F458622

General Info

Members Datasets Scaffolds Average Seq Length
520 329 1040 164

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154155|2515853823
Length 184
Sequence GLFGPYGELRHANPLDLGRTDRVSLYDIPLHTLTGKPGTLGDLAGKTLLVVNVASKCGLTPQYTGLERLQERYADQGFSVVGFPCNQFGGQEPGTAEEIQEFCSTTYGVTFPMFEKIEVNGPGRHPIYTELTATPDADGEAGDIQWNFEKFLIASDGTVINRFRPRTEPEDAAVVAAIEANLPA

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
74 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
81 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
90 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
91 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
101 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
155 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
162 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
163 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
164 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
165 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
166 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
167 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
168 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
176 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
179 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
180 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
181 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
182 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
183 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
196 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
197 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
198 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
202 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
203 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
204 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
216 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
220 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
226 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
227 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
230 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
234 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
235 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
236 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
237 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
238 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
253 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
254 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
255 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
256 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
266 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
267 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
268 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
269 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
270 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
273 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
274 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
275 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
276 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
277 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
278 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
279 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
280 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
281 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
282 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
283 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
284 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
285 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
286 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
304 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
307 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
308 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
309 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
310 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
313 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
314 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
315 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
316 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
317 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
318 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
319 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
320 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
321 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
322 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
323 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
324 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
325 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
326 2922554459 Rhodococcus sp. 66b Isolate Unclassified
327 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
328 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
329 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 1.54
Isolates 3.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.69
Nodule 0
Rhizoplane 5.77
Rhizosphere 85.19
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1032784 3300001978 Bacteria 598
2 JGI24740J21852_10099037 3300001979 Bacteria 743
3 JGI24743J22301_10044772 3300001991 Bacteria 893
