F458565

General Info

Members Datasets Scaffolds Average Seq Length
520 212 520 218

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0295250|Ga0395899_0295250_433_1083
Length 216
Sequence MTSPASPIVIAVDGPAASGKGTIARALAKHYGLPHMDTGMLYRAVALTMFRFGGDPASEFEAVRACEGTPQVDPTDPDLRTEIVSSIASRISAYPAVRAALLQRQQAFASQASGAVLDGRDIGTVIAPHATAKLFVTASPEVRARRRVAELLKRGMPAHYEDVLIDIRARDERDSKRDAAPLVQADDADLLDTSEMDIDEAIAAAIALVEAKIGAN

Samples

Sample ID Description Type Environment
1 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
165 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
166 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
167 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
173 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
174 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
175 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
176 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
187 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
211 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 5
Rhizosphere 92.5
Stem 0
Stem Tuber 0
Unclassified 1.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24747J21853_1001580 3300001978 Bacteria 1734
2 JGI24739J22299_10008945 3300001989 Bacteria 3736
3 JGI24737J22298_10026431 3300001990 Bacteria 1833
4 JGI24735J21928_10031377 3300002067 Bacteria 1575
5 JGI24735J21928_10035780 3300002067 Bacteria 1458
6 JGI24735J21928_10040219 3300002067 Bacteria 1366
7 JGI24745J21846_1002754 3300002073 Bacteria 1812
8 JGI24738J21930_10018195 3300002075 Bacteria 1470
9 JGI24744J21845_10000287 3300002077 Bacteria 8385
10 rootH1_10208177 3300003323 Bacteria 1327
11 Ga0070658_10026100 3300005327 Bacteria 4686
12 Ga0070658_10033381 3300005327 Bacteria 4140
13 Ga0070658_10076276 3300005327 Bacteria 2749
14 Ga0070658_10142407 3300005327 Bacteria 2003
15 Ga0070658_10577640 3300005327 Bacteria 973
16 Ga0070658_10710753 3300005327 Bacteria 872
17 Ga0070676_10046893 3300005328 Bacteria 2521
18 Ga0070683_100295705 3300005329 Bacteria 1540
19 Ga0070690_100045194 3300005330 Bacteria 2797
20 Ga0070690_100052565 3300005330 Bacteria 2604
21 Ga0070670_100030359 3300005331 Bacteria 4655
22 Ga0070670_100124951 3300005331 Bacteria 2221
23 Ga0070670_100181430 3300005331 Bacteria 1828
24 Ga0070670_100279175 3300005331 Bacteria 1459
25 Ga0068869_100059083 3300005334 Bacteria 2806
26 Ga0070666_10007245 3300005335 Bacteria 6839
27 Ga0070666_10018022 3300005335 Bacteria 4533
28 Ga0070666_10018242 3300005335 Bacteria 4508
29 Ga0070682_100354673 3300005337 Bacteria 1095
30 Ga0068868_100000237 3300005338 Bacteria 37449
31 Ga0068868_100006807 3300005338 Bacteria 8117
32 Ga0068868_100299968 3300005338 Bacteria 1364
33 Ga0070660_100003366 3300005339 Bacteria 10999
34 Ga0070660_100102984 3300005339 Bacteria 2263
35 Ga0070660_100179609 3300005339 Bacteria 1712
36 Ga0070660_100227333 3300005339 Bacteria 1517
37 Ga0070660_100434711 3300005339 Bacteria 1087
38 Ga0070689_100099347 3300005340 Bacteria 2303
39 Ga0070689_100451579 3300005340 Bacteria 1094
40 Ga0070661_100007217 3300005344 Bacteria 7661
41 Ga0070661_100043546 3300005344 Bacteria 3279
42 Ga0070661_100051844 3300005344 Bacteria 3003
43 Ga0070661_100109566 3300005344 Bacteria 2061
44 Ga0070692_10036947 3300005345 Bacteria 2481
45 Ga0070668_100006254 3300005347 Bacteria 8821
46 Ga0070668_100073903 3300005347 Bacteria 2659
47 Ga0070668_100145703 3300005347 Bacteria 1912
48 Ga0070668_100328395 3300005347 Bacteria 1289
49 Ga0070668_100336378 3300005347 Bacteria 1275
50 Ga0070669_100165589 3300005353 Bacteria 1721
51 Ga0070675_100087001 3300005354 Bacteria 2613
52 Ga0070675_100092888 3300005354 Bacteria 2530
53 Ga0070671_100013668 3300005355 Bacteria 6547
54 Ga0070671_100014207 3300005355 Bacteria 6430
55 Ga0070671_100015603 3300005355 Bacteria 6138
56 Ga0070671_100045988 3300005355 Bacteria 3629
57 Ga0070671_100077208 3300005355 Bacteria 2783
58 Ga0070671_100166042 3300005355 Bacteria 1866
59 Ga0070671_100218283 3300005355 Bacteria 1618
60 Ga0070674_100006593 3300005356 Bacteria 6786
61 Ga0070674_100006617 3300005356 Bacteria 6775
62 Ga0070674_100031836 3300005356 Bacteria 3499
63 Ga0070674_100032380 3300005356 Bacteria 3472
64 Ga0070673_100008272 3300005364 Bacteria 6909
65 Ga0070673_100013344 3300005364 Bacteria 5679
66 Ga0070673_100090533 3300005364 Bacteria 2499
67 Ga0070673_100168440 3300005364 Bacteria 1868
68 Ga0070673_100504370 3300005364 Bacteria 1095
69 Ga0070659_100023121 3300005366 Bacteria 4752
70 Ga0070659_100143512 3300005366 Bacteria 1944
71 Ga0070659_100149803 3300005366 Bacteria 1903
72 Ga0070659_100214018 3300005366 Bacteria 1589
