Ga0466963_0006530
992 Ga0466963_0107834
993 Ga0466963_0116278
994 Ga0466963_0172000
995 Ga0466963_0362281
996 Ga0466971_0007854
997 Ga0466971_0030999
998 Ga0466970_0094904
999 Ga0466957_0002271
1000 Ga0466957_0012693
1001 Ga0466957_0118534
1002 Ga0466959_0012141
1003 Ga0466959_0084310
1004 Ga0466959_0135985
1005 Ga0466958_0000227
1006 Ga0466958_0007060
1007 Ga0466958_0085474
1008 Ga0466967_0005250
1009 Ga0466967_0011212
1010 Ga0466967_0035204
1011 Ga0466967_0216753
1012 Ga0466967_0543027
1013 Ga0495642_0195739
1014 Ga0495669_0059984
1015 Ga0495669_0433422
1016 Ga0496100_0174928
1017 Ga0496101_0128237
1018 Ga0496106_0220447
1019 Ga0496107_0106193
1020 Ga0496109_0089604
1021 Ga0496111_0081904
1022 Ga0496114_0178383
1023 Ga0496115_0000775
1024 Ga0501067_0134812
1025 Ga0501209_014279
1026 Ga0501216_003999
1027 Ga0501223_017476
1028 Ga0501227_017842
1029 Ga0501233_067381
1030 Ga0501249_006034
1031 Ga0501249_028397
1032 Ga0501258_007301
1033 Ga0501221_004956
1034 Ga0501225_0018043
1035 Ga0501268_003853
1036 Ga0501268_012758
1037 Ga0501272_003228
1038 Ga0501273_003061
1039 Ga0501204_007611
1040 nmdc:mga0sz30_40541_c1
1041 Ga0466962_0003849
1042 Ga0466962_0169684

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

26

243

0.81

PF00149

Metallophos

Calcineurin-like phosphoesterase

26

228

0.58

Structural Annotation

Top 5 Hits

ID Description Score Start End
6unc-assembly2.cif.gz_B the crystal structure of phosphopantetheinyl hydrolase (ppth) from mycobacterium tuberculosis 0.7121 3 233
6unc-assembly2.cif.gz_B the crystal structure of phosphopantetheinyl hydrolase (ppth) from mycobacterium tuberculosis 0.699 3 233
2dxl-assembly1.cif.gz_A glycerophosphodiesterase from enterobacter aerogenes 0.6648 1 218
3rl3-assembly1.cif.gz_A rat metallophosphodiesterase mpped2 0.6647 2 235
3rl4-assembly1.cif.gz_A rat metallophosphodiesterase mpped2 g252h mutant 0.6606 2 235
ID Description Score Start End Superfamily
af_Q22704_214_405_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7511 1 200 3.60.21.10
af_Q2FVI2_1_263_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7432 1 223 3.60.21.10
af_P0AEW4_8_273_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.731 1 218 3.60.21.10
af_Q08BG1_205_402_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.727 3 200 3.60.21.10
2yv1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Succinyl-CoA synthetase domains 0.7099 19 90 3.40.50.261
ID Description Score Start End GO Terms
AF-A0A7W0CXV0-F1-model_v4 Metallophosphoesterase family protein 0.9671 1 235 GO:0008758
GO:0009245
GO:0016020
AF-A0A8B3NB59-F1-model_v4 Metallophosphoesterase 0.9671 1 83 GO:0016787
AF-A0A538NL83-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9631 1 106 GO:0016787
AF-A0A2P7QUG2-F1-model_v4 Metallophosphoesterase 0.9608 2 235 GO:0008758
GO:0009245
GO:0016020
AF-A0A4Q3HLX1-F1-model_v4 Metallophosphoesterase 0.9604 6 91 GO:0008758
GO:0009245
GO:0016020

Map