4 JGI24745J21846_1042702 3300002073 Bacteria 564
5 JGI24744J21845_10035094 3300002077 Bacteria 950
6 rootH2_10059946 3300003320 Bacteria 3835
7 Ga0070658_10185495 3300005327 Bacteria 1752
8 Ga0070676_10178240 3300005328 Bacteria 1380
9 Ga0070683_100010691 3300005329 Bacteria 7891
10 Ga0070690_100157638 3300005330 Bacteria 1553
11 Ga0068869_100273727 3300005334 Bacteria 1355
12 Ga0070666_10009723 3300005335 Bacteria 6008
13 Ga0070680_100075244 3300005336 Bacteria 2779
14 Ga0070682_100078446 3300005337 Bacteria 2130
15 Ga0068868_100139057 3300005338 Bacteria 1992
16 Ga0070660_100087569 3300005339 Bacteria 2451
17 Ga0070691_10025510 3300005341 Bacteria 2752
18 Ga0070661_100160380 3300005344 Bacteria 1703
19 Ga0070661_100236388 3300005344 Bacteria 1405
20 Ga0070668_100559205 3300005347 Bacteria 997
21 Ga0070675_100040688 3300005354 Bacteria 3795
22 Ga0070674_100129431 3300005356 Bacteria 1880
23 Ga0070673_100108404 3300005364 Bacteria 2299
24 Ga0070659_100150807 3300005366 Bacteria 1896
25 Ga0070667_100226641 3300005367 Bacteria 1665
26 Ga0070667_100502473 3300005367 Bacteria 1111
27 Ga0070714_100038216 3300005435 Bacteria 4036
28 Ga0070714_101156748 3300005435 Bacteria 754
29 Ga0070714_101228460 3300005435 Bacteria 731
30 Ga0070713_100062171 3300005436 Bacteria 3127
31 Ga0070713_100186538 3300005436 Bacteria 1867
32 Ga0070713_100218132 3300005436 Bacteria 1730
33 Ga0070710_10185113 3300005437 Bacteria 1306
34 Ga0070710_10243312 3300005437 Bacteria 1153
35 Ga0070710_10294223 3300005437 Bacteria 1058
36 Ga0070701_10003907 3300005438 Bacteria 5951
37 Ga0070711_100036343 3300005439 Bacteria 3300
38 Ga0070705_100019573 3300005440 Bacteria 3564
39 Ga0070700_100092717 3300005441 Bacteria 1974
40 Ga0070708_100294645 3300005445 Bacteria 1528
41 Ga0070708_100297924 3300005445 Bacteria 1518
42 Ga0070708_100624575 3300005445 Bacteria 1016
43 Ga0070663_100004385 3300005455 Bacteria 8285
44 Ga0070663_100088531 3300005455 Bacteria 2289
45 Ga0070663_100351212 3300005455 Bacteria 1194
46 Ga0070663_101041467 3300005455 Bacteria 713
47 Ga0070678_100354498 3300005456 Bacteria 1262
48 Ga0070662_100168674 3300005457 Bacteria 1717
49 Ga0070681_10147646 3300005458 Bacteria 2279
50 Ga0070681_11224222 3300005458 Bacteria 673
51 Ga0070685_10147211 3300005466 Bacteria 1489
52 Ga0070685_10790194 3300005466 Bacteria 699
53 Ga0070706_100010288 3300005467 Bacteria 8691
54 Ga0070706_100140518 3300005467 Bacteria 2254
55 Ga0070706_100486944 3300005467 Bacteria 1148
56 Ga0070707_100310916 3300005468 Bacteria 1531
57 Ga0070707_100398903 3300005468 Bacteria 1335
58 Ga0070698_100015097 3300005471 Bacteria 8165
59 Ga0070698_100033811 3300005471 Bacteria 5296
60 Ga0070698_100298504 3300005471 Bacteria 1542
61 Ga0070699_100125465 3300005518 Bacteria 2259
62 Ga0070679_100014169 3300005530 Bacteria 7650
63 Ga0070684_100055569 3300005535 Bacteria 3452
64 Ga0070684_100331080 3300005535 Bacteria 1399
65 Ga0068853_100123332 3300005539 Bacteria 2314
66 Ga0070672_100039666 3300005543 Bacteria 3608
67 Ga0070686_100018252 3300005544 Bacteria 4113
68 Ga0070695_100042959 3300005545 Bacteria 2872
69 Ga0070696_100032530 3300005546 Bacteria 3578
70 Ga0070693_100128722 3300005547 Bacteria 1579
71 Ga0070665_100021205 3300005548 Bacteria 6532
72 Ga0070665_100111257 3300005548 Bacteria 2741
73 Ga0070665_100826008 3300005548 Bacteria 940
74 Ga0070664_100004731 3300005564 Bacteria 10915
75 Ga0070664_100511166 3300005564 Bacteria 1108
76 Ga0068857_100049915 3300005577 Bacteria 3712
77 Ga0068857_100551503 3300005577 Bacteria 1086
78 Ga0068854_100123257 3300005578 Bacteria 1970
79 Ga0068856_100193149 3300005614 Bacteria 2049
80 Ga0068856_101152774 3300005614 Bacteria 792
81 Ga0068852_100057339 3300005616 Bacteria 3370
82 Ga0068852_100468324 3300005616 Bacteria 1250
83 Ga0068852_100758872 3300005616 Bacteria 982
84 Ga0068864_100205279 3300005618 Bacteria 1812
85 Ga0068864_100333654 3300005618 Bacteria 1427
86 Ga0068866_10090570 3300005718 Bacteria 1664
87 Ga0068861_100252515 3300005719 Bacteria 1505
88 Ga0068861_100702197 3300005719 Bacteria 940
89 Ga0068851_10094111 3300005834 Bacteria 1582
90 Ga0068870_10022978 3300005840 Bacteria 3070
91 Ga0068863_100222610 3300005841 Bacteria 1818
92 Ga0068863_100299162 3300005841 Bacteria 1561
93 Ga0068858_100340492 3300005842 Bacteria 1435
94 Ga0068860_100158977 3300005843 Bacteria 2178
95 Ga0068860_100218742 3300005843 Bacteria 1849
96 Ga0068862_100296463 3300005844 Bacteria 1486
97 Ga0068862_100445344 3300005844 Bacteria 1220
98 Ga0081455_10184341 3300005937 Bacteria 1578
99 Ga0081455_10564639 3300005937 Bacteria 749
100 Ga0081539_10000173 3300005985 Bacteria 151356
101 Ga0070717_10006637 3300006028 Bacteria 8527
102 Ga0070717_10010777 3300006028 Bacteria 6919
103 Ga0070717_10277113 3300006028 Bacteria 1487
104 Ga0075363_100002126 3300006048 Bacteria 7959
105 Ga0070715_10046792 3300006163 Bacteria 1841
106 Ga0070715_10130635 3300006163 Bacteria 1208
107 Ga0070716_100140893 3300006173 Bacteria 1537
108 Ga0070712_100003399 3300006175 Bacteria 9791
109 Ga0075367_10277460 3300006178 Bacteria 1053
110 Ga0075369_10169729 3300006186 Bacteria 1001
111 Ga0075370_10024270 3300006353 Bacteria 3348
112 Ga0068871_100114378 3300006358 Bacteria 2273
113 Ga0068871_100515832 3300006358 Bacteria 1079
114 Ga0075428_100015235 3300006844 Bacteria 8529
115 Ga0075434_100255138 3300006871 Bacteria 1772
116 Ga0075434_101121876 3300006871 Bacteria 799