73 Ga0070659_100248607 3300005366 Bacteria 1473
74 Ga0070667_100040495 3300005367 Bacteria 3907
75 Ga0070667_100122321 3300005367 Bacteria 2265
76 Ga0070667_100334121 3300005367 Bacteria 1369
77 Ga0070667_100385435 3300005367 Bacteria 1274
78 Ga0070667_100634877 3300005367 Bacteria 985
79 Ga0070667_100832733 3300005367 Bacteria 857
80 Ga0070714_100042688 3300005435 Bacteria 3832
81 Ga0070714_100374999 3300005435 Bacteria 1340
82 Ga0070713_100056520 3300005436 Bacteria 3264
83 Ga0070694_100167802 3300005444 Bacteria 1615
84 Ga0070663_100007211 3300005455 Bacteria 6753
85 Ga0070663_100021827 3300005455 Bacteria 4265
86 Ga0070663_100025599 3300005455 Bacteria 3986
87 Ga0070663_100061842 3300005455 Bacteria 2698
88 Ga0070663_100101244 3300005455 Bacteria 2150
89 Ga0070678_100021464 3300005456 Bacteria 4258
90 Ga0070678_100055768 3300005456 Bacteria 2886
91 Ga0070662_100003264 3300005457 Bacteria 10090
92 Ga0070662_100286832 3300005457 Bacteria 1333
93 Ga0070662_100302892 3300005457 Bacteria 1299
94 Ga0070662_101095666 3300005457 Bacteria 683
95 Ga0070681_10531807 3300005458 Unclassified 1089
96 Ga0068867_100002869 3300005459 Bacteria 12129
97 Ga0068867_100058279 3300005459 Bacteria 2862
98 Ga0068867_100145751 3300005459 Bacteria 1855
99 Ga0068867_100154331 3300005459 Bacteria 1806
100 Ga0070685_10135386 3300005466 Bacteria 1545
101 Ga0070706_100248834 3300005467 Bacteria 1660
102 Ga0070679_100439976 3300005530 Bacteria 1249
103 Ga0068853_100036747 3300005539 Bacteria 4166
104 Ga0068853_100079809 3300005539 Bacteria 2862
105 Ga0070672_100000482 3300005543 Bacteria 23162
106 Ga0070672_100085728 3300005543 Bacteria 2532
107 Ga0070672_100118015 3300005543 Bacteria 2169
108 Ga0070672_100247642 3300005543 Bacteria 1500
109 Ga0070672_100851320 3300005543 Bacteria 804
110 Ga0070672_100879626 3300005543 Bacteria 791
111 Ga0070686_100129525 3300005544 Bacteria 1743
112 Ga0070695_100023104 3300005545 Bacteria 3818
113 Ga0070696_100006532 3300005546 Bacteria 7787
114 Ga0070693_100205124 3300005547 Bacteria 1283
115 Ga0070693_100318725 3300005547 Bacteria 1054
116 Ga0070665_100016225 3300005548 Bacteria 7473
117 Ga0070665_100138768 3300005548 Bacteria 2434
118 Ga0068855_100127353 3300005563 Bacteria 2911
119 Ga0068855_100853875 3300005563 Bacteria 964
120 Ga0070664_100030419 3300005564 Bacteria 4505
121 Ga0070664_100038109 3300005564 Bacteria 4045
122 Ga0070664_100141257 3300005564 Bacteria 2120
123 Ga0070664_100191258 3300005564 Bacteria 1823
124 Ga0068857_100332360 3300005577 Bacteria 1405
125 Ga0068854_100015826 3300005578 Bacteria 5010
126 Ga0068854_100091847 3300005578 Bacteria 2260
127 Ga0068854_100366947 3300005578 Bacteria 1183
128 Ga0068856_100042138 3300005614 Bacteria 4490
129 Ga0068856_100278743 3300005614 Bacteria 1689
130 Ga0068856_100334270 3300005614 Bacteria 1533
131 Ga0068852_100012312 3300005616 Bacteria 6489
132 Ga0068852_100036248 3300005616 Bacteria 4125
133 Ga0068852_100074676 3300005616 Bacteria 2987
134 Ga0068852_100093094 3300005616 Bacteria 2700
135 Ga0068852_100242350 3300005616 Bacteria 1724
136 Ga0068859_100003354 3300005617 Bacteria 16292
137 Ga0068859_100014674 3300005617 Bacteria 7873
138 Ga0068859_100069745 3300005617 Bacteria 3550
139 Ga0068859_100106596 3300005617 Bacteria 2862
140 Ga0068859_100552657 3300005617 Bacteria 1246
141 Ga0068864_100089105 3300005618 Bacteria 2718
142 Ga0068864_100098577 3300005618 Bacteria 2589
143 Ga0068866_10004001 3300005718 Bacteria 6053
144 Ga0068866_10005219 3300005718 Bacteria 5352
145 Ga0068866_10131801 3300005718 Bacteria 1423
146 Ga0068861_100203868 3300005719 Bacteria 1662
147 Ga0068851_10003876 3300005834 Bacteria 6697
148 Ga0068851_10009411 3300005834 Bacteria 4543
149 Ga0068870_10033540 3300005840 Bacteria 2620
150 Ga0068870_10131204 3300005840 Bacteria 1456
151 Ga0068863_100001961 3300005841 Bacteria 20447
152 Ga0068863_100138621 3300005841 Bacteria 2324
153 Ga0068863_100264835 3300005841 Bacteria 1662
154 Ga0068858_100001063 3300005842 Bacteria 28439
155 Ga0068858_100080260 3300005842 Bacteria 3031
156 Ga0068858_100549613 3300005842 Bacteria 1118
157 Ga0068860_100100415 3300005843 Bacteria 2761
158 Ga0068860_100147325 3300005843 Bacteria 2265
159 Ga0068860_101177625 3300005843 Bacteria 786
160 Ga0068862_100005659 3300005844 Bacteria 10428
161 Ga0068862_100264722 3300005844 Bacteria 1570
162 Ga0068862_100759856 3300005844 Bacteria 944
163 Ga0070717_10028934 3300006028 Bacteria 4441
164 Ga0075365_10330841 3300006038 Bacteria 1073
165 Ga0070716_100030809 3300006173 Bacteria 2914
166 Ga0070712_100010413 3300006175 Bacteria 5866
