F458621

General Info

Members Datasets Scaffolds Average Seq Length
520 178 1040 217

Family's Representative Sequence

Representative Sequence 3300059645|Ga0587076_068928|Ga0587076_068928_32_694
Length 211
Sequence MLRLGAAGAAGLILSSAASSQIVPGLIAPPNAGSGMVPLARVPAGIDPQLFQRAKAALDAHRIAARDSIGIADFSQPSSNPRFHLVDLQNGTVESHLVCHGRGSDPAHSGYLERFNDFGSYATSNGTYVTDDYYQGKYGLSLKVRGLDWTNNNAEDRAIVIHNAWYAEPEMIPLHGMLGRSEGCFAMPKKSQYEVMRRLAGGRMIYADKLA

Samples

Sample ID Description Type Environment
1 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
136 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
137 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
152 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
162 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
163 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
178 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.46
Metatranscriptomes 1.35
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.96
Rhizosphere 99.04
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0587076_068928 3300059645 Unclassified 730
2 JGI24741J21665_1000578 3300001915 Bacteria 11131
3 JGI24740J21852_10018280 3300001979 Bacteria 2491
4 JGI24740J21852_10054594 3300001979 Bacteria 1127
5 JGI24739J22299_10003228 3300001989 Bacteria 6220
6 JGI24739J22299_10006424 3300001989 Bacteria 4438
7 JGI24739J22299_10039060 3300001989 Bacteria 1592
8 JGI24737J22298_10000987 3300001990 Bacteria 10119
9 JGI24737J22298_10005144 3300001990 Bacteria 4528
10 JGI24735J21928_10010414 3300002067 Bacteria 2965
11 JGI24735J21928_10014734 3300002067 Bacteria 2446
12 JGI24738J21930_10003272 3300002075 Bacteria 4121
13 Ga0065714_10107729 3300005288 Bacteria 1492
14 Ga0065712_10097823 3300005290 Bacteria 2138
15 Ga0070658_10000269 3300005327 Bacteria 45712
16 Ga0070658_10009873 3300005327 Bacteria 7669
17 Ga0070658_10039807 3300005327 Bacteria 3792
18 Ga0070658_10055450 3300005327 Bacteria 3220
19 Ga0070658_10066799 3300005327 Bacteria 2938
20 Ga0070658_10137343 3300005327 Bacteria 2041
21 Ga0070658_10172122 3300005327 Bacteria 1819
22 Ga0070676_10055359 3300005328 Bacteria 2340
23 Ga0070676_10171710 3300005328 Bacteria 1403
24 Ga0070683_100001138 3300005329 Bacteria 20116
25 Ga0070683_100009832 3300005329 Bacteria 8195
26 Ga0070683_100057299 3300005329 Bacteria 3620
27 Ga0070683_100222484 3300005329 Unclassified 1794
28 Ga0070683_100230585 3300005329 Bacteria 1760
29 Ga0070683_100444940 3300005329 Bacteria 1236
30 Ga0070690_100323523 3300005330 Bacteria 1112
31 Ga0070670_100000632 3300005331 Bacteria 27410
32 Ga0070670_100020883 3300005331 Bacteria 5632
33 Ga0070670_100106381 3300005331 Bacteria 2417
34 Ga0070677_10004813 3300005333 Bacteria 4429
35 Ga0070677_10026523 3300005333 Bacteria 2173
36 Ga0070666_10000330 3300005335 Bacteria 29917
37 Ga0070666_10379841 3300005335 Bacteria 1014
38 Ga0070680_100017872 3300005336 Bacteria 5595
39 Ga0070680_100108509 3300005336 Bacteria 2309
40 Ga0070682_100014847 3300005337 Bacteria 4507
41 Ga0070682_100139802 3300005337 Bacteria 1649
42 Ga0068868_100595208 3300005338 Bacteria 979
43 Ga0070660_100000109 3300005339 Bacteria 50964
44 Ga0070660_100008282 3300005339 Bacteria 7266
45 Ga0070660_100011109 3300005339 Bacteria 6386
46 Ga0070660_100104882 3300005339 Bacteria 2243
47 Ga0070660_100317374 3300005339 Bacteria 1279
48 Ga0070691_10053368 3300005341 Bacteria 1934
49 Ga0070661_100000070 3300005344 Bacteria 82818
50 Ga0070661_100033437 3300005344 Bacteria 3724
51 Ga0070661_100126363 3300005344 Bacteria 1918
52 Ga0070661_100168464 3300005344 Bacteria 1662
53 Ga0070661_100428698 3300005344 Bacteria 1049
54 Ga0070661_100453188 3300005344 Bacteria 1021
55 Ga0070661_100506785 3300005344 Unclassified 967
56 Ga0070692_10010960 3300005345 Bacteria 4149
57 Ga0070692_10013273 3300005345 Bacteria 3836
58 Ga0070692_10013980 3300005345 Bacteria 3756
59 Ga0070692_10400295 3300005345 Bacteria 866
60 Ga0070668_100024705 3300005347 Bacteria 4554
61 Ga0070669_100025316 3300005353 Bacteria 4261
62 Ga0070669_100117296 3300005353 Bacteria 2027
63 Ga0070669_100383983 3300005353 Bacteria 1146
64 Ga0070669_100568489 3300005353 Bacteria 947
65 Ga0070675_100001534 3300005354 Bacteria 17081
66 Ga0070675_100015032 3300005354 Bacteria 6114
67 Ga0070675_100079731 3300005354 Bacteria 2728
68 Ga0070675_100226009 3300005354 Bacteria 1631
69 Ga0070671_100001248 3300005355 Bacteria 19067
70 Ga0070671_100005801 3300005355 Bacteria 9835
71 Ga0070671_100012010 3300005355 Bacteria 6966
72 Ga0070671_100307158 3300005355 Bacteria 1351
73 Ga0070674_100011729 3300005356 Bacteria 5346
74 Ga0070673_100366577 3300005364 Bacteria 1282
75 Ga0070659_100000312 3300005366 Bacteria 37872
76 Ga0070659_100025887 3300005366 Bacteria 4512
77 Ga0070659_100041705 3300005366 Bacteria 3588
78 Ga0070659_100074427 3300005366 Bacteria 2705
79 Ga0070659_100200329 3300005366 Bacteria 1643
80 Ga0070667_100021289 3300005367 Bacteria 5387
81 Ga0070714_100364312 3300005435 Bacteria 1360
82 Ga0070713_100627132 3300005436 Bacteria 1023