117 Ga0099794_10128885 3300007265 Bacteria 1276
118 Ga0099795_10023434 3300007788 Bacteria 2049
119 Ga0105251_10145479 3300009011 Bacteria 1072
120 Ga0105250_10045362 3300009092 Bacteria 1762
121 Ga0105247_10005195 3300009101 Bacteria 8231
122 Ga0105243_10140680 3300009148 Bacteria 2059
123 Ga0105242_11629610 3300009176 Bacteria 680
124 Ga0105237_10004429 3300009545 Bacteria 16276
125 Ga0105238_10052473 3300009551 Bacteria 4099
126 Ga0105239_10007880 3300010375 Bacteria 12176
127 Ga0105239_10954837 3300010375 Bacteria 985
128 Ga0105246_10416534 3300011119 Bacteria 1120
129 Ga0105246_10477644 3300011119 Bacteria 1054
130 Ga0157335_1002836 3300012492 Bacteria 1073
131 Ga0157342_1005110 3300012507 Bacteria 1195
132 Ga0157338_1006795 3300012515 Bacteria 1068
133 Ga0157373_10455186 3300013100 Bacteria 921
134 Ga0157369_10195563 3300013105 Bacteria 2124
135 Ga0157374_10007942 3300013296 Bacteria 9063
136 Ga0163162_10305082 3300013306 Bacteria 1724
137 Ga0157372_10731192 3300013307 Bacteria 1151
138 Ga0163163_10216195 3300014325 Bacteria 1965
139 Ga0163163_10382478 3300014325 Bacteria 1465
140 Ga0157377_10020243 3300014745 Bacteria 3484
141 Ga0157379_10271451 3300014968 Bacteria 1542
142 Ga0182005_1200156 3300015265 Bacteria 600
143 Ga0197907_10830985 3300020069 Bacteria 1163
144 Ga0206356_11507630 3300020070 Bacteria 1100
145 Ga0206350_10314167 3300020080 Bacteria 1075
146 Ga0206353_10134612 3300020082 Bacteria 2135
147 Ga0224712_10051149 3300022467 Bacteria 1608
148 Ga0207656_10216315 3300025321 Bacteria 930
149 Ga0207692_10042711 3300025898 Bacteria 2252
150 Ga0207710_10013062 3300025900 Bacteria 3498
151 Ga0207688_10003159 3300025901 Bacteria 8988
152 Ga0207688_10059082 3300025901 Bacteria 2159
153 Ga0207680_10076775 3300025903 Bacteria 2087
154 Ga0207647_10018984 3300025904 Bacteria 4632
155 Ga0207699_10058598 3300025906 Bacteria 2304
156 Ga0207699_10116238 3300025906 Bacteria 1722
157 Ga0207643_10021986 3300025908 Bacteria 3510
158 Ga0207684_10009113 3300025910 Bacteria 8790
159 Ga0207684_10067359 3300025910 Bacteria 3043
160 Ga0207684_10261560 3300025910 Bacteria 1493
161 Ga0207654_10149709 3300025911 Bacteria 1497
162 Ga0207707_10025142 3300025912 Bacteria 5208
163 Ga0207707_10974110 3300025912 Bacteria 697
164 Ga0207671_10009509 3300025914 Bacteria 8120
165 Ga0207671_10270906 3300025914 Bacteria 1338
166 Ga0207693_10003995 3300025915 Bacteria 12535
167 Ga0207693_10006476 3300025915 Bacteria 9702
168 Ga0207693_10344097 3300025915 Bacteria 1167
169 Ga0207663_10040694 3300025916 Bacteria 2827
170 Ga0207663_10179348 3300025916 Bacteria 1511
171 Ga0207663_10290731 3300025916 Bacteria 1217
172 Ga0207662_10019679 3300025918 Bacteria 3845
173 Ga0207657_10100966 3300025919 Bacteria 2395
174 Ga0207646_10032714 3300025922 Bacteria 4705
175 Ga0207694_10096038 3300025924 Bacteria 2344
176 Ga0207694_10315505 3300025924 Bacteria 1289
177 Ga0207650_10251321 3300025925 Bacteria 1431
178 Ga0207659_10219597 3300025926 Bacteria 1527
179 Ga0207700_10024898 3300025928 Bacteria 4148
180 Ga0207700_10491374 3300025928 Bacteria 1085
181 Ga0207700_11081911 3300025928 Bacteria 717
182 Ga0207664_10006014 3300025929 Bacteria 8306
183 Ga0207664_10182491 3300025929 Bacteria 1802
184 Ga0207664_10311352 3300025929 Bacteria 1387
185 Ga0207664_10495711 3300025929 Bacteria 1093
186 Ga0207664_10559610 3300025929 Bacteria 1026
187 Ga0207644_10301427 3300025931 Bacteria 1291
188 Ga0207644_10579853 3300025931 Bacteria 930
189 Ga0207644_10719944 3300025931 Bacteria 833
190 Ga0207706_10232900 3300025933 Bacteria 1611
191 Ga0207691_10127428 3300025940 Bacteria 2251
192 Ga0207711_10264647 3300025941 Bacteria 1581
193 Ga0207689_10001334 3300025942 Bacteria 23807
194 Ga0207661_10286909 3300025944 Bacteria 1472
195 Ga0207679_10028423 3300025945 Bacteria 3880
196 Ga0207679_10385291 3300025945 Bacteria 1230
197 Ga0207667_10452628 3300025949 Bacteria 1304
198 Ga0207651_10255801 3300025960 Bacteria 1435
199 Ga0207712_10362689 3300025961 Bacteria 1208
200 Ga0207658_10196268 3300025986 Bacteria 1681
201 Ga0207677_10266549 3300026023 Bacteria 1399
202 Ga0207703_10626107 3300026035 Bacteria 1019
203 Ga0207639_10218364 3300026041 Bacteria 1645
204 Ga0207678_10002306 3300026067 Bacteria 17276
205 Ga0207678_10092312 3300026067 Bacteria 2588
206 Ga0207708_10011592 3300026075 Bacteria 6568
207 Ga0207708_10561166 3300026075 Bacteria 964
208 Ga0207708_10975175 3300026075 Bacteria 736
209 Ga0207702_10010214 3300026078 Bacteria 7859
210 Ga0207648_10113673 3300026089 Bacteria 2378
211 Ga0207676_10235363 3300026095 Bacteria 1640
212 Ga0207676_10521145 3300026095 Bacteria 1131
213 Ga0207674_10002042 3300026116 Bacteria 25622
214 Ga0207675_100014426 3300026118 Bacteria 7367
215 Ga0207675_100398089 3300026118 Bacteria 1357
216 Ga0207683_10009865 3300026121 Bacteria 8146
217 Ga0207683_10203526 3300026121 Bacteria 1800
218 Ga0207698_10162280 3300026142 Bacteria 1956
219 Ga0207698_10531178 3300026142 Bacteria 1150
220 Ga0268266_10080953 3300028379 Bacteria 2830
221 Ga0268266_10710078 3300028379 Bacteria 969
222 Ga0268266_11588408 3300028379 Bacteria 629
223 Ga0268265_10135390 3300028380 Bacteria 2054
224 Ga0268264_11601556 3300028381 Bacteria 662
225 Ga0307512_10038727 3300030522 Bacteria 4006
226 Ga0265762_1018174 3300030760 Bacteria 1282
227 Ga0265762_1041744 3300030760 Bacteria 899
228 Ga0307513_10698931 3300031456 Bacteria 720