167 Ga0097621_100104514 3300006237 Bacteria 2387
168 Ga0097621_100827397 3300006237 Bacteria 859
169 Ga0068871_100013156 3300006358 Bacteria 6136
170 Ga0068865_100004584 3300006881 Bacteria 8340
171 Ga0068865_100277693 3300006881 Bacteria 1333
172 Ga0097620_100003354 3300006931 Bacteria 16292
173 Ga0097620_100014673 3300006931 Bacteria 7873
174 Ga0097620_100069748 3300006931 Bacteria 3550
175 Ga0097620_100106595 3300006931 Bacteria 2862
176 Ga0097620_100552648 3300006931 Bacteria 1246
177 Ga0105240_10373909 3300009093 Bacteria 1611
178 Ga0105245_10017352 3300009098 Bacteria 6280
179 Ga0105245_10019353 3300009098 Bacteria 5961
180 Ga0114129_10593315 3300009147 Bacteria 1436
181 Ga0105243_10244968 3300009148 Bacteria 1597
182 Ga0105242_10002696 3300009176 Bacteria 13894
183 Ga0105242_10296319 3300009176 Bacteria 1474
184 Ga0105248_10057467 3300009177 Bacteria 4367
185 Ga0105248_10097345 3300009177 Bacteria 3315
186 Ga0105248_10123267 3300009177 Bacteria 2924
187 Ga0105248_10150526 3300009177 Bacteria 2625
188 Ga0105248_10200160 3300009177 Bacteria 2250
189 Ga0105248_10239202 3300009177 Bacteria 2044
190 Ga0105248_10285213 3300009177 Bacteria 1859
191 Ga0105248_10495441 3300009177 Bacteria 1377
192 Ga0105248_11442376 3300009177 Bacteria 779
193 Ga0105237_10554693 3300009545 Bacteria 1156
194 Ga0105238_10074784 3300009551 Bacteria 3380
195 Ga0105238_10281994 3300009551 Bacteria 1643
196 Ga0105238_10389906 3300009551 Bacteria 1385
197 Ga0105239_10046622 3300010375 Bacteria 4749
198 Ga0157373_10119369 3300013100 Bacteria 1853
199 Ga0157373_10187142 3300013100 Bacteria 1459
200 Ga0157371_10005796 3300013102 Bacteria 10340
201 Ga0157371_10261242 3300013102 Bacteria 1248
202 Ga0157370_10086037 3300013104 Bacteria 2954
203 Ga0157370_10339489 3300013104 Bacteria 1385
204 Ga0157369_10206595 3300013105 Bacteria 2059
205 Ga0157374_10000688 3300013296 Bacteria 29808
206 Ga0157374_10018582 3300013296 Bacteria 6138
207 Ga0157374_10067803 3300013296 Bacteria 3356
208 Ga0157374_10419440 3300013296 Bacteria 1337
209 Ga0157378_10182570 3300013297 Bacteria 1974
210 Ga0163162_10216505 3300013306 Bacteria 2045
211 Ga0163162_10240053 3300013306 Bacteria 1943
212 Ga0157372_10506167 3300013307 Bacteria 1408
213 Ga0157372_11024391 3300013307 Bacteria 956
214 Ga0157375_10028047 3300013308 Bacteria 5272
215 Ga0157375_10104755 3300013308 Bacteria 2918
216 Ga0157375_10118248 3300013308 Bacteria 2757
217 Ga0157375_10184436 3300013308 Bacteria 2239
218 Ga0157375_10541402 3300013308 Bacteria 1326
219 Ga0163163_10033263 3300014325 Bacteria 4987
220 Ga0163163_10712313 3300014325 Bacteria 1067
221 Ga0157379_10036388 3300014968 Bacteria 4390
222 Ga0157379_10129648 3300014968 Bacteria 2269
223 Ga0157379_10193202 3300014968 Bacteria 1839
224 Ga0157376_10020862 3300014969 Bacteria 5078
225 Ga0213876_10074375 3300021384 Bacteria 1794
226 Ga0213875_10004443 3300021388 Bacteria 7699
227 Ga0207697_10008065 3300025315 Bacteria 4647
228 Ga0207697_10011363 3300025315 Bacteria 3767
229 Ga0207656_10168284 3300025321 Bacteria 1046
230 Ga0207682_10003391 3300025893 Bacteria 6936
231 Ga0207682_10012163 3300025893 Bacteria 3360
232 Ga0207682_10049271 3300025893 Bacteria 1739
233 Ga0207642_10125270 3300025899 Bacteria 1332
234 Ga0207688_10025127 3300025901 Bacteria 3269
235 Ga0207680_10004711 3300025903 Bacteria 6484
236 Ga0207680_10015753 3300025903 Bacteria 3953
237 Ga0207680_10145817 3300025903 Bacteria 1573
238 Ga0207647_10004799 3300025904 Bacteria 10005
239 Ga0207647_10014821 3300025904 Bacteria 5362
240 Ga0207647_10157330 3300025904 Bacteria 1326
241 Ga0207645_10023605 3300025907 Bacteria 3994
242 Ga0207643_10096149 3300025908 Bacteria 1732
243 Ga0207643_10270556 3300025908 Bacteria 1051
244 Ga0207705_10017883 3300025909 Bacteria 5070
245 Ga0207705_10028159 3300025909 Bacteria 4006
246 Ga0207705_10099952 3300025909 Bacteria 2133
247 Ga0207705_10137685 3300025909 Bacteria 1821
248 Ga0207705_10182489 3300025909 Bacteria 1584
249 Ga0207705_10208989 3300025909 Bacteria 1480
250 Ga0207684_10322330 3300025910 Bacteria 1332
251 Ga0207707_10257532 3300025912 Bacteria 1515
252 Ga0207707_10576242 3300025912 Unclassified 954
253 Ga0207695_10252223 3300025913 Bacteria 1664
254 Ga0207693_10020143 3300025915 Bacteria 5306
255 Ga0207657_10031106 3300025919 Bacteria 4839
256 Ga0207657_10039319 3300025919 Bacteria 4205
257 Ga0207657_10042957 3300025919 Bacteria 3985
258 Ga0207657_10132709 3300025919 Bacteria 2040
259 Ga0207657_10207610 3300025919 Bacteria 1573
260 Ga0207657_10231699 3300025919 Bacteria 1477
261 Ga0207657_10260301 3300025919 Bacteria 1381
262 Ga0207657_10314356 3300025919 Bacteria 1239