83 Ga0070705_100340334 3300005440 Bacteria 1090
84 Ga0070663_100005850 3300005455 Bacteria 7348
85 Ga0070663_100025115 3300005455 Bacteria 4020
86 Ga0070663_100026090 3300005455 Bacteria 3953
87 Ga0070663_100095784 3300005455 Bacteria 2207
88 Ga0070663_100275290 3300005455 Bacteria 1339
89 Ga0070663_100402851 3300005455 Bacteria 1119
90 Ga0070678_100017727 3300005456 Bacteria 4594
91 Ga0070662_100000037 3300005457 Bacteria 76596
92 Ga0070662_100000256 3300005457 Bacteria 31436
93 Ga0070662_100008309 3300005457 Bacteria 6763
94 Ga0070662_100008480 3300005457 Bacteria 6706
95 Ga0070662_100028447 3300005457 Bacteria 3889
96 Ga0070662_100109917 3300005457 Bacteria 2098
97 Ga0070662_100122792 3300005457 Bacteria 1992
98 Ga0070681_10095915 3300005458 Bacteria 2914
99 Ga0070681_10135295 3300005458 Bacteria 2395
100 Ga0070681_10178777 3300005458 Bacteria 2043
101 Ga0070681_10193536 3300005458 Bacteria 1953
102 Ga0070681_10587075 3300005458 Bacteria 1028
103 Ga0068867_100015138 3300005459 Bacteria 5469
104 Ga0070679_100007863 3300005530 Bacteria 10000
105 Ga0070679_100017940 3300005530 Bacteria 6857
106 Ga0070679_100089715 3300005530 Bacteria 3061
107 Ga0070679_100151773 3300005530 Bacteria 2293
108 Ga0070679_100191533 3300005530 Bacteria 2013
109 Ga0070679_100332814 3300005530 Bacteria 1467
110 Ga0070684_100074365 3300005535 Bacteria 2995
111 Ga0068853_100000309 3300005539 Bacteria 34282
112 Ga0068853_100041268 3300005539 Bacteria 3940
113 Ga0068853_100306820 3300005539 Bacteria 1468
114 Ga0068853_100339904 3300005539 Bacteria 1395
115 Ga0068853_100505382 3300005539 Bacteria 1141
116 Ga0070672_100000621 3300005543 Bacteria 20802
117 Ga0070672_100002117 3300005543 Bacteria 12535
118 Ga0070672_100275047 3300005543 Bacteria 1423
119 Ga0070693_100009762 3300005547 Bacteria 4784
120 Ga0070665_100020315 3300005548 Bacteria 6670
121 Ga0070665_100645320 3300005548 Bacteria 1072
122 Ga0068855_100004288 3300005563 Bacteria 17424
123 Ga0068855_100029059 3300005563 Bacteria 6611
124 Ga0068855_100086305 3300005563 Bacteria 3629
125 Ga0068855_100112774 3300005563 Bacteria 3120
126 Ga0068855_100115015 3300005563 Bacteria 3084
127 Ga0068855_100218979 3300005563 Bacteria 2136
128 Ga0068855_100304823 3300005563 Bacteria 1763
129 Ga0070664_100000077 3300005564 Bacteria 62053
130 Ga0070664_100038310 3300005564 Bacteria 4035
131 Ga0070664_100060771 3300005564 Bacteria 3219
132 Ga0070664_100188368 3300005564 Bacteria 1837
133 Ga0070664_100570380 3300005564 Bacteria 1048
134 Ga0068857_100031248 3300005577 Bacteria 4705
135 Ga0068857_100039427 3300005577 Bacteria 4184
136 Ga0068857_100061493 3300005577 Bacteria 3336
137 Ga0068857_100139982 3300005577 Bacteria 2187
138 Ga0068857_100485973 3300005577 Bacteria 1157
139 Ga0068857_100757947 3300005577 Unclassified 925
140 Ga0068854_100155368 3300005578 Bacteria 1767
141 Ga0068854_100267911 3300005578 Bacteria 1370
142 Ga0068854_100403713 3300005578 Bacteria 1131
143 Ga0068856_100000444 3300005614 Bacteria 45674
144 Ga0068856_100286088 3300005614 Bacteria 1665
145 Ga0068856_100414348 3300005614 Bacteria 1367
146 Ga0070702_100222009 3300005615 Bacteria 1264
147 Ga0068852_100000350 3300005616 Bacteria 31032
148 Ga0068852_100021963 3300005616 Bacteria 5108
149 Ga0068852_100053062 3300005616 Bacteria 3488
150 Ga0068852_100221775 3300005616 Bacteria 1798
151 Ga0068852_100398527 3300005616 Bacteria 1353
152 Ga0068852_100419067 3300005616 Bacteria 1320
153 Ga0068859_100000965 3300005617 Bacteria 29425
154 Ga0068864_100019971 3300005618 Bacteria 5602
155 Ga0068864_100239248 3300005618 Bacteria 1682
156 Ga0068866_10255826 3300005718 Bacteria 1074
157 Ga0068861_100012250 3300005719 Bacteria 5980
158 Ga0068870_10026600 3300005840 Bacteria 2886
159 Ga0068862_100006991 3300005844 Bacteria 9367
160 Ga0068862_100051556 3300005844 Bacteria 3520
161 Ga0068871_100047543 3300006358 Bacteria 3461
162 Ga0068865_100051207 3300006881 Bacteria 2857
163 Ga0097620_100000965 3300006931 Bacteria 29425
164 Ga0105240_10023243 3300009093 Bacteria 8206
165 Ga0105240_10064049 3300009093 Bacteria 4570
166 Ga0111539_10058672 3300009094 Bacteria 4565
167 Ga0105241_10040097 3300009174 Bacteria 3534
168 Ga0105248_10000719 3300009177 Bacteria 37511
169 Ga0105248_10138128 3300009177 Bacteria 2749
170 Ga0105237_10142523 3300009545 Bacteria 2391
171 Ga0105238_10148900 3300009551 Bacteria 2316
172 Ga0105238_10158501 3300009551 Bacteria 2239
173 Ga0105238_10236138 3300009551 Bacteria 1805
174 Ga0105238_10465580 3300009551 Bacteria 1262
175 Ga0105249_10006738 3300009553 Bacteria 10007
176 Ga0105249_10031368 3300009553 Bacteria 4806
177 Ga0105239_10027029 3300010375 Bacteria 6316
178 Ga0157373_10014974 3300013100 Bacteria 5675
179 Ga0157373_10024591 3300013100 Bacteria 4362
180 Ga0157373_10056102 3300013100 Bacteria 2798
181 Ga0157373_10085452 3300013100 Bacteria 2224
182 Ga0157373_10126541 3300013100 Bacteria 1797
183 Ga0157373_10133294 3300013100 Bacteria 1747
184 Ga0157371_10006372 3300013102 Bacteria 9758
185 Ga0157371_10014286 3300013102 Bacteria 5998