229 Ga0307516_10864686 3300031730 Bacteria 569
230 Ga0307518_10047197 3300031838 Bacteria 3132
231 Ga0307518_10307597 3300031838 Bacteria 958
232 Ga0307406_10181706 3300031901 Bacteria 1532
233 Ga0307415_101836625 3300032126 Bacteria 587
234 Ga0307507_10004082 3300033179 Bacteria 26692
235 Ga0307510_10226632 3300033180 Bacteria 1375
236 Ga0316214_1011115 3300033545 Bacteria 1224
237 Ga0373930_0038965 3300034816 Bacteria 1006
238 Ga0373950_0050602 3300034818 Bacteria 815
239 Ga0373959_0036199 3300034820 Bacteria 1018
240 Ga0373926_0000876 3300035083 Bacteria 8614
241 Ga0373928_0049077 3300035084 Bacteria 991
242 Ga0373934_0118423 3300035086 Bacteria 1076
243 Ga0373940_0018506 3300035088 Bacteria 1749
244 Ga0373944_0002208 3300035089 Bacteria 4946
245 Ga0373923_0036761 3300035111 Bacteria 2000
246 Ga0373936_0000314 3300035113 Bacteria 16354
247 Ga0373936_0524074 3300035113 Bacteria 552
248 Ga0373945_0000066 3300035116 Bacteria 23678
249 Ga0373945_0031512 3300035116 Bacteria 1874
250 Ga0373953_0023786 3300035117 Bacteria 2322
251 Ga0373957_0009452 3300035120 Bacteria 3191
252 Ga0373957_0029031 3300035120 Bacteria 2018
253 Ga0373960_0012068 3300035121 Bacteria 2140
254 Ga0373943_0001292 3300035170 Bacteria 11237
255 Ga0373943_0013688 3300035170 Bacteria 3666
256 Ga0373946_0000073 3300035171 Bacteria 26844
257 Ga0373955_0009329 3300035172 Bacteria 4595
258 Ga0373955_0058527 3300035172 Bacteria 2121
259 Ga0373955_0154546 3300035172 Bacteria 1351
260 Ga0373955_0222144 3300035172 Bacteria 1128
261 Ga0373942_0007228 3300035207 Bacteria 2573
262 Ga0373961_0034880 3300035241 Bacteria 1425
263 Ga0373962_0090566 3300035242 Bacteria 941
264 Ga0373924_0069050 3300035410 Bacteria 1488
265 Ga0373931_0014904 3300035691 Bacteria 3808
266 Ga0373935_0000371 3300035692 Bacteria 23010
267 Ga0373927_0001071 3300035695 Bacteria 20930
268 Ga0373947_0000582 3300035725 Bacteria 21425
269 Ga0373937_0060448 3300036401 Bacteria 3482
270 Ga0373925_0059088 3300037068 Bacteria 2875
271 Ga0373925_0083644 3300037068 Bacteria 2431
272 Ga0436364_0875940 3300037853 Bacteria 990
273 Ga0436364_0897023 3300037853 Bacteria 831
274 Ga0436364_1341515 3300037853 Bacteria 6365
275 Ga0436360_0796707 3300039438 Bacteria 1597
276 Ga0436362_0875852 3300039453 Bacteria 826
277 Ga0439466_0019022 3300041411 Bacteria 2460
278 Ga0439465_0037284 3300041413 Bacteria 1563
279 Ga0451791_0476237 3300041451 Bacteria 1426
280 Ga0451853_1426811 3300041512 Bacteria 2445
281 Ga0439442_005512 3300042002 Bacteria 2530
282 Ga0466969_0059370 3300044656 Bacteria 1860
283 Ga0466972_0013402 3300044658 Bacteria 4116
284 Ga0466965_0005462 3300044683 Bacteria 5730
285 Ga0466966_0029856 3300044684 Bacteria 3545
286 Ga0466961_0021530 3300044693 Bacteria 4149
287 Ga0466963_0259703 3300044694 Bacteria 1219
288 Ga0466971_0057834 3300044719 Bacteria 1750
289 Ga0466968_0003285 3300044735 Bacteria 5960
290 Ga0466968_0014027 3300044735 Bacteria 3161
291 Ga0466970_0038510 3300044765 Bacteria 2536
292 Ga0466970_0082898 3300044765 Bacteria 1734
293 Ga0466957_0088950 3300044842 Bacteria 1932
294 Ga0466960_0000170 3300044901 Bacteria 22220
295 Ga0466960_0034568 3300044901 Bacteria 2356
296 Ga0466959_0098190 3300045049 Bacteria 2098
297 Ga0466958_0037721 3300045836 Bacteria 2896
298 Ga0466967_0220963 3300045976 Bacteria 1800
299 Ga0466967_0274115 3300045976 Bacteria 1617
300 Ga0466967_0561681 3300045976 Bacteria 1124
301 Ga0495592_0005532 3300046454 Bacteria 9345
302 Ga0495592_0034388 3300046454 Bacteria 3820
303 Ga0495592_0078082 3300046454 Bacteria 2398
304 Ga0495592_0395848 3300046454 Bacteria 876
305 Ga0495603_0026525 3300046455 Bacteria 3499
306 Ga0495629_0002241 3300046459 Bacteria 14904
307 Ga0495629_0016388 3300046459 Bacteria 5319
308 Ga0495638_0548958 3300046460 Bacteria 575
309 Ga0495641_0003923 3300046461 Bacteria 10814
310 Ga0495641_0033237 3300046461 Bacteria 2450
311 Ga0495651_0022926 3300046462 Bacteria 4855
312 Ga0495651_0028169 3300046462 Bacteria 4378
313 Ga0495653_0001878 3300046463 Bacteria 16577
314 Ga0495653_0008502 3300046463 Bacteria 8416
315 Ga0495653_0011320 3300046463 Bacteria 7290
316 Ga0495653_0016202 3300046463 Bacteria 6072
317 Ga0495653_0115139 3300046463 Bacteria 1925
318 Ga0495580_0013472 3300046472 Bacteria 6238
319 Ga0495582_0150503 3300046473 Bacteria 1321
320 Ga0495639_0018899 3300046475 Bacteria 3004
321 Ga0495662_0001974 3300046476 Bacteria 10288
322 Ga0495662_0088177 3300046476 Bacteria 1511
323 Ga0495664_0002993 3300046477 Bacteria 9133
324 Ga0495664_0007786 3300046477 Bacteria 5962
325 Ga0495664_0032559 3300046477 Bacteria 3060
326 Ga0495664_0041402 3300046477 Unclassified 2726
327 Ga0495585_0046650 3300046492 Bacteria 2416
328 Ga0495594_0000322 3300046499 Bacteria 23676
329 Ga0495606_0026353 3300046507 Bacteria 4145
330 Ga0495608_0002211 3300046511 Bacteria 14042
331 Ga0495608_0025924 3300046511 Bacteria 4001
332 Ga0495608_0073878 3300046511 Bacteria 2223
333 Ga0495608_0333229 3300046511 Bacteria 936
334 Ga0495608_0378983 3300046511 Bacteria 867
335 Ga0495618_0038990 3300046514 Bacteria 2987
336 Ga0495618_0066664 3300046514 Bacteria 2288
337 Ga0495618_0155129 3300046514 Bacteria 1461
338 Ga0495628_0011178 3300046516 Bacteria 7597
339 Ga0495628_0020885 3300046516 Bacteria 5393
340 Ga0495628_0050138 3300046516 Bacteria 3303
341 Ga0495628_0057729 3300046516 Bacteria 3053
342 Ga0495630_0016079 3300046517 Bacteria 5469