263 Ga0207657_10330439 3300025919 Bacteria 1204
264 Ga0207657_10656807 3300025919 Bacteria 816
265 Ga0207649_10028121 3300025920 Bacteria 3308
266 Ga0207649_10095519 3300025920 Bacteria 1956
267 Ga0207649_10214436 3300025920 Bacteria 1367
268 Ga0207649_10372656 3300025920 Bacteria 1062
269 Ga0207652_10258022 3300025921 Bacteria 1572
270 Ga0207681_10176013 3300025923 Bacteria 1626
271 Ga0207694_10087365 3300025924 Bacteria 2456
272 Ga0207650_10442296 3300025925 Bacteria 1081
273 Ga0207659_10054284 3300025926 Bacteria 2861
274 Ga0207687_10294734 3300025927 Bacteria 1305
275 Ga0207664_10092944 3300025929 Bacteria 2477
276 Ga0207644_10000196 3300025931 Bacteria 43119
277 Ga0207644_10024755 3300025931 Bacteria 4123
278 Ga0207644_10083987 3300025931 Bacteria 2359
279 Ga0207644_10094735 3300025931 Bacteria 2231
280 Ga0207644_10211758 3300025931 Bacteria 1533
281 Ga0207644_10265214 3300025931 Bacteria 1374
282 Ga0207644_10336153 3300025931 Bacteria 1224
283 Ga0207690_10056203 3300025932 Bacteria 2654
284 Ga0207690_10059565 3300025932 Bacteria 2587
285 Ga0207690_10076399 3300025932 Bacteria 2326
286 Ga0207706_10000840 3300025933 Bacteria 31741
287 Ga0207706_10004449 3300025933 Bacteria 13166
288 Ga0207706_10022419 3300025933 Bacteria 5668
289 Ga0207706_10215242 3300025933 Bacteria 1683
290 Ga0207706_10243416 3300025933 Bacteria 1572
291 Ga0207709_10331398 3300025935 Bacteria 1143
292 Ga0207670_10178205 3300025936 Bacteria 1599
293 Ga0207669_10061892 3300025937 Bacteria 2302
294 Ga0207704_10638721 3300025938 Bacteria 875
295 Ga0207691_10000705 3300025940 Bacteria 33075
296 Ga0207691_10015370 3300025940 Bacteria 7283
297 Ga0207691_10026477 3300025940 Bacteria 5440
298 Ga0207691_10059530 3300025940 Bacteria 3472
299 Ga0207691_10103966 3300025940 Bacteria 2532
300 Ga0207691_10526373 3300025940 Bacteria 1003
301 Ga0207691_10591179 3300025940 Bacteria 940
302 Ga0207711_10000826 3300025941 Bacteria 30270
303 Ga0207711_10005440 3300025941 Bacteria 10766
304 Ga0207711_10005651 3300025941 Bacteria 10566
305 Ga0207711_10398973 3300025941 Bacteria 1278
306 Ga0207711_10727142 3300025941 Bacteria 926
307 Ga0207689_10010936 3300025942 Bacteria 7801
308 Ga0207661_10234000 3300025944 Bacteria 1628
309 Ga0207661_10412039 3300025944 Bacteria 1227
310 Ga0207679_10023034 3300025945 Bacteria 4251
311 Ga0207679_10076662 3300025945 Bacteria 2541
312 Ga0207679_10086567 3300025945 Bacteria 2410
313 Ga0207679_10122637 3300025945 Bacteria 2072
314 Ga0207679_10367917 3300025945 Bacteria 1257
315 Ga0207667_10060438 3300025949 Bacteria 3966
316 Ga0207667_10136274 3300025949 Bacteria 2528
317 Ga0207651_10000999 3300025960 Bacteria 12480
318 Ga0207651_10026562 3300025960 Bacteria 3620
319 Ga0207651_10078621 3300025960 Bacteria 2367
320 Ga0207651_10095478 3300025960 Bacteria 2190
321 Ga0207651_10160136 3300025960 Bacteria 1763
322 Ga0207651_10370540 3300025960 Bacteria 1211
323 Ga0207668_10191711 3300025972 Bacteria 1620
324 Ga0207668_10286224 3300025972 Bacteria 1354
325 Ga0207668_10597214 3300025972 Bacteria 961
326 Ga0207640_10179242 3300025981 Bacteria 1587
327 Ga0207640_10246742 3300025981 Bacteria 1383
328 Ga0207640_10713191 3300025981 Bacteria 861
329 Ga0207658_10008208 3300025986 Bacteria 7114
330 Ga0207658_10021355 3300025986 Bacteria 4493
331 Ga0207658_10033791 3300025986 Bacteria 3649
332 Ga0207658_10156901 3300025986 Bacteria 1861
333 Ga0207658_10707872 3300025986 Bacteria 910
334 Ga0207658_10769948 3300025986 Bacteria 872
335 Ga0207677_10009046 3300026023 Bacteria 5589
336 Ga0207677_10018096 3300026023 Bacteria 4222
337 Ga0207677_10021077 3300026023 Bacteria 3974
338 Ga0207677_10117830 3300026023 Bacteria 1991
339 Ga0207677_10409135 3300026023 Bacteria 1152
340 Ga0207703_10008014 3300026035 Bacteria 8349
341 Ga0207703_10069607 3300026035 Bacteria 2902
342 Ga0207703_10182061 3300026035 Bacteria 1855
343 Ga0207703_10337034 3300026035 Bacteria 1385
344 Ga0207639_10107899 3300026041 Bacteria 2263
345 Ga0207639_10135502 3300026041 Bacteria 2044
346 Ga0207639_10158071 3300026041 Bacteria 1907
347 Ga0207639_10166460 3300026041 Bacteria 1863
348 Ga0207678_10001628 3300026067 Bacteria 20589
349 Ga0207678_10004245 3300026067 Bacteria 12855
350 Ga0207678_10009726 3300026067 Bacteria 8455
351 Ga0207678_10010002 3300026067 Bacteria 8323
352 Ga0207678_10060651 3300026067 Bacteria 3253
353 Ga0207678_10151122 3300026067 Bacteria 1983
354 Ga0207678_10163402 3300026067 Bacteria 1902
355 Ga0207702_10027154 3300026078 Bacteria 4753
356 Ga0207641_10029710 3300026088 Bacteria 4521
357 Ga0207641_10060791 3300026088 Bacteria 3221