186 Ga0157371_10015176 3300013102 Bacteria 5785
187 Ga0157371_10020851 3300013102 Bacteria 4820
188 Ga0157371_10054121 3300013102 Bacteria 2850
189 Ga0157371_10078304 3300013102 Bacteria 2342
190 Ga0157371_10088004 3300013102 Bacteria 2199
191 Ga0157370_10002746 3300013104 Bacteria 21034
192 Ga0157370_10055585 3300013104 Bacteria 3770
193 Ga0157370_10102855 3300013104 Bacteria 2674
194 Ga0157370_10104088 3300013104 Unclassified 2657
195 Ga0157370_10140845 3300013104 Bacteria 2247
196 Ga0157370_10197422 3300013104 Bacteria 1867
197 Ga0157370_10294394 3300013104 Bacteria 1499
198 Ga0157370_10412742 3300013104 Bacteria 1242
199 Ga0157370_10534876 3300013104 Bacteria 1075
200 Ga0157370_10550675 3300013104 Bacteria 1057
201 Ga0157370_10660127 3300013104 Bacteria 956
202 Ga0157369_10110449 3300013105 Bacteria 2923
203 Ga0157369_10186201 3300013105 Bacteria 2183
204 Ga0157369_10463535 3300013105 Bacteria 1312
205 Ga0157369_10474576 3300013105 Bacteria 1295
206 Ga0157374_10098361 3300013296 Bacteria 2801
207 Ga0157372_10206753 3300013307 Bacteria 2275
208 Ga0157372_10354482 3300013307 Bacteria 1710
209 Ga0157372_10368230 3300013307 Bacteria 1674
210 Ga0157372_10722643 3300013307 Bacteria 1158
211 Ga0163163_10000123 3300014325 Bacteria 82366
212 Ga0157377_10097935 3300014745 Bacteria 1742
213 Ga0157379_10067894 3300014968 Bacteria 3187
214 Ga0163161_10012032 3300017792 Bacteria 6000
215 Ga0163161_10070778 3300017792 Bacteria 2551
216 Ga0197907_11475149 3300020069 Bacteria 1062
217 Ga0206356_11890991 3300020070 Bacteria 1124
218 Ga0224712_10198876 3300022467 Bacteria 910
219 Ga0207697_10000510 3300025315 Bacteria 21916
220 Ga0207697_10026856 3300025315 Bacteria 2355
221 Ga0207656_10006890 3300025321 Bacteria 4115
222 Ga0207682_10000666 3300025893 Bacteria 16058
223 Ga0207682_10013947 3300025893 Bacteria 3130
224 Ga0207688_10015967 3300025901 Bacteria 4070
225 Ga0207680_10001021 3300025903 Bacteria 13204
226 Ga0207647_10024348 3300025904 Bacteria 3992
227 Ga0207647_10038573 3300025904 Bacteria 3019
228 Ga0207647_10078708 3300025904 Bacteria 1980
229 Ga0207647_10139641 3300025904 Bacteria 1420
230 Ga0207645_10194500 3300025907 Bacteria 1333
231 Ga0207705_10000086 3300025909 Bacteria 116132
232 Ga0207705_10005376 3300025909 Bacteria 9575
233 Ga0207705_10009927 3300025909 Bacteria 6932
234 Ga0207705_10014705 3300025909 Bacteria 5628
235 Ga0207705_10037883 3300025909 Bacteria 3450
236 Ga0207705_10045205 3300025909 Bacteria 3165
237 Ga0207705_10069043 3300025909 Bacteria 2559
238 Ga0207705_10077992 3300025909 Bacteria 2410
239 Ga0207705_10078951 3300025909 Bacteria 2396
240 Ga0207705_10088241 3300025909 Bacteria 2268
241 Ga0207705_10097045 3300025909 Bacteria 2164
242 Ga0207654_10050546 3300025911 Bacteria 2389
243 Ga0207707_10017647 3300025912 Bacteria 6225
244 Ga0207707_10018528 3300025912 Bacteria 6068
245 Ga0207707_10039480 3300025912 Bacteria 4125
246 Ga0207707_10170334 3300025912 Bacteria 1903
247 Ga0207707_10243312 3300025912 Unclassified 1564
248 Ga0207707_10480976 3300025912 Bacteria 1061
249 Ga0207707_10791025 3300025912 Bacteria 791
250 Ga0207695_10135710 3300025913 Bacteria 2414
251 Ga0207695_10536318 3300025913 Bacteria 1052
252 Ga0207671_10024193 3300025914 Bacteria 4570
253 Ga0207660_10000484 3300025917 Bacteria 26514
254 Ga0207660_10005214 3300025917 Bacteria 8441
255 Ga0207660_10115216 3300025917 Bacteria 2028
256 Ga0207657_10001020 3300025919 Bacteria 29724
257 Ga0207657_10003123 3300025919 Bacteria 17708
258 Ga0207657_10007415 3300025919 Bacteria 11248
259 Ga0207657_10007525 3300025919 Bacteria 11162
260 Ga0207657_10007627 3300025919 Bacteria 11074
261 Ga0207657_10075163 3300025919 Bacteria 2852
262 Ga0207657_10126661 3300025919 Bacteria 2097
263 Ga0207657_10340570 3300025919 Bacteria 1184
264 Ga0207649_10000420 3300025920 Bacteria 31171
265 Ga0207649_10081183 3300025920 Bacteria 2099
266 Ga0207649_10111983 3300025920 Bacteria 1825
267 Ga0207652_10014535 3300025921 Bacteria 6378
268 Ga0207652_10117069 3300025921 Bacteria 2367
269 Ga0207652_10308206 3300025921 Bacteria 1429
270 Ga0207652_10628537 3300025921 Bacteria 961
271 Ga0207681_10015791 3300025923 Bacteria 4713
272 Ga0207681_10066465 3300025923 Bacteria 2496
273 Ga0207681_10362848 3300025923 Bacteria 1162
274 Ga0207681_10404659 3300025923 Bacteria 1103
275 Ga0207694_10024170 3300025924 Bacteria 4614
276 Ga0207694_10134283 3300025924 Bacteria 1986
277 Ga0207694_10215136 3300025924 Bacteria 1566
278 Ga0207694_10386598 3300025924 Bacteria 1162
279 Ga0207650_10002896 3300025925 Bacteria 11844
280 Ga0207650_10003622 3300025925 Bacteria 10587
281 Ga0207659_10001181 3300025926 Bacteria 15609
282 Ga0207659_10029702 3300025926 Bacteria 3728
283 Ga0207659_10382284 3300025926 Bacteria 1174
284 Ga0207664_10600758 3300025929 Unclassified 988
285 Ga0207644_10029105 3300025931 Bacteria 3828
286 Ga0207644_10059535 3300025931 Bacteria 2762
287 Ga0207690_10000413 3300025932 Bacteria 27940
288 Ga0207690_10013977 3300025932 Bacteria 4838
289 Ga0207690_10014924 3300025932 Bacteria 4703