343 Ga0495630_0075192 3300046517 Bacteria 2545
344 Ga0495630_0139305 3300046517 Bacteria 1844
345 Ga0495630_0314281 3300046517 Bacteria 1197
346 Ga0495666_0000590 3300046526 Bacteria 16240
347 Ga0495652_0004467 3300046529 Bacteria 13357
348 Ga0495652_0037454 3300046529 Bacteria 4208
349 Ga0495652_0069654 3300046529 Bacteria 2943
350 Ga0495652_0398409 3300046529 Bacteria 975
351 Ga0495665_0004853 3300046531 Bacteria 7254
352 Ga0495665_0010069 3300046531 Bacteria 5122
353 Ga0495665_0114249 3300046531 Bacteria 1415
354 Ga0495640_0012620 3300046533 Bacteria 6449
355 Ga0495640_0019173 3300046533 Bacteria 5053
356 Ga0495640_0034135 3300046533 Bacteria 3612
357 Ga0495640_0091047 3300046533 Bacteria 2012
358 Ga0495586_0161230 3300046535 Bacteria 1265
359 Ga0495587_0002970 3300046536 Bacteria 11338
360 Ga0495587_0004915 3300046536 Bacteria 8764
361 Ga0495645_0003904 3300046543 Bacteria 10164
362 Ga0495645_0008482 3300046543 Bacteria 7175
363 Ga0495645_0042103 3300046543 Bacteria 3330
364 Ga0495645_0073758 3300046543 Bacteria 2458
365 Ga0495645_0128263 3300046543 Bacteria 1780
366 Ga0495633_0088623 3300046558 Bacteria 1439
367 Ga0495667_0001289 3300046559 Bacteria 16420
368 Ga0495667_0006211 3300046559 Bacteria 8094
369 Ga0495667_0022489 3300046559 Bacteria 4247
370 Ga0495667_0078634 3300046559 Bacteria 2144
371 Ga0495668_0044252 3300046616 Bacteria 2474
372 Ga0495668_0620011 3300046616 Bacteria 598
373 Ga0495634_0005432 3300046642 Bacteria 9817
374 Ga0495634_0005789 3300046642 Bacteria 9434
375 Ga0495634_0357637 3300046642 Bacteria 873
376 Ga0495634_0530124 3300046642 Bacteria 688
377 Ga0495635_0000941 3300046663 Bacteria 19199
378 Ga0495635_0007582 3300046663 Bacteria 7571
379 Ga0495588_0022161 3300046674 Bacteria 3138
380 Ga0495657_0001206 3300046675 Bacteria 22653
381 Ga0495657_0090163 3300046675 Bacteria 1968
382 Ga0495657_0231870 3300046675 Bacteria 1116
383 Ga0495599_0002708 3300046678 Bacteria 10339
384 Ga0495599_0047957 3300046678 Bacteria 2677
385 Ga0495599_0059659 3300046678 Bacteria 2386
386 Ga0495599_0177521 3300046678 Bacteria 1313
387 Ga0495623_0023430 3300046679 Bacteria 3985
388 Ga0495646_0020157 3300046680 Bacteria 4216
389 Ga0495646_0068141 3300046680 Bacteria 2101
390 Ga0495647_0012282 3300046681 Bacteria 2947
391 Ga0495658_0033288 3300046683 Bacteria 2821
392 Ga0495658_0296889 3300046683 Bacteria 1021
393 Ga0495613_0002883 3300046689 Bacteria 12877
394 Ga0495613_0003064 3300046689 Bacteria 12484
395 Ga0495613_0072201 3300046689 Bacteria 2516
396 Ga0495624_0017260 3300046690 Bacteria 4850
397 Ga0495624_0113121 3300046690 Bacteria 1669
398 Ga0495624_0130184 3300046690 Bacteria 1543
399 Ga0495600_0001737 3300046809 Bacteria 12180
400 Ga0495600_0040226 3300046809 Bacteria 3044
401 Ga0495600_0415431 3300046809 Bacteria 835
402 Ga0495581_0029973 3300047315 Bacteria 3154
403 Ga0495581_0132372 3300047315 Bacteria 1453
404 Ga0495604_0000482 3300047317 Bacteria 35034
405 Ga0495604_0008179 3300047317 Bacteria 8277
406 Ga0495674_0001678 3300047319 Bacteria 21774
407 Ga0495674_0002739 3300047319 Bacteria 17109
408 Ga0495674_0017961 3300047319 Bacteria 6585
409 Ga0495674_0095653 3300047319 Bacteria 2532
410 Ga0495674_0154852 3300047319 Bacteria 1920
411 Ga0495674_0650777 3300047319 Bacteria 831
412 Ga0495672_0002524 3300047320 Bacteria 16717
413 Ga0495676_0032879 3300047321 Bacteria 4373
414 Ga0495676_0040569 3300047321 Bacteria 3839
415 Ga0495676_0105512 3300047321 Bacteria 2077
416 Ga0495680_0008559 3300047322 Bacteria 9289
417 Ga0495680_0010913 3300047322 Bacteria 8072
418 Ga0495675_0020373 3300047444 Bacteria 4217
419 Ga0495675_0042581 3300047444 Bacteria 2892
420 Ga0495675_0365846 3300047444 Bacteria 846
421 Ga0495673_0001014 3300047469 Bacteria 24774
422 Ga0495684_0001504 3300047471 Bacteria 18649
423 Ga0495684_0003168 3300047471 Bacteria 12896
424 Ga0495684_0634435 3300047471 Bacteria 716
425 Ga0495602_0048691 3300048088 Bacteria 3805
426 Ga0495602_0075791 3300048088 Bacteria 2853
427 Ga0495602_0123523 3300048088 Bacteria 2078
428 Ga0495602_0357105 3300048088 Bacteria 1053
429 Ga0495614_0001264 3300048089 Bacteria 10860
430 Ga0496100_0000780 3300048903 Bacteria 15181
431 Ga0496100_0127055 3300048903 Bacteria 1790
432 Ga0496101_0000031 3300048904 Bacteria 195195
433 Ga0496101_0077571 3300048904 Bacteria 2448
434 Ga0496102_0000065 3300048905 Bacteria 161370
435 Ga0496103_0000048 3300048906 Bacteria 160911
436 Ga0496103_0027107 3300048906 Bacteria 3470
437 Ga0496103_0209553 3300048906 Bacteria 1253
438 Ga0496103_0702428 3300048906 Bacteria 641
439 Ga0496104_0446464 3300048907 Bacteria 1205
440 Ga0496105_0699531 3300048908 Bacteria 778
441 Ga0496106_0107807 3300048909 Bacteria 2166
442 Ga0496106_0441598 3300048909 Bacteria 1045
443 Ga0496107_0034691 3300048910 Bacteria 3614
444 Ga0496108_0499384 3300048911 Bacteria 1062
445 Ga0496108_0874224 3300048911 Bacteria 772
446 Ga0496109_0002787 3300048912 Bacteria 14644
447 Ga0496109_0004328 3300048912 Bacteria 11860
448 Ga0496109_0313667 3300048912 Bacteria 1479
449 Ga0496110_0041545 3300048913 Bacteria 4013
450 Ga0496110_0385935 3300048913 Bacteria 1276
451 Ga0496111_0057185 3300048914 Bacteria 2823
452 Ga0496112_0034944 3300048915 Bacteria 4892
453 Ga0496113_0119346 3300048916 Bacteria 2060
454 Ga0496113_1075812 3300048916 Bacteria 631
455 Ga0496113_1292290 3300048916 Bacteria 568
456 Ga0496114_0280359 3300048917 Bacteria 1469