358 Ga0207641_10188806 3300026088 Bacteria 1892
359 Ga0207648_10000889 3300026089 Bacteria 33700
360 Ga0207648_10009239 3300026089 Bacteria 9469
361 Ga0207648_10239787 3300026089 Bacteria 1614
362 Ga0207676_10094294 3300026095 Bacteria 2466
363 Ga0207676_10143031 3300026095 Bacteria 2050
364 Ga0207676_10395544 3300026095 Bacteria 1290
365 Ga0207674_10350189 3300026116 Bacteria 1428
366 Ga0207675_100610585 3300026118 Bacteria 1094
367 Ga0207683_10001943 3300026121 Bacteria 18297
368 Ga0207683_10002694 3300026121 Bacteria 15527
369 Ga0207683_10142139 3300026121 Bacteria 2163
370 Ga0207683_10292282 3300026121 Bacteria 1490
371 Ga0207698_10005796 3300026142 Bacteria 7668
372 Ga0207698_10252468 3300026142 Bacteria 1615
373 Ga0207698_10313869 3300026142 Bacteria 1465
374 Ga0268266_10029060 3300028379 Bacteria 4698
375 Ga0268266_10166205 3300028379 Bacteria 1999
376 Ga0268265_10003952 3300028380 Bacteria 10443
377 Ga0268265_10260527 3300028380 Bacteria 1541
378 Ga0268265_10260898 3300028380 Bacteria 1540
379 Ga0268264_10124925 3300028381 Bacteria 2273
380 Ga0268264_10144671 3300028381 Bacteria 2124
381 Ga0268264_10363903 3300028381 Bacteria 1380
382 Ga0307408_100032429 3300031548 Bacteria 3642
383 Ga0307408_100042329 3300031548 Bacteria 3234
384 Ga0307405_10012233 3300031731 Bacteria 4533
385 Ga0307405_10131603 3300031731 Bacteria 1729
386 Ga0307405_10286788 3300031731 Bacteria 1242
387 Ga0307405_10460207 3300031731 Bacteria 1011
388 Ga0307413_10332985 3300031824 Bacteria 1164
389 Ga0307410_10002455 3300031852 Bacteria 8952
390 Ga0307410_10064236 3300031852 Bacteria 2521
391 Ga0307410_10476803 3300031852 Bacteria 1023
392 Ga0307406_10009362 3300031901 Bacteria 5491
393 Ga0307407_10051046 3300031903 Bacteria 2369
394 Ga0307407_10199116 3300031903 Bacteria 1341
395 Ga0307412_10020992 3300031911 Bacteria 3983
396 Ga0307412_10064806 3300031911 Bacteria 2470
397 Ga0307409_100182249 3300031995 Bacteria 1860
398 Ga0307409_100643043 3300031995 Bacteria 1053
399 Ga0307414_10254795 3300032004 Bacteria 1461
400 Ga0307411_10061374 3300032005 Bacteria 2502
401 Ga0307411_10272209 3300032005 Bacteria 1343
402 Ga0307411_10759268 3300032005 Bacteria 850
403 Ga0307415_100080796 3300032126 Bacteria 2320
404 Ga0307415_100102676 3300032126 Bacteria 2101
405 Ga0373928_0097196 3300035084 Bacteria 763
406 Ga0373923_0178101 3300035111 Bacteria 976
407 Ga0373935_0024057 3300035692 Bacteria 3746
408 Ga0395899_0000103 3300037312 Bacteria 147274
409 Ga0395899_0031413 3300037312 Bacteria 3991
410 Ga0395899_0038808 3300037312 Bacteria 3566
411 Ga0395899_0084262 3300037312 Bacteria 2310
412 Ga0395899_0100349 3300037312 Bacteria 2090
413 Ga0395899_0295250 3300037312 Bacteria 1098
414 Ga0395900_0000031 3300037418 Bacteria 262393
415 Ga0395900_0000862 3300037418 Bacteria 40012
416 Ga0395900_0002384 3300037418 Bacteria 20759
417 Ga0395900_0013399 3300037418 Bacteria 8377
418 Ga0395900_0063590 3300037418 Bacteria 3793
419 Ga0395900_0203635 3300037418 Bacteria 2001
420 Ga0395900_0263696 3300037418 Bacteria 1719
421 Ga0395900_0284787 3300037418 Bacteria 1643
422 Ga0395900_0289330 3300037418 Bacteria 1627
423 Ga0395900_0434466 3300037418 Bacteria 1271
424 Ga0395900_0597365 3300037418 Bacteria 1044
425 Ga0395898_0000053 3300037466 Bacteria 279600
426 Ga0395898_0003373 3300037466 Bacteria 17893
427 Ga0395898_0055086 3300037466 Bacteria 3879
428 Ga0395898_0058977 3300037466 Bacteria 3735
429 Ga0395898_0085812 3300037466 Bacteria 3034
430 Ga0395898_0157671 3300037466 Bacteria 2171
431 Ga0395898_0211248 3300037466 Bacteria 1851
432 Ga0395898_0241905 3300037466 Bacteria 1721
433 Ga0395898_0250029 3300037466 Bacteria 1691
434 Ga0395898_0376696 3300037466 Bacteria 1353
435 Ga0395905_0000031 3300037471 Bacteria 286757
436 Ga0395905_0000365 3300037471 Bacteria 64175
437 Ga0395905_0027046 3300037471 Bacteria 5409
438 Ga0395905_0066499 3300037471 Bacteria 3375
439 Ga0395905_0099067 3300037471 Bacteria 2737
440 Ga0395905_0153227 3300037471 Bacteria 2168
441 Ga0395905_0342313 3300037471 Bacteria 1386
442 Ga0395905_0488765 3300037471 Bacteria 1130
443 Ga0395905_0498737 3300037471 Bacteria 1117
444 Ga0436364_1311127 3300037853 Bacteria 690
445 Ga0436364_1360610 3300037853 Bacteria 32497
446 Ga0395901_0000163 3300038443 Bacteria 87103
447 Ga0395901_0002051 3300038443 Bacteria 20650
448 Ga0395901_0035805 3300038443 Bacteria 5129
449 Ga0395901_0042145 3300038443 Bacteria 4732
450 Ga0395901_0134999 3300038443 Bacteria 2593
451 Ga0395901_0172036 3300038443 Bacteria 2272
452 Ga0395901_0210614 3300038443 Bacteria 2034
453 Ga0395901_0245226 3300038443 Bacteria 1867
454 Ga0395901_0251891 3300038443 Bacteria 1839