290 Ga0207690_10029270 3300025932 Bacteria 3499
291 Ga0207690_10060505 3300025932 Bacteria 2570
292 Ga0207690_10066579 3300025932 Bacteria 2468
293 Ga0207690_10126505 3300025932 Bacteria 1864
294 Ga0207690_10203823 3300025932 Bacteria 1504
295 Ga0207706_10000192 3300025933 Bacteria 68319
296 Ga0207706_10000341 3300025933 Bacteria 50615
297 Ga0207706_10000890 3300025933 Bacteria 30672
298 Ga0207706_10016273 3300025933 Bacteria 6718
299 Ga0207706_10054006 3300025933 Bacteria 3546
300 Ga0207669_10007915 3300025937 Bacteria 4956
301 Ga0207669_10023373 3300025937 Bacteria 3301
302 Ga0207704_10163822 3300025938 Bacteria 1585
303 Ga0207691_10000143 3300025940 Bacteria 65645
304 Ga0207691_10003939 3300025940 Bacteria 14420
305 Ga0207691_10139664 3300025940 Bacteria 2135
306 Ga0207711_10002038 3300025941 Bacteria 18270
307 Ga0207661_10013875 3300025944 Bacteria 5888
308 Ga0207661_10117633 3300025944 Bacteria 2258
309 Ga0207661_10170290 3300025944 Bacteria 1895
310 Ga0207661_10756720 3300025944 Bacteria 894
311 Ga0207679_10000347 3300025945 Bacteria 33719
312 Ga0207679_10038453 3300025945 Bacteria 3409
313 Ga0207679_10069570 3300025945 Bacteria 2649
314 Ga0207679_10074023 3300025945 Bacteria 2579
315 Ga0207679_10114299 3300025945 Bacteria 2137
316 Ga0207679_10242714 3300025945 Bacteria 1527
317 Ga0207679_10746425 3300025945 Bacteria 890
318 Ga0207679_10855822 3300025945 Bacteria 830
319 Ga0207667_10000850 3300025949 Bacteria 39399
320 Ga0207667_10009453 3300025949 Bacteria 11479
321 Ga0207667_10026676 3300025949 Bacteria 6306
322 Ga0207667_10087521 3300025949 Bacteria 3222
323 Ga0207667_10094354 3300025949 Bacteria 3089
324 Ga0207667_10139171 3300025949 Bacteria 2499
325 Ga0207667_10151223 3300025949 Bacteria 2389
326 Ga0207667_10287604 3300025949 Bacteria 1680
327 Ga0207667_10747411 3300025949 Bacteria 977
328 Ga0207651_10042807 3300025960 Bacteria 3017
329 Ga0207651_10469260 3300025960 Bacteria 1083
330 Ga0207668_10134292 3300025972 Bacteria 1894
331 Ga0207668_10169543 3300025972 Bacteria 1710
332 Ga0207668_10172393 3300025972 Bacteria 1698
333 Ga0207640_10003169 3300025981 Bacteria 8851
334 Ga0207640_10100002 3300025981 Bacteria 2031
335 Ga0207640_10860882 3300025981 Unclassified 789
336 Ga0207658_10004545 3300025986 Bacteria 9630
337 Ga0207658_10005150 3300025986 Bacteria 9003
338 Ga0207639_10000412 3300026041 Bacteria 29612
339 Ga0207639_10000923 3300026041 Bacteria 19909
340 Ga0207639_10006431 3300026041 Bacteria 7988
341 Ga0207639_10314586 3300026041 Bacteria 1388
342 Ga0207678_10001315 3300026067 Bacteria 22977
343 Ga0207678_10001460 3300026067 Bacteria 21690
344 Ga0207678_10008190 3300026067 Bacteria 9216
345 Ga0207678_10057346 3300026067 Bacteria 3351
346 Ga0207678_10078278 3300026067 Bacteria 2831
347 Ga0207678_10408434 3300026067 Bacteria 1176
348 Ga0207708_10052147 3300026075 Bacteria 3116
349 Ga0207702_10005023 3300026078 Bacteria 11624
350 Ga0207702_10037780 3300026078 Bacteria 4043
351 Ga0207702_10543024 3300026078 Bacteria 1136
352 Ga0207702_10795520 3300026078 Bacteria 934
353 Ga0207648_10177107 3300026089 Bacteria 1886
354 Ga0207674_10011239 3300026116 Bacteria 10061
355 Ga0207674_10048419 3300026116 Bacteria 4350
356 Ga0207674_10115084 3300026116 Bacteria 2661
357 Ga0207674_10161462 3300026116 Bacteria 2195
358 Ga0207675_100003414 3300026118 Bacteria 15508
359 Ga0207698_10000542 3300026142 Bacteria 21912
360 Ga0207698_10006737 3300026142 Bacteria 7176
361 Ga0207698_10008977 3300026142 Bacteria 6344
362 Ga0207698_10072971 3300026142 Bacteria 2731
363 Ga0207698_10075479 3300026142 Bacteria 2694
364 Ga0207698_10515881 3300026142 Bacteria 1165
365 Ga0268266_10013807 3300028379 Bacteria 6953
366 Ga0268266_10052662 3300028379 Bacteria 3495
367 Ga0268265_10011915 3300028380 Bacteria 5882
368 Ga0307408_100085128 3300031548 Bacteria 2373
369 Ga0307408_100235778 3300031548 Bacteria 1501
370 Ga0307408_100299242 3300031548 Bacteria 1347
371 Ga0307405_10073270 3300031731 Bacteria 2210
372 Ga0307405_10114280 3300031731 Bacteria 1834
373 Ga0307405_10184024 3300031731 Bacteria 1503
374 Ga0307405_10220884 3300031731 Bacteria 1390
375 Ga0307405_10306874 3300031731 Bacteria 1206
376 Ga0307405_10718472 3300031731 Bacteria 829
377 Ga0307405_10739185 3300031731 Bacteria 819
378 Ga0307413_10002467 3300031824 Bacteria 7526
379 Ga0307410_10000365 3300031852 Bacteria 17643
380 Ga0307410_10008560 3300031852 Bacteria 5683
381 Ga0307410_10022610 3300031852 Bacteria 3890
382 Ga0307410_10106632 3300031852 Bacteria 2019
383 Ga0307410_10136620 3300031852 Bacteria 1808
384 Ga0307410_10200657 3300031852 Bacteria 1522
385 Ga0307410_10239762 3300031852 Bacteria 1404
386 Ga0307410_10940230 3300031852 Bacteria 742
387 Ga0307406_10031025 3300031901 Bacteria 3251
388 Ga0307406_10197918 3300031901 Bacteria 1476
389 Ga0307406_10294181 3300031901 Bacteria 1244
390 Ga0307406_10786076 3300031901 Unclassified 802
391 Ga0307407_10015582 3300031903 Bacteria 3764
392 Ga0307407_10046458 3300031903 Bacteria 2458