457 Ga0496115_0018107 3300048918 Bacteria 5399
458 Ga0496115_0099897 3300048918 Bacteria 2378
459 Ga0496116_0000125 3300048919 Bacteria 160885
460 Ga0496117_0000111 3300048920 Bacteria 184570
461 Ga0496118_0000083 3300048921 Bacteria 184570
462 Ga0496121_0000728 3300048924 Bacteria 60874
463 Ga0496125_0021933 3300048928 Bacteria 5939
464 Ga0496126_0000220 3300048929 Bacteria 124547
465 Ga0496126_0202277 3300048929 Bacteria 1676
466 Ga0496126_0368779 3300048929 Bacteria 1171
467 Ga0496126_0430768 3300048929 Bacteria 1065
468 Ga0501031_0093871 3300049568 Bacteria 1958
469 Ga0501032_0088532 3300049569 Bacteria 2055
470 Ga0501033_0038007 3300049570 Bacteria 3601
471 Ga0501034_0018238 3300049571 Bacteria 7200
472 Ga0501034_0222620 3300049571 Bacteria 1839
473 Ga0501036_0040078 3300049572 Bacteria 3962
474 Ga0501038_0047264 3300049574 Bacteria 3728
475 Ga0501042_0651929 3300049578 Bacteria 765
476 Ga0501043_0027916 3300049579 Bacteria 4430
477 Ga0501047_0108804 3300049581 Bacteria 2654
478 Ga0501047_0160967 3300049581 Bacteria 2116
479 Ga0501035_0121899 3300049822 Bacteria 2278
480 Ga0501044_0042444 3300049823 Bacteria 4730
481 Ga0501044_0389204 3300049823 Bacteria 1308
482 Ga0501044_1278175 3300049823 Bacteria 601
483 nmdc:mga03n38_246265_c1 3300050490 Bacteria 942
484 nmdc:mga03n38_5266_c1 3300050490 Bacteria 4387
485 nmdc:mga00v17_198405_c1 3300050491 Bacteria 1297
486 nmdc:mga06z11_347191_c1 3300050494 Bacteria 888
487 nmdc:mga07m45_14241_c1 3300050496 Bacteria 4232
488 nmdc:mga07m45_17940_c1 3300050496 Bacteria 3809
489 nmdc:mga0n895_622806_c1 3300050512 Bacteria 1080
490 nmdc:mga0n895_762952_c1 3300050512 Bacteria 960
491 Ga0495601_0005227 3300053077 Bacteria 7552
492 Ga0495601_0009816 3300053077 Bacteria 5665
493 Ga0495601_0249368 3300053077 Bacteria 1159
494 Ga0495612_0137423 3300053078 Bacteria 1059
495 Ga0495619_0011017 3300053085 Bacteria 5690
496 Ga0495619_0101872 3300053085 Bacteria 1955
497 Ga0500643_003652 3300053087 Bacteria 7271
498 Ga0500559_0010239 3300053136 Bacteria 4031
499 Ga0500585_137618 3300053144 Bacteria 861
500 Ga0500616_0000116 3300053153 Bacteria 145790
501 Ga0587106_099375 3300059605 Bacteria 592
502 Ga0501082_0455401 3300060353 Bacteria 1118
503 2515853823 2515154155 Bacteria 7985436
504 2566996177 2565956761 Bacteria 6601618
505 2585297659 2582581312 Bacteria 7308206
506 2616902812 2616644941 Bacteria 8510691
507 2643942534 2643221587 Bacteria 7586415
508 2644429993 2643221677 Bacteria 7584031
509 2738888727 2738541308 Bacteria 7020677
510 2739204609 2738543005 Bacteria 5278128
511 2862296506 2862290372 Bacteria 7471434
512 2868090213 2868088558 Bacteria 7609351
513 2899362126 2899359706 Bacteria 10940472
514 2902797188 2902792274 Bacteria 7270173
515 2904540813 2904535858 Bacteria 6308016
516 2917743470 2917736166 Bacteria 9690793
517 2922554904 2922554459 Bacteria 6683962
518 2928145448 2928142448 Bacteria 5288925
519 2932401600 2932398195 Bacteria 3847976
520 3006488060 3006486233 Bacteria 8157040
521 JGI24747J21853_1032784
522 JGI24740J21852_10099037
523 JGI24743J22301_10044772
524 JGI24745J21846_1042702
525 JGI24744J21845_10035094
526 rootH2_10059946
527 Ga0070658_10185495
528 Ga0070676_10178240
529 Ga0070683_100010691
530 Ga0070690_100157638
531 Ga0068869_100273727
532 Ga0070666_10009723
533 Ga0070680_100075244
534 Ga0070682_100078446
535 Ga0068868_100139057
536 Ga0070660_100087569
537 Ga0070691_10025510
538 Ga0070661_100160380
539 Ga0070661_100236388
540 Ga0070668_100559205
541 Ga0070675_100040688
542 Ga0070674_100129431
543 Ga0070673_100108404
544 Ga0070659_100150807
545 Ga0070667_100226641
546 Ga0070667_100502473
547 Ga0070714_100038216
548 Ga0070714_101156748
549 Ga0070714_101228460
550 Ga0070713_100062171
551 Ga0070713_100186538
552 Ga0070713_100218132
553 Ga0070710_10185113
554 Ga0070710_10243312
555 Ga0070710_10294223
556 Ga0070701_10003907
557 Ga0070711_100036343
558 Ga0070705_100019573
559 Ga0070700_100092717
560 Ga0070708_100294645
561 Ga0070708_100297924
562 Ga0070708_100624575
563 Ga0070663_100004385
564 Ga0070663_100088531
565 Ga0070663_100351212
566 Ga0070663_101041467
567 Ga0070678_100354498
568 Ga0070662_100168674
569 Ga0070681_10147646
570 Ga0070681_11224222
571 Ga0070685_10147211
572 Ga0070685_10790194
573 Ga0070706_100010288
574 Ga0070706_100140518
575 Ga0070706_100486944
576 Ga0070707_100310916
577 Ga0070707_100398903
578 Ga0070698_100015097
579 Ga0070698_100033811
580 Ga0070698_100298504
581 Ga0070699_100125465
582 Ga0070679_100014169
583 Ga0070684_100055569
584 Ga0070684_100331080
585 Ga0068853_100123332
586 Ga0070672_100039666
587 Ga0070686_100018252
588 Ga0070695_100042959
589 Ga0070696_100032530
590 Ga0070693_100128722
591 Ga0070665_100021205
592 Ga0070665_100111257
593 Ga0070665_100826008
594 Ga0070664_100004731
595 Ga0070664_100511166
596 Ga0068857_100049915
597 Ga0068857_100551503
598 Ga0068854_100123257
599 Ga0068856_100193149
600 Ga0068856_101152774
601 Ga0068852_100057339
602 Ga0068852_100468324
603 Ga0068852_100758872
604 Ga0068864_100205279
605 Ga0068864_100333654
606 Ga0068866_10090570
607 Ga0068861_100252515
608 Ga0068861_100702197
609 Ga0068851_10094111
610 Ga0068870_10022978
611 Ga0068863_100222610
612 Ga0068863_100299162
613 Ga0068858_100340492
614 Ga0068860_100158977
615 Ga0068860_100218742
616 Ga0068862_100296463
617 Ga0068862_100445344
618 Ga0081455_10184341
619 Ga0081455_10564639
620 Ga0081539_10000173