455 Ga0395901_0330627 3300038443 Bacteria 1575
456 Ga0395901_0803286 3300038443 Bacteria 929
457 Ga0395901_0939074 3300038443 Bacteria 844
458 Ga0436365_0504349 3300039437 Bacteria 9584
459 Ga0436363_0214937 3300039450 Bacteria 778
460 Ga0439438_031102 3300041405 Bacteria 1420
461 Ga0450905_005530 3300042142 Bacteria 1698
462 Ga0450889_000034 3300042144 Bacteria 11809
463 Ga0439464_0007229 3300042439 Bacteria 2902
464 Ga0466965_0161247 3300044683 Bacteria 1176
465 Ga0466963_0003565 3300044694 Bacteria 8939
466 Ga0466963_0007455 3300044694 Bacteria 6524
467 Ga0466963_0050713 3300044694 Bacteria 2747
468 Ga0466963_0117592 3300044694 Bacteria 1827
469 Ga0466971_0001977 3300044719 Bacteria 8670
470 Ga0466957_0026243 3300044842 Bacteria 3455
471 Ga0466960_0006351 3300044901 Bacteria 4739
472 Ga0466960_0261844 3300044901 Bacteria 964
473 Ga0466958_0003049 3300045836 Bacteria 8588
474 Ga0466967_0036370 3300045976 Bacteria 4203
475 Ga0466967_0052221 3300045976 Bacteria 3587
476 Ga0466967_0053129 3300045976 Bacteria 3560
477 Ga0466967_0183430 3300045976 Bacteria 1975
478 Ga0466967_0501958 3300045976 Bacteria 1191
479 Ga0495598_0007122 3300046537 Bacteria 2553
480 Ga0495633_0077772 3300046558 Bacteria 1545
481 Ga0495669_0021229 3300046684 Bacteria 2817
482 Ga0495669_0040505 3300046684 Bacteria 2066
483 Ga0495670_0000002 3300046691 Bacteria 601814
484 Ga0495670_0001581 3300046691 Bacteria 11130
485 Ga0495649_0117925 3300046694 Bacteria 1405
486 Ga0496100_0005386 3300048903 Bacteria 6884
487 Ga0496101_0006613 3300048904 Bacteria 7469
488 Ga0496101_0020211 3300048904 Bacteria 4553
489 Ga0496102_0046197 3300048905 Bacteria 3954
490 Ga0496102_0403847 3300048905 Bacteria 1284
491 Ga0496103_0010493 3300048906 Bacteria 5483
492 Ga0496104_0034086 3300048907 Bacteria 4745
493 Ga0496105_0097795 3300048908 Bacteria 2424
494 Ga0496106_0003808 3300048909 Bacteria 11240
495 Ga0496106_0176142 3300048909 Bacteria 1697
496 Ga0496107_0009640 3300048910 Bacteria 6695
497 Ga0496107_0381868 3300048910 Bacteria 1048
498 Ga0496108_0000396 3300048911 Bacteria 35971
499 Ga0496108_0313186 3300048911 Bacteria 1368
500 Ga0496108_0487484 3300048911 Bacteria 1077
501 Ga0496109_0003559 3300048912 Bacteria 13006
502 Ga0496109_0199074 3300048912 Bacteria 1883
503 Ga0496110_0002181 3300048913 Bacteria 14631
504 Ga0496111_0000917 3300048914 Bacteria 16063
505 Ga0496112_0003726 3300048915 Bacteria 12722
506 Ga0496112_0054159 3300048915 Bacteria 3941
507 Ga0496112_0165703 3300048915 Bacteria 2176
508 Ga0496113_0002217 3300048916 Bacteria 11210
509 Ga0496113_0107789 3300048916 Bacteria 2165
510 Ga0496114_0000152 3300048917 Bacteria 50128
511 Ga0496115_0011238 3300048918 Bacteria 6709
512 Ga0501067_0236146 3300049583 Bacteria 1017
513 Ga0501249_034346 3300049679 Bacteria 1137
514 nmdc:mga05p37_230730_c1 3300050507 Bacteria 2230
515 Ga0500583_0317756 3300053092 Bacteria 760
516 Ga0500641_0005984 3300053096 Bacteria 4305
517 Ga0500559_0224704 3300053136 Bacteria 885
518 Ga0500588_0042173 3300053146 Bacteria 1381
519 Ga0500645_005952 3300053730 Bacteria 4415
520 Ga0466962_0003110 3300061719 Bacteria 7886

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100279175 Ga0070670_1002791751 194
2 3300025944 Ga0207661_10412039 Ga0207661_104120391 195
3 3300005344 Ga0070661_100007217 Ga0070661_1000072174 196
4 3300005564 Ga0070664_100038109 Ga0070664_1000381096 196
5 3300005564 Ga0070664_100191258 Ga0070664_1001912582 196
6 3300005616 Ga0068852_100036248 Ga0068852_1000362483 196
7 3300005834 Ga0068851_10003876 Ga0068851_100038762 196
8 3300025920 Ga0207649_10028121 Ga0207649_100281213 196
9 3300025945 Ga0207679_10023034 Ga0207679_100230344 196
10 3300025945 Ga0207679_10086567 Ga0207679_100865673 196
11 3300026041 Ga0207639_10135502 Ga0207639_101355023 196
12 3300026067 Ga0207678_10009726 Ga0207678_100097268 196
13 3300002067 JGI24735J21928_10035780 JGI24735J21928_100357802 197
14 3300005353 Ga0070669_100165589 Ga0070669_1001655893 197
15 3300005355 Ga0070671_100218283 Ga0070671_1002182832 197
16 3300005366 Ga0070659_100149803 Ga0070659_1001498032 197
17 3300005844 Ga0068862_100759856 Ga0068862_1007598562 197
18 3300025893 Ga0207682_10012163 Ga0207682_100121633 197
19 3300025931 Ga0207644_10211758 Ga0207644_102117582 197
20 3300025960 Ga0207651_10078621 Ga0207651_100786214 197
21 3300025972 Ga0207668_10191711 Ga0207668_101917112 197
22 3300046691 Ga0495670_0000002 Ga0495670_0000002_115269_115901 197
23 3300046694 Ga0495649_0117925 Ga0495649_0117925_306_938 197
24 3300053136 Ga0500559_0224704 Ga0500559_0224704_102_734 197