393 Ga0307407_10072546 3300031903 Bacteria 2053
394 Ga0307407_10157345 3300031903 Bacteria 1483
395 Ga0307412_10059733 3300031911 Bacteria 2556
396 Ga0307412_10243413 3300031911 Bacteria 1392
397 Ga0307412_10259667 3300031911 Bacteria 1353
398 Ga0307409_100002524 3300031995 Bacteria 9590
399 Ga0307409_100010657 3300031995 Bacteria 5735
400 Ga0307409_100031807 3300031995 Bacteria 3815
401 Ga0307409_100088472 3300031995 Bacteria 2528
402 Ga0307409_100186023 3300031995 Bacteria 1844
403 Ga0307409_100186551 3300031995 Bacteria 1841
404 Ga0307409_100192319 3300031995 Bacteria 1817
405 Ga0307409_100218918 3300031995 Bacteria 1717
406 Ga0307409_100271524 3300031995 Bacteria 1562
407 Ga0307416_100030216 3300032002 Bacteria 4062
408 Ga0307416_100082836 3300032002 Bacteria 2719
409 Ga0307416_100452700 3300032002 Bacteria 1336
410 Ga0307416_100624899 3300032002 Bacteria 1159
411 Ga0307416_100681679 3300032002 Bacteria 1115
412 Ga0307416_100762649 3300032002 Bacteria 1061
413 Ga0307414_10027927 3300032004 Bacteria 3653
414 Ga0307414_10078895 3300032004 Bacteria 2401
415 Ga0307414_10082128 3300032004 Bacteria 2362
416 Ga0307414_10305175 3300032004 Bacteria 1348
417 Ga0307414_10329719 3300032004 Bacteria 1302
418 Ga0307414_10338528 3300032004 Bacteria 1287
419 Ga0307411_10000475 3300032005 Bacteria 13954
420 Ga0307411_10007285 3300032005 Bacteria 5616
421 Ga0307411_10015741 3300032005 Bacteria 4259
422 Ga0307411_10023791 3300032005 Bacteria 3637
423 Ga0307411_10026146 3300032005 Bacteria 3510
424 Ga0307411_10035297 3300032005 Bacteria 3121
425 Ga0307411_10071637 3300032005 Bacteria 2350
426 Ga0307411_10072606 3300032005 Bacteria 2337
427 Ga0307411_10511220 3300032005 Bacteria 1017
428 Ga0307415_100004164 3300032126 Bacteria 7461
429 Ga0307415_100030807 3300032126 Bacteria 3448
430 Ga0307415_100064142 3300032126 Bacteria 2555
431 Ga0307415_100080479 3300032126 Bacteria 2324
432 Ga0307415_100130152 3300032126 Bacteria 1903
433 Ga0307415_100170517 3300032126 Bacteria 1696
434 Ga0373930_0086657 3300034816 Unclassified 730
435 Ga0373952_0037297 3300035092 Bacteria 1108
436 Ga0373954_0033151 3300035118 Bacteria 2389
437 Ga0373931_0001320 3300035691 Bacteria 10617
438 Ga0373933_0051686 3300035724 Unclassified 2457
439 Ga0373937_0010753 3300036401 Bacteria 8007
440 Ga0395899_0000896 3300037312 Bacteria 28140
441 Ga0395899_0029513 3300037312 Bacteria 4125
442 Ga0395899_0063922 3300037312 Bacteria 2706
443 Ga0395899_0146888 3300037312 Bacteria 1673
444 Ga0395899_0455200 3300037312 Bacteria 837
445 Ga0395900_0000364 3300037418 Bacteria 65068
446 Ga0395900_0086544 3300037418 Bacteria 3220
447 Ga0395900_0136699 3300037418 Bacteria 2511
448 Ga0395900_0206366 3300037418 Bacteria 1986
449 Ga0395900_0337838 3300037418 Bacteria 1482
450 Ga0395900_0424619 3300037418 Bacteria 1290
451 Ga0395900_0434390 3300037418 Bacteria 1271
452 Ga0395900_0485130 3300037418 Bacteria 1188
453 Ga0395900_0508759 3300037418 Bacteria 1154
454 Ga0395900_0600292 3300037418 Bacteria 1041
455 Ga0395898_0021270 3300037466 Bacteria 6579
456 Ga0395898_0022695 3300037466 Bacteria 6352
457 Ga0395898_0027641 3300037466 Bacteria 5690
458 Ga0395898_0038262 3300037466 Bacteria 4755
459 Ga0395898_0043024 3300037466 Bacteria 4451
460 Ga0395898_0048782 3300037466 Bacteria 4150
461 Ga0395898_0090439 3300037466 Bacteria 2946
462 Ga0395905_0033437 3300037471 Bacteria 4830
463 Ga0395905_0034571 3300037471 Bacteria 4746
464 Ga0395905_0037384 3300037471 Bacteria 4558
465 Ga0395905_0040718 3300037471 Bacteria 4358
466 Ga0395905_0045504 3300037471 Bacteria 4116
467 Ga0395905_0067554 3300037471 Bacteria 3348
468 Ga0395905_0131132 3300037471 Bacteria 2357
469 Ga0395905_0151377 3300037471 Bacteria 2182
470 Ga0395905_0172660 3300037471 Bacteria 2030
471 Ga0395905_0651147 3300037471 Bacteria 955
472 Ga0395901_0000209 3300038443 Bacteria 73635
473 Ga0395901_0000782 3300038443 Bacteria 35570
474 Ga0395901_0004604 3300038443 Bacteria 13917
475 Ga0395901_0091744 3300038443 Bacteria 3179
476 Ga0395901_0116668 3300038443 Bacteria 2804
477 Ga0395901_0119453 3300038443 Bacteria 2770
478 Ga0395901_0210932 3300038443 Bacteria 2033
479 Ga0395901_0384312 3300038443 Bacteria 1444
480 Ga0395901_0404299 3300038443 Bacteria 1402
481 Ga0395901_0441129 3300038443 Bacteria 1332
482 Ga0395901_0508906 3300038443 Bacteria 1225
483 Ga0439432_010987 3300042006 Bacteria 3122
484 Ga0466966_0265170 3300044684 Bacteria 1034
485 Ga0466963_0006272 3300044694 Bacteria 7029
486 Ga0466963_0010200 3300044694 Bacteria 5681
487 Ga0466963_0201333 3300044694 Bacteria 1393
488 Ga0466957_0094903 3300044842 Bacteria 1873
489 Ga0466958_0426379 3300045836 Unclassified 858
490 Ga0466967_0064643 3300045976 Bacteria 3254
491 Ga0466967_0243665 3300045976 Bacteria 1715
492 Ga0466967_0448619 3300045976 Bacteria 1260
493 Ga0495663_0022466 3300046525 Bacteria 1822
494 Ga0495621_0002363 3300046539 Bacteria 5072
495 Ga0495659_0222431 3300046664 Bacteria 780
496 Ga0495659_0273927 3300046664 Bacteria 708
497 Ga0495623_0019538 3300046679 Bacteria 4378