621 Ga0070717_10006637
622 Ga0070717_10010777
623 Ga0070717_10277113
624 Ga0075363_100002126
625 Ga0070715_10046792
626 Ga0070715_10130635
627 Ga0070716_100140893
628 Ga0070712_100003399
629 Ga0075367_10277460
630 Ga0075369_10169729
631 Ga0075370_10024270
632 Ga0068871_100114378
633 Ga0068871_100515832
634 Ga0075428_100015235
635 Ga0075434_100255138
636 Ga0075434_101121876
637 Ga0099794_10128885
638 Ga0099795_10023434
639 Ga0105251_10145479
640 Ga0105250_10045362
641 Ga0105247_10005195
642 Ga0105243_10140680
643 Ga0105242_11629610
644 Ga0105237_10004429
645 Ga0105238_10052473
646 Ga0105239_10007880
647 Ga0105239_10954837
648 Ga0105246_10416534
649 Ga0105246_10477644
650 Ga0157335_1002836
651 Ga0157342_1005110
652 Ga0157338_1006795
653 Ga0157373_10455186
654 Ga0157369_10195563
655 Ga0157374_10007942
656 Ga0163162_10305082
657 Ga0157372_10731192
658 Ga0163163_10216195
659 Ga0163163_10382478
660 Ga0157377_10020243
661 Ga0157379_10271451
662 Ga0182005_1200156
663 Ga0197907_10830985
664 Ga0206356_11507630
665 Ga0206350_10314167
666 Ga0206353_10134612
667 Ga0224712_10051149
668 Ga0207656_10216315
669 Ga0207692_10042711
670 Ga0207710_10013062
671 Ga0207688_10003159
672 Ga0207688_10059082
673 Ga0207680_10076775
674 Ga0207647_10018984
675 Ga0207699_10058598
676 Ga0207699_10116238
677 Ga0207643_10021986
678 Ga0207684_10009113
679 Ga0207684_10067359
680 Ga0207684_10261560
681 Ga0207654_10149709
682 Ga0207707_10025142
683 Ga0207707_10974110
684 Ga0207671_10009509
685 Ga0207671_10270906
686 Ga0207693_10003995
687 Ga0207693_10006476
688 Ga0207693_10344097
689 Ga0207663_10040694
690 Ga0207663_10179348
691 Ga0207663_10290731
692 Ga0207662_10019679
693 Ga0207657_10100966
694 Ga0207646_10032714
695 Ga0207694_10096038
696 Ga0207694_10315505
697 Ga0207650_10251321
698 Ga0207659_10219597
699 Ga0207700_10024898
700 Ga0207700_10491374
701 Ga0207700_11081911
702 Ga0207664_10006014
703 Ga0207664_10182491
704 Ga0207664_10311352
705 Ga0207664_10495711
706 Ga0207664_10559610
707 Ga0207644_10301427
708 Ga0207644_10579853
709 Ga0207644_10719944
710 Ga0207706_10232900
711 Ga0207691_10127428
712 Ga0207711_10264647
713 Ga0207689_10001334
714 Ga0207661_10286909
715 Ga0207679_10028423
716 Ga0207679_10385291
717 Ga0207667_10452628
718 Ga0207651_10255801
719 Ga0207712_10362689
720 Ga0207658_10196268
721 Ga0207677_10266549
722 Ga0207703_10626107
723 Ga0207639_10218364
724 Ga0207678_10002306
725 Ga0207678_10092312
726 Ga0207708_10011592
727 Ga0207708_10561166
728 Ga0207708_10975175
729 Ga0207702_10010214
730 Ga0207648_10113673
731 Ga0207676_10235363
732 Ga0207676_10521145
733 Ga0207674_10002042
734 Ga0207675_100014426
735 Ga0207675_100398089
736 Ga0207683_10009865
737 Ga0207683_10203526
738 Ga0207698_10162280
739 Ga0207698_10531178
740 Ga0268266_10080953
741 Ga0268266_10710078
742 Ga0268266_11588408
743 Ga0268265_10135390
744 Ga0268264_11601556
745 Ga0307512_10038727
746 Ga0265762_1018174
747 Ga0265762_1041744
748 Ga0307513_10698931
749 Ga0307516_10864686
750 Ga0307518_10047197
751 Ga0307518_10307597
752 Ga0307406_10181706
753 Ga0307415_101836625
754 Ga0307507_10004082
755 Ga0307510_10226632
756 Ga0316214_1011115
757 Ga0373930_0038965
758 Ga0373950_0050602
759 Ga0373959_0036199
760 Ga0373926_0000876
761 Ga0373928_0049077
762 Ga0373934_0118423
763 Ga0373940_0018506
764 Ga0373944_0002208
765 Ga0373923_0036761
766 Ga0373936_0000314
767 Ga0373936_0524074
768 Ga0373945_0000066
769 Ga0373945_0031512
770 Ga0373953_0023786
771 Ga0373957_0009452
772 Ga0373957_0029031
773 Ga0373960_0012068
774 Ga0373943_0001292
775 Ga0373943_0013688
776 Ga0373946_0000073
777 Ga0373955_0009329
778 Ga0373955_0058527
779 Ga0373955_0154546
780 Ga0373955_0222144
781 Ga0373942_0007228
782 Ga0373961_0034880
783 Ga0373962_0090566
784 Ga0373924_0069050
785 Ga0373931_0014904
786 Ga0373935_0000371
787 Ga0373927_0001071
788 Ga0373947_0000582
789 Ga0373937_0060448
790 Ga0373925_0059088
791 Ga0373925_0083644
792 Ga0436364_0875940
793 Ga0436364_0897023
794 Ga0436364_1341515
795 Ga0436360_0796707
796 Ga0436362_0875852
797 Ga0439466_0019022
798 Ga0439465_0037284
799 Ga0451791_0476237
800 Ga0451853_1426811
801 Ga0439442_005512
802 Ga0466969_0059370
803 Ga0466972_0013402
804 Ga0466965_0005462
805 Ga0466966_0029856
806 Ga0466961_0021530
807 Ga0466963_0259703
808 Ga0466971_0057834
809 Ga0466968_0003285
810 Ga0466968_0014027
811 Ga0466970_0038510
812 Ga0466970_0082898
813 Ga0466957_0088950
814 Ga0466960_0000170
815 Ga0466960_0034568
816 Ga0466959_0098190
817 Ga0466958_0037721
818 Ga0466967_0220963
819 Ga0466967_0274115
820 Ga0466967_0561681
821 Ga0495592_0005532
822 Ga0495592_0034388
823 Ga0495592_0078082
824 Ga0495592_0395848
825 Ga0495603_0026525
826 Ga0495629_0002241
827 Ga0495629_0016388
828 Ga0495638_0548958
829 Ga0495641_0003923
830 Ga0495641_0033237
831 Ga0495651_0022926
832 Ga0495651_0028169
833 Ga0495653_0001878
834 Ga0495653_0008502
835 Ga0495653_0011320
836 Ga0495653_0016202
837 Ga0495653_0115139
838 Ga0495580_0013472
839 Ga0495582_0150503
840 Ga0495639_0018899
841 Ga0495662_0001974
842 Ga0495662_0088177
843 Ga0495664_0002993
844 Ga0495664_0007786
845 Ga0495664_0032559
846 Ga0495664_0041402
847 Ga0495585_0046650
848 Ga0495594_0000322
849 Ga0495606_0026353
850 Ga0495608_0002211
851 Ga0495608_0025924
852 Ga0495608_0073878
853 Ga0495608_0333229
854 Ga0495608_0378983
855 Ga0495618_0038990
856 Ga0495618_0066664
857 Ga0495618_0155129
858 Ga0495628_0011178