25 3300001990 JGI24737J22298_10026431 JGI24737J22298_100264312 198
26 3300002067 JGI24735J21928_10031377 JGI24735J21928_100313772 198
27 3300002067 JGI24735J21928_10040219 JGI24735J21928_100402191 198
28 3300005327 Ga0070658_10076276 Ga0070658_100762762 198
29 3300005327 Ga0070658_10577640 Ga0070658_105776402 198
30 3300005327 Ga0070658_10710753 Ga0070658_107107531 198
31 3300005344 Ga0070661_100109566 Ga0070661_1001095663 198
32 3300005347 Ga0070668_100006254 Ga0070668_1000062544 198
33 3300005366 Ga0070659_100214018 Ga0070659_1002140182 198
34 3300005455 Ga0070663_100021827 Ga0070663_1000218273 198
35 3300005455 Ga0070663_100061842 Ga0070663_1000618423 198
36 3300005457 Ga0070662_101095666 Ga0070662_1010956661 198
37 3300005614 Ga0068856_100334270 Ga0068856_1003342702 198
38 3300005844 Ga0068862_100005659 Ga0068862_1000056595 198
39 3300009177 Ga0105248_10495441 Ga0105248_104954413 198
40 3300013102 Ga0157371_10261242 Ga0157371_102612423 198
41 3300013296 Ga0157374_10419440 Ga0157374_104194401 198
42 3300014325 Ga0163163_10712313 Ga0163163_107123132 198
43 3300014968 Ga0157379_10036388 Ga0157379_100363883 198
44 3300021388 Ga0213875_10004443 Ga0213875_100044433 198
45 3300025904 Ga0207647_10157330 Ga0207647_101573302 198
46 3300025909 Ga0207705_10017883 Ga0207705_100178833 198
47 3300025909 Ga0207705_10099952 Ga0207705_100999522 198
48 3300025909 Ga0207705_10208989 Ga0207705_102089892 198
49 3300025919 Ga0207657_10330439 Ga0207657_103304391 198
50 3300025919 Ga0207657_10656807 Ga0207657_106568071 198
51 3300025920 Ga0207649_10095519 Ga0207649_100955192 198
52 3300025945 Ga0207679_10076662 Ga0207679_100766622 198
53 3300026067 Ga0207678_10010002 Ga0207678_100100026 198
54 3300026067 Ga0207678_10163402 Ga0207678_101634022 198
55 3300028380 Ga0268265_10003952 Ga0268265_1000395210 198
56 3300031852 Ga0307410_10476803 Ga0307410_104768033 198
57 3300037853 Ga0436364_1311127 Ga0436364_1311127_19_645 198
58 3300037853 Ga0436364_1360610 Ga0436364_1360610_18597_19223 198
59 3300044694 Ga0466963_0007455 Ga0466963_0007455_764_1390 198
60 3300045976 Ga0466967_0036370 Ga0466967_0036370_2654_3280 198
61 3300045976 Ga0466967_0501958 Ga0466967_0501958_253_879 198
62 3300005329 Ga0070683_100295705 Ga0070683_1002957052 199
63 3300005347 Ga0070668_100328395 Ga0070668_1003283953 199
64 3300005347 Ga0070668_100336378 Ga0070668_1003363783 199
65 3300005367 Ga0070667_100122321 Ga0070667_1001223212 199
66 3300005367 Ga0070667_100832733 Ga0070667_1008327331 199
67 3300005543 Ga0070672_100879626 Ga0070672_1008796261 199
68 3300005718 Ga0068866_10131801 Ga0068866_101318011 199
69 3300005843 Ga0068860_101177625 Ga0068860_1011776251 199
70 3300006881 Ga0068865_100277693 Ga0068865_1002776933 199
71 3300013100 Ga0157373_10119369 Ga0157373_101193692 199
72 3300013296 Ga0157374_10000688 Ga0157374_1000068818 199
73 3300013308 Ga0157375_10184436 Ga0157375_101844362 199
74 3300025893 Ga0207682_10049271 Ga0207682_100492712 199
75 3300025899 Ga0207642_10125270 Ga0207642_101252702 199
76 3300025923 Ga0207681_10176013 Ga0207681_101760132 199
77 3300025933 Ga0207706_10022419 Ga0207706_100224193 199
78 3300025938 Ga0207704_10638721 Ga0207704_106387211 199
79 3300025940 Ga0207691_10059530 Ga0207691_100595304 199
80 3300025944 Ga0207661_10234000 Ga0207661_102340002 199
81 3300025986 Ga0207658_10769948 Ga0207658_107699481 199
82 3300026035 Ga0207703_10182061 Ga0207703_101820611 199
83 3300026121 Ga0207683_10292282 Ga0207683_102922822 199
84 3300028380 Ga0268265_10260898 Ga0268265_102608981 199
85 3300028381 Ga0268264_10144671 Ga0268264_101446712 199
86 3300032005 Ga0307411_10759268 Ga0307411_107592681 199
87 3300053730 Ga0500645_005952 Ga0500645_005952_2643_3281 199
88 3300005327 Ga0070658_10033381 Ga0070658_100333813 200
89 3300005339 Ga0070660_100003366 Ga0070660_1000033662 200
90 3300005366 Ga0070659_100023121 Ga0070659_1000231217 200
91 3300005455 Ga0070663_100025599 Ga0070663_1000255997 200
92 3300005539 Ga0068853_100079809 Ga0068853_1000798092 200
93 3300005564 Ga0070664_100030419 Ga0070664_1000304192 200
94 3300005616 Ga0068852_100074676 Ga0068852_1000746763 200
95 3300025321 Ga0207656_10168284 Ga0207656_101682842 200
96 3300025909 Ga0207705_10137685 Ga0207705_101376852 200
97 3300025919 Ga0207657_10031106 Ga0207657_100311064 200
98 3300025932 Ga0207690_10056203 Ga0207690_100562036 200
99 3300026041 Ga0207639_10107899 Ga0207639_101078993 200
100 3300037418 Ga0395900_0203635 Ga0395900_0203635_181_822 200
101 3300037466 Ga0395898_0157671 Ga0395898_0157671_489_1130 200
102 3300038443 Ga0395901_0042145 Ga0395901_0042145_2743_3384 200
103 3300044694 Ga0466963_0050713 Ga0466963_0050713_1810_2442 200