498 Ga0495669_0000607 3300046684 Bacteria 15668
499 Ga0495669_0030005 3300046684 Bacteria 2387
500 Ga0495669_0160302 3300046684 Bacteria 1068
501 Ga0495670_0026835 3300046691 Bacteria 2851
502 Ga0495670_0054898 3300046691 Bacteria 1997
503 Ga0495677_0222027 3300047445 Unclassified 736
504 Ga0495602_0091257 3300048088 Bacteria 2527
505 Ga0495615_0029399 3300048090 Bacteria 1304
506 Ga0496101_0567976 3300048904 Bacteria 897
507 Ga0496109_0177330 3300048912 Bacteria 2001
508 Ga0496110_0008443 3300048913 Bacteria 8291
509 Ga0496111_0002149 3300048914 Bacteria 11793
510 Ga0496112_0158143 3300048915 Bacteria 2233
511 Ga0501268_005469 3300049765 Bacteria 1828
512 nmdc:mga0n895_596274_c1 3300050512 Bacteria 1107
513 Ga0495612_0104101 3300053078 Bacteria 1210
514 Ga0587088_044797 3300059508 Unclassified 846
515 Ga0587090_058086 3300059510 Unclassified 727
516 Ga0587075_050401 3300059644 Unclassified 725
517 Ga0466962_0006344 3300061719 Bacteria 5677
518 Ga0466962_0083530 3300061719 Bacteria 1528
519 Ga0466962_0098440 3300061719 Bacteria 1404
520 2896432007 2896429255 Bacteria 2557483
521 Ga0587076_068928
522 JGI24741J21665_1000578
523 JGI24740J21852_10018280
524 JGI24740J21852_10054594
525 JGI24739J22299_10003228
526 JGI24739J22299_10006424
527 JGI24739J22299_10039060
528 JGI24737J22298_10000987
529 JGI24737J22298_10005144
530 JGI24735J21928_10010414
531 JGI24735J21928_10014734
532 JGI24738J21930_10003272
533 Ga0065714_10107729
534 Ga0065712_10097823
535 Ga0070658_10000269
536 Ga0070658_10009873
537 Ga0070658_10039807
538 Ga0070658_10055450
539 Ga0070658_10066799
540 Ga0070658_10137343
541 Ga0070658_10172122
542 Ga0070676_10055359
543 Ga0070676_10171710
544 Ga0070683_100001138
545 Ga0070683_100009832
546 Ga0070683_100057299
547 Ga0070683_100222484
548 Ga0070683_100230585
549 Ga0070683_100444940
550 Ga0070690_100323523
551 Ga0070670_100000632
552 Ga0070670_100020883
553 Ga0070670_100106381
554 Ga0070677_10004813
555 Ga0070677_10026523
556 Ga0070666_10000330
557 Ga0070666_10379841
558 Ga0070680_100017872
559 Ga0070680_100108509
560 Ga0070682_100014847
561 Ga0070682_100139802
562 Ga0068868_100595208
563 Ga0070660_100000109
564 Ga0070660_100008282
565 Ga0070660_100011109
566 Ga0070660_100104882
567 Ga0070660_100317374
568 Ga0070691_10053368
569 Ga0070661_100000070
570 Ga0070661_100033437
571 Ga0070661_100126363
572 Ga0070661_100168464
573 Ga0070661_100428698
574 Ga0070661_100453188
575 Ga0070661_100506785
576 Ga0070692_10010960
577 Ga0070692_10013273
578 Ga0070692_10013980
579 Ga0070692_10400295
580 Ga0070668_100024705
581 Ga0070669_100025316
582 Ga0070669_100117296
583 Ga0070669_100383983
584 Ga0070669_100568489
585 Ga0070675_100001534
586 Ga0070675_100015032
587 Ga0070675_100079731
588 Ga0070675_100226009
589 Ga0070671_100001248
590 Ga0070671_100005801
591 Ga0070671_100012010
592 Ga0070671_100307158
593 Ga0070674_100011729
594 Ga0070673_100366577
595 Ga0070659_100000312
596 Ga0070659_100025887
597 Ga0070659_100041705
598 Ga0070659_100074427
599 Ga0070659_100200329
600 Ga0070667_100021289
601 Ga0070714_100364312
602 Ga0070713_100627132
603 Ga0070705_100340334
604 Ga0070663_100005850
605 Ga0070663_100025115
606 Ga0070663_100026090
607 Ga0070663_100095784
608 Ga0070663_100275290
609 Ga0070663_100402851
610 Ga0070678_100017727
611 Ga0070662_100000037
612 Ga0070662_100000256
613 Ga0070662_100008309
614 Ga0070662_100008480
615 Ga0070662_100028447
616 Ga0070662_100109917
617 Ga0070662_100122792
618 Ga0070681_10095915
619 Ga0070681_10135295
620 Ga0070681_10178777
621 Ga0070681_10193536
622 Ga0070681_10587075
623 Ga0068867_100015138
624 Ga0070679_100007863
625 Ga0070679_100017940
626 Ga0070679_100089715
627 Ga0070679_100151773
628 Ga0070679_100191533
629 Ga0070679_100332814
630 Ga0070684_100074365
631 Ga0068853_100000309
632 Ga0068853_100041268
633 Ga0068853_100306820
634 Ga0068853_100339904
635 Ga0068853_100505382
636 Ga0070672_100000621
637 Ga0070672_100002117
638 Ga0070672_100275047
639 Ga0070693_100009762
640 Ga0070665_100020315
641 Ga0070665_100645320
642 Ga0068855_100004288
643 Ga0068855_100029059
644 Ga0068855_100086305
645 Ga0068855_100112774
646 Ga0068855_100115015
647 Ga0068855_100218979
648 Ga0068855_100304823
649 Ga0070664_100000077
650 Ga0070664_100038310
651 Ga0070664_100060771
652 Ga0070664_100188368
653 Ga0070664_100570380
654 Ga0068857_100031248
655 Ga0068857_100039427
656 Ga0068857_100061493
657 Ga0068857_100139982
658 Ga0068857_100485973
659 Ga0068857_100757947
660 Ga0068854_100155368
661 Ga0068854_100267911
662 Ga0068854_100403713
663 Ga0068856_100000444
664 Ga0068856_100286088
665 Ga0068856_100414348
666 Ga0070702_100222009
667 Ga0068852_100000350
668 Ga0068852_100021963
669 Ga0068852_100053062
670 Ga0068852_100221775
671 Ga0068852_100398527
672 Ga0068852_100419067
673 Ga0068859_100000965
674 Ga0068864_100019971
675 Ga0068864_100239248
676 Ga0068866_10255826
677 Ga0068861_100012250
678 Ga0068870_10026600
679 Ga0068862_100006991
680 Ga0068862_100051556
681 Ga0068871_100047543
682 Ga0068865_100051207
683 Ga0097620_100000965