859 Ga0495628_0020885
860 Ga0495628_0050138
861 Ga0495628_0057729
862 Ga0495630_0016079
863 Ga0495630_0075192
864 Ga0495630_0139305
865 Ga0495630_0314281
866 Ga0495666_0000590
867 Ga0495652_0004467
868 Ga0495652_0037454
869 Ga0495652_0069654
870 Ga0495652_0398409
871 Ga0495665_0004853
872 Ga0495665_0010069
873 Ga0495665_0114249
874 Ga0495640_0012620
875 Ga0495640_0019173
876 Ga0495640_0034135
877 Ga0495640_0091047
878 Ga0495586_0161230
879 Ga0495587_0002970
880 Ga0495587_0004915
881 Ga0495645_0003904
882 Ga0495645_0008482
883 Ga0495645_0042103
884 Ga0495645_0073758
885 Ga0495645_0128263
886 Ga0495633_0088623
887 Ga0495667_0001289
888 Ga0495667_0006211
889 Ga0495667_0022489
890 Ga0495667_0078634
891 Ga0495668_0044252
892 Ga0495668_0620011
893 Ga0495634_0005432
894 Ga0495634_0005789
895 Ga0495634_0357637
896 Ga0495634_0530124
897 Ga0495635_0000941
898 Ga0495635_0007582
899 Ga0495588_0022161
900 Ga0495657_0001206
901 Ga0495657_0090163
902 Ga0495657_0231870
903 Ga0495599_0002708
904 Ga0495599_0047957
905 Ga0495599_0059659
906 Ga0495599_0177521
907 Ga0495623_0023430
908 Ga0495646_0020157
909 Ga0495646_0068141
910 Ga0495647_0012282
911 Ga0495658_0033288
912 Ga0495658_0296889
913 Ga0495613_0002883
914 Ga0495613_0003064
915 Ga0495613_0072201
916 Ga0495624_0017260
917 Ga0495624_0113121
918 Ga0495624_0130184
919 Ga0495600_0001737
920 Ga0495600_0040226
921 Ga0495600_0415431
922 Ga0495581_0029973
923 Ga0495581_0132372
924 Ga0495604_0000482
925 Ga0495604_0008179
926 Ga0495674_0001678
927 Ga0495674_0002739
928 Ga0495674_0017961
929 Ga0495674_0095653
930 Ga0495674_0154852
931 Ga0495674_0650777
932 Ga0495672_0002524
933 Ga0495676_0032879
934 Ga0495676_0040569
935 Ga0495676_0105512
936 Ga0495680_0008559
937 Ga0495680_0010913
938 Ga0495675_0020373
939 Ga0495675_0042581
940 Ga0495675_0365846
941 Ga0495673_0001014
942 Ga0495684_0001504
943 Ga0495684_0003168
944 Ga0495684_0634435
945 Ga0495602_0048691
946 Ga0495602_0075791
947 Ga0495602_0123523
948 Ga0495602_0357105
949 Ga0495614_0001264
950 Ga0496100_0000780
951 Ga0496100_0127055
952 Ga0496101_0000031
953 Ga0496101_0077571
954 Ga0496102_0000065
955 Ga0496103_0000048
956 Ga0496103_0027107
957 Ga0496103_0209553
958 Ga0496103_0702428
959 Ga0496104_0446464
960 Ga0496105_0699531
961 Ga0496106_0107807
962 Ga0496106_0441598
963 Ga0496107_0034691
964 Ga0496108_0499384
965 Ga0496108_0874224
966 Ga0496109_0002787
967 Ga0496109_0004328
968 Ga0496109_0313667
969 Ga0496110_0041545
970 Ga0496110_0385935
971 Ga0496111_0057185
972 Ga0496112_0034944
973 Ga0496113_0119346
974 Ga0496113_1075812
975 Ga0496113_1292290
976 Ga0496114_0280359
977 Ga0496115_0018107
978 Ga0496115_0099897
979 Ga0496116_0000125
980 Ga0496117_0000111
981 Ga0496118_0000083
982 Ga0496121_0000728
983 Ga0496125_0021933
984 Ga0496126_0000220
985 Ga0496126_0202277
986 Ga0496126_0368779
987 Ga0496126_0430768
988 Ga0501031_0093871
989 Ga0501032_0088532
990 Ga0501033_0038007
991 Ga0501034_0018238
992 Ga0501034_0222620
993 Ga0501036_0040078
994 Ga0501038_0047264
995 Ga0501042_0651929
996 Ga0501043_0027916
997 Ga0501047_0108804
998 Ga0501047_0160967
999 Ga0501035_0121899
1000 Ga0501044_0042444
1001 Ga0501044_0389204
1002 Ga0501044_1278175
1003 nmdc:mga03n38_246265_c1
1004 nmdc:mga03n38_5266_c1
1005 nmdc:mga00v17_198405_c1
1006 nmdc:mga06z11_347191_c1
1007 nmdc:mga07m45_14241_c1
1008 nmdc:mga07m45_17940_c1
1009 nmdc:mga0n895_622806_c1
1010 nmdc:mga0n895_762952_c1
1011 Ga0495601_0005227
1012 Ga0495601_0009816
1013 Ga0495601_0249368
1014 Ga0495612_0137423
1015 Ga0495619_0011017
1016 Ga0495619_0101872
1017 Ga0500643_003652
1018 Ga0500559_0010239
1019 Ga0500585_137618
1020 Ga0500616_0000116
1021 Ga0587106_099375
1022 Ga0501082_0455401
1023 2515853823
1024 2566996177
1025 2585297659
1026 2616902812
1027 2643942534
1028 2644429993
1029 2738888727
1030 2739204609
1031 2862296506
1032 2868090213
1033 2899362126
1034 2902797188
1035 2904540813
1036 2917743470
1037 2922554904
1038 2928145448
1039 2932401600
1040 3006488060

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

25

132

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l8l-assembly1.cif.gz_A crystal structure of human r152h gpx4-u46c 0.9325 2 161
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9272 1 164
5l71-assembly1.cif.gz_A crystal structure of mouse phospholipid hydroperoxide glutathione peroxidase 4 (gpx4) 0.9187 1 161
7l8m-assembly1.cif.gz_A crystal structure of human gpx4-u46c mutant k48l 0.917 2 161
7l8r-assembly2.cif.gz_B crystal structure of human gpx4-u46c mutant k48a 0.916 2 161
ID Description Score Start End Superfamily
af_Q4CY93_66_221_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9321 2 160 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9277 3 161 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9273 2 160 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.921 2 164 3.40.30.10
2p31B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9135 1 162 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1I3XYZ8-F1-model_v4 Glutathione peroxidase 0.9844 1 161 GO:0004601
GO:0034599
AF-A0A7X0EYC3-F1-model_v4 Glutathione peroxidase 0.9836 1 161 GO:0004602
GO:0034599
AF-A0A1A3ID35-F1-model_v4 Glutathione peroxidase 0.9835 1 162 GO:0004601
GO:0034599
AF-A0A429BCQ9-F1-model_v4 Glutathione peroxidase 0.9832 1 161 GO:0004601
GO:0034599
AF-A0A4Y9MQB4-F1-model_v4 Glutathione peroxidase 0.983 1 162 GO:0004601
GO:0034599

Map