684 Ga0105240_10023243
685 Ga0105240_10064049
686 Ga0111539_10058672
687 Ga0105241_10040097
688 Ga0105248_10000719
689 Ga0105248_10138128
690 Ga0105237_10142523
691 Ga0105238_10148900
692 Ga0105238_10158501
693 Ga0105238_10236138
694 Ga0105238_10465580
695 Ga0105249_10006738
696 Ga0105249_10031368
697 Ga0105239_10027029
698 Ga0157373_10014974
699 Ga0157373_10024591
700 Ga0157373_10056102
701 Ga0157373_10085452
702 Ga0157373_10126541
703 Ga0157373_10133294
704 Ga0157371_10006372
705 Ga0157371_10014286
706 Ga0157371_10015176
707 Ga0157371_10020851
708 Ga0157371_10054121
709 Ga0157371_10078304
710 Ga0157371_10088004
711 Ga0157370_10002746
712 Ga0157370_10055585
713 Ga0157370_10102855
714 Ga0157370_10104088
715 Ga0157370_10140845
716 Ga0157370_10197422
717 Ga0157370_10294394
718 Ga0157370_10412742
719 Ga0157370_10534876
720 Ga0157370_10550675
721 Ga0157370_10660127
722 Ga0157369_10110449
723 Ga0157369_10186201
724 Ga0157369_10463535
725 Ga0157369_10474576
726 Ga0157374_10098361
727 Ga0157372_10206753
728 Ga0157372_10354482
729 Ga0157372_10368230
730 Ga0157372_10722643
731 Ga0163163_10000123
732 Ga0157377_10097935
733 Ga0157379_10067894
734 Ga0163161_10012032
735 Ga0163161_10070778
736 Ga0197907_11475149
737 Ga0206356_11890991
738 Ga0224712_10198876
739 Ga0207697_10000510
740 Ga0207697_10026856
741 Ga0207656_10006890
742 Ga0207682_10000666
743 Ga0207682_10013947
744 Ga0207688_10015967
745 Ga0207680_10001021
746 Ga0207647_10024348
747 Ga0207647_10038573
748 Ga0207647_10078708
749 Ga0207647_10139641
750 Ga0207645_10194500
751 Ga0207705_10000086
752 Ga0207705_10005376
753 Ga0207705_10009927
754 Ga0207705_10014705
755 Ga0207705_10037883
756 Ga0207705_10045205
757 Ga0207705_10069043
758 Ga0207705_10077992
759 Ga0207705_10078951
760 Ga0207705_10088241
761 Ga0207705_10097045
762 Ga0207654_10050546
763 Ga0207707_10017647
764 Ga0207707_10018528
765 Ga0207707_10039480
766 Ga0207707_10170334
767 Ga0207707_10243312
768 Ga0207707_10480976
769 Ga0207707_10791025
770 Ga0207695_10135710
771 Ga0207695_10536318
772 Ga0207671_10024193
773 Ga0207660_10000484
774 Ga0207660_10005214
775 Ga0207660_10115216
776 Ga0207657_10001020
777 Ga0207657_10003123
778 Ga0207657_10007415
779 Ga0207657_10007525
780 Ga0207657_10007627
781 Ga0207657_10075163
782 Ga0207657_10126661
783 Ga0207657_10340570
784 Ga0207649_10000420
785 Ga0207649_10081183
786 Ga0207649_10111983
787 Ga0207652_10014535
788 Ga0207652_10117069
789 Ga0207652_10308206
790 Ga0207652_10628537
791 Ga0207681_10015791
792 Ga0207681_10066465
793 Ga0207681_10362848
794 Ga0207681_10404659
795 Ga0207694_10024170
796 Ga0207694_10134283
797 Ga0207694_10215136
798 Ga0207694_10386598
799 Ga0207650_10002896
800 Ga0207650_10003622
801 Ga0207659_10001181
802 Ga0207659_10029702
803 Ga0207659_10382284
804 Ga0207664_10600758
805 Ga0207644_10029105
806 Ga0207644_10059535
807 Ga0207690_10000413
808 Ga0207690_10013977
809 Ga0207690_10014924
810 Ga0207690_10029270
811 Ga0207690_10060505
812 Ga0207690_10066579
813 Ga0207690_10126505
814 Ga0207690_10203823
815 Ga0207706_10000192
816 Ga0207706_10000341
817 Ga0207706_10000890
818 Ga0207706_10016273
819 Ga0207706_10054006
820 Ga0207669_10007915
821 Ga0207669_10023373
822 Ga0207704_10163822
823 Ga0207691_10000143
824 Ga0207691_10003939
825 Ga0207691_10139664
826 Ga0207711_10002038
827 Ga0207661_10013875
828 Ga0207661_10117633
829 Ga0207661_10170290
830 Ga0207661_10756720
831 Ga0207679_10000347
832 Ga0207679_10038453
833 Ga0207679_10069570
834 Ga0207679_10074023
835 Ga0207679_10114299
836 Ga0207679_10242714
837 Ga0207679_10746425
838 Ga0207679_10855822
839 Ga0207667_10000850
840 Ga0207667_10009453
841 Ga0207667_10026676
842 Ga0207667_10087521
843 Ga0207667_10094354
844 Ga0207667_10139171
845 Ga0207667_10151223
846 Ga0207667_10287604
847 Ga0207667_10747411
848 Ga0207651_10042807
849 Ga0207651_10469260
850 Ga0207668_10134292
851 Ga0207668_10169543
852 Ga0207668_10172393
853 Ga0207640_10003169
854 Ga0207640_10100002
855 Ga0207640_10860882
856 Ga0207658_10004545
857 Ga0207658_10005150
858 Ga0207639_10000412
859 Ga0207639_10000923
860 Ga0207639_10006431
861 Ga0207639_10314586
862 Ga0207678_10001315
863 Ga0207678_10001460
864 Ga0207678_10008190
865 Ga0207678_10057346
866 Ga0207678_10078278
867 Ga0207678_10408434
868 Ga0207708_10052147
869 Ga0207702_10005023
870 Ga0207702_10037780
871 Ga0207702_10543024
872 Ga0207702_10795520
873 Ga0207648_10177107
874 Ga0207674_10011239
875 Ga0207674_10048419
876 Ga0207674_10115084
877 Ga0207674_10161462
878 Ga0207675_100003414
879 Ga0207698_10000542
880 Ga0207698_10006737
881 Ga0207698_10008977
882 Ga0207698_10072971
883 Ga0207698_10075479
884 Ga0207698_10515881
885 Ga0268266_10013807
886 Ga0268266_10052662
887 Ga0268265_10011915
888 Ga0307408_100085128
889 Ga0307408_100235778
890 Ga0307408_100299242
891 Ga0307405_10073270
892 Ga0307405_10114280
893 Ga0307405_10184024
894 Ga0307405_10220884
895 Ga0307405_10306874
896 Ga0307405_10718472
897 Ga0307405_10739185
898 Ga0307413_10002467
899 Ga0307410_10000365
900 Ga0307410_10008560
901 Ga0307410_10022610
902 Ga0307410_10106632
903 Ga0307410_10136620
904 Ga0307410_10200657
905 Ga0307410_10239762
906 Ga0307410_10940230
907 Ga0307406_10031025
908 Ga0307406_10197918
909 Ga0307406_10294181
910 Ga0307406_10786076
911 Ga0307407_10015582
912 Ga0307407_10046458
913 Ga0307407_10072546
914 Ga0307407_10157345
915 Ga0307412_10059733
916 Ga0307412_10243413
917 Ga0307412_10259667
918 Ga0307409_100002524
919 Ga0307409_100010657
920 Ga0307409_100031807
921 Ga0307409_100088472
922 Ga0307409_100186023
923 Ga0307409_100186551
924 Ga0307409_100192319
925 Ga0307409_100218918
926 Ga0307409_100271524
927 Ga0307416_100030216
928 Ga0307416_100082836
929 Ga0307416_100452700
930 Ga0307416_100624899
931 Ga0307416_100681679
932 Ga0307416_100762649
933 Ga0307414_10027927
934 Ga0307414_10078895
935 Ga0307414_10082128
936 Ga0307414_10305175
937 Ga0307414_10329719
938 Ga0307414_10338528
939 Ga0307411_10000475
940 Ga0307411_10007285
941 Ga0307411_10015741
942 Ga0307411_10023791
943 Ga0307411_10026146
944 Ga0307411_10035297
945 Ga0307411_10071637
946 Ga0307411_10072606
947 Ga0307411_10511220
948 Ga0307415_100004164
949 Ga0307415_100030807
950 Ga0307415_100064142
951 Ga0307415_100080479
952 Ga0307415_100130152
953 Ga0307415_100170517
954 Ga0373930_0086657
955 Ga0373952_0037297
956 Ga0373954_0033151
957 Ga0373931_0001320
958 Ga0373933_0051686
959 Ga0373937_0010753
960 Ga0395899_0000896
961 Ga0395899_0029513
962 Ga0395899_0063922
963 Ga0395899_0146888
964 Ga0395899_0455200
965 Ga0395900_0000364
966 Ga0395900_0086544
967 Ga0395900_0136699
968 Ga0395900_0206366
969 Ga0395900_0337838
970 Ga0395900_0424619
971 Ga0395900_0434390
972 Ga0395900_0485130
973 Ga0395900_0508759
974 Ga0395900_0600292
975 Ga0395898_0021270
976 Ga0395898_0022695
977 Ga0395898_0027641
978 Ga0395898_0038262
979 Ga0395898_0043024
980 Ga0395898_0048782
981 Ga0395898_0090439
982 Ga0395905_0033437
983 Ga0395905_0034571
984 Ga0395905_0037384
985 Ga0395905_0040718
986 Ga0395905_0045504
987 Ga0395905_0067554
988 Ga0395905_0131132
989 Ga0395905_0151377
990 Ga0395905_0172660
991 Ga0395905_0651147
992 Ga0395901_0000209
993 Ga0395901_0000782
994 Ga0395901_0004604
995 Ga0395901_0091744
996 Ga0395901_0116668
997 Ga0395901_0119453
998 Ga0395901_0210932
999 Ga0395901_0384312
1000 Ga0395901_0404299
1001 Ga0395901_0441129
1002 Ga0395901_0508906
1003 Ga0439432_010987
1004 Ga0466966_0265170
1005 Ga0466963_0006272
1006 Ga0466963_0010200
1007 Ga0466963_0201333
1008 Ga0466957_0094903
1009 Ga0466958_0426379
1010 Ga0466967_0064643
1011 Ga0466967_0243665
1012 Ga0466967_0448619
1013 Ga0495663_0022466
1014 Ga0495621_0002363
1015 Ga0495659_0222431
1016 Ga0495659_0273927
1017 Ga0495623_0019538
1018 Ga0495669_0000607
1019 Ga0495669_0030005
1020 Ga0495669_0160302
1021 Ga0495670_0026835
1022 Ga0495670_0054898
1023 Ga0495677_0222027
1024 Ga0495602_0091257
1025 Ga0495615_0029399
1026 Ga0496101_0567976
1027 Ga0496109_0177330
1028 Ga0496110_0008443
1029 Ga0496111_0002149
1030 Ga0496112_0158143
1031 Ga0501268_005469
1032 nmdc:mga0n895_596274_c1
1033 Ga0495612_0104101
1034 Ga0587088_044797
1035 Ga0587090_058086
1036 Ga0587075_050401
1037 Ga0466962_0006344
1038 Ga0466962_0083530
1039 Ga0466962_0098440
1040 2896432007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13645

YkuD_2

L,D-transpeptidase catalytic domain

43

207

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gsq-assembly1.cif.gz_A structural basis for the inhibition of mycobacterium tuberculosis l,d-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains 0.7374 71 216
4zfq-assembly1.cif.gz_A structure of m. tuberculosis (3,3) l,d-transpeptidase, ldtmt5. (meropenen-adduct form) 0.7082 69 214
4qrb-assembly1.cif.gz_A structure and specificity of l-d-transpeptidase from mycobacterium tuberculosis and antibiotic resistance: calcium binding promotes dimer formation 0.6942 71 214
5uwv-assembly3.cif.gz_D crystal structure of mycobacterium abscessus l,d-transpeptidase 2 0.6848 71 215
6d5a-assembly1.cif.gz_A crystal structure of l,d-transpeptidase 5 from mycobacterium tuberculosis in apo form 0.6824 69 216
ID Description Score Start End Superfamily
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.7135 71 214 2.40.440.10
6d5aA03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.6834 70 216 2.40.440.10
4a1iC02 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.6707 71 214 2.40.440.10
5uwvD03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.6642 71 215 2.40.440.10
6d5aA03 Mainly Beta;Beta Barrel;L,D-transpeptidase catalytic domain-like;L,D-transpeptidase catalytic domain-like 0.63 70 216 2.40.440.10
ID Description Score Start End GO Terms
AF-A0A520HQ53-F1-model_v4 Transcriptional initiation protein Tat 0.9415 131 215
AF-A0A520HQ53-F1-model_v4 Transcriptional initiation protein Tat 0.9209 131 215
AF-A0A4Q3HS33-F1-model_v4 Murein L,D-transpeptidase catalytic domain family protein 0.9163 56 215
AF-A0A561HGR4-F1-model_v4 deleted 0.9128 50 216
AF-A0A7W9CHE8-F1-model_v4 Twin-arginine translocation pathway signal 0.9123 56 214

Map