104 3300053092 Ga0500583_0317756 Ga0500583_0317756_104_748 200
105 3300053096 Ga0500641_0005984 Ga0500641_0005984_3312_3953 200
106 3300053146 Ga0500588_0042173 Ga0500588_0042173_31_675 200
107 3300025912 Ga0207707_10257532 Ga0207707_102575322 201
108 3300037312 Ga0395899_0295250 Ga0395899_0295250_433_1083 201
109 3300037418 Ga0395900_0000862 Ga0395900_0000862_32447_33097 201
110 3300037466 Ga0395898_0211248 Ga0395898_0211248_980_1630 201
111 3300037471 Ga0395905_0000365 Ga0395905_0000365_4759_5409 201
112 3300038443 Ga0395901_0035805 Ga0395901_0035805_3058_3708 201
113 3300005617 Ga0068859_100003354 Ga0068859_1000033545 202
114 3300005841 Ga0068863_100138621 Ga0068863_1001386216 202
115 3300005843 Ga0068860_100100415 Ga0068860_1001004154 202
116 3300006931 Ga0097620_100003354 Ga0097620_1000033545 202
117 3300009177 Ga0105248_10150526 Ga0105248_101505263 202
118 3300025941 Ga0207711_10398973 Ga0207711_103989731 202
119 3300026023 Ga0207677_10021077 Ga0207677_100210772 202
120 3300035084 Ga0373928_0097196 Ga0373928_0097196_76_714 202
121 3300037312 Ga0395899_0038808 Ga0395899_0038808_1191_1829 202
122 3300037466 Ga0395898_0250029 Ga0395898_0250029_807_1445 202
123 3300005339 Ga0070660_100179609 Ga0070660_1001796093 203
124 3300005366 Ga0070659_100248607 Ga0070659_1002486072 203
125 3300005367 Ga0070667_100634877 Ga0070667_1006348772 203
126 3300005543 Ga0070672_100851320 Ga0070672_1008513201 203
127 3300005617 Ga0068859_100106596 Ga0068859_1001065963 203
128 3300005842 Ga0068858_100549613 Ga0068858_1005496132 203
129 3300006931 Ga0097620_100106595 Ga0097620_1001065953 203
130 3300009177 Ga0105248_10097345 Ga0105248_100973454 203
131 3300009177 Ga0105248_10200160 Ga0105248_102001601 203
132 3300025919 Ga0207657_10260301 Ga0207657_102603013 203
133 3300025931 Ga0207644_10265214 Ga0207644_102652142 203
134 3300025940 Ga0207691_10591179 Ga0207691_105911791 203
135 3300025941 Ga0207711_10005651 Ga0207711_100056514 203
136 3300025941 Ga0207711_10727142 Ga0207711_107271422 203
137 3300025986 Ga0207658_10008208 Ga0207658_100082086 203
138 3300026088 Ga0207641_10188806 Ga0207641_101888062 203
139 3300028381 Ga0268264_10363903 Ga0268264_103639033 203
140 3300037312 Ga0395899_0084262 Ga0395899_0084262_825_1481 203
141 3300037312 Ga0395899_0100349 Ga0395899_0100349_1324_1980 203
142 3300037418 Ga0395900_0063590 Ga0395900_0063590_1101_1757 203
143 3300037418 Ga0395900_0597365 Ga0395900_0597365_130_786 203
144 3300037466 Ga0395898_0085812 Ga0395898_0085812_1769_2425 203
145 3300037466 Ga0395898_0376696 Ga0395898_0376696_566_1222 203
146 3300037471 Ga0395905_0066499 Ga0395905_0066499_72_728 203
147 3300037471 Ga0395905_0099067 Ga0395905_0099067_2010_2666 203
148 3300037471 Ga0395905_0488765 Ga0395905_0488765_457_1113 203
149 3300037471 Ga0395905_0498737 Ga0395905_0498737_124_780 203
150 3300038443 Ga0395901_0210614 Ga0395901_0210614_825_1481 203
151 3300038443 Ga0395901_0245226 Ga0395901_0245226_111_767 203
152 3300038443 Ga0395901_0803286 Ga0395901_0803286_169_825 203
153 3300038443 Ga0395901_0939074 Ga0395901_0939074_169_825 203
154 3300045976 Ga0466967_0183430 Ga0466967_0183430_1205_1861 203
155 3300048911 Ga0496108_0313186 Ga0496108_0313186_109_765 203
156 3300048912 Ga0496109_0199074 Ga0496109_0199074_476_1132 203
157 3300048915 Ga0496112_0054159 Ga0496112_0054159_2606_3262 203
158 3300048916 Ga0496113_0107789 Ga0496113_0107789_550_1206 203
159 3300049679 Ga0501249_034346 Ga0501249_034346_342_986 203
160 3300005345 Ga0070692_10036947 Ga0070692_100369474 204
161 3300005455 Ga0070663_100101244 Ga0070663_1001012442 204
162 3300005458 Ga0070681_10531807 Ga0070681_105318071 204
163 3300005563 Ga0068855_100127353 Ga0068855_1001273534 204
164 3300025909 Ga0207705_10182489 Ga0207705_101824893 204
165 3300025912 Ga0207707_10576242 Ga0207707_105762421 204
166 3300025949 Ga0207667_10136274 Ga0207667_101362744 204
167 3300044694 Ga0466963_0117592 Ga0466963_0117592_606_1250 204
168 3300045976 Ga0466967_0052221 Ga0466967_0052221_438_1082 204
169 3300005331 Ga0070670_100030359 Ga0070670_1000303592 205
170 3300005844 Ga0068862_100264722 Ga0068862_1002647222 205
171 3300028380 Ga0268265_10260527 Ga0268265_102605272 205
172 3300031731 Ga0307405_10286788 Ga0307405_102867881 205
173 3300031852 Ga0307410_10002455 Ga0307410_1000245511 205
174 3300031903 Ga0307407_10199116 Ga0307407_101991163 205
175 3300032004 Ga0307414_10254795 Ga0307414_102547952 205
176 3300032005 Ga0307411_10061374 Ga0307411_100613742 205
177 3300037418 Ga0395900_0434466 Ga0395900_0434466_476_1150 205
178 3300038443 Ga0395901_0134999 Ga0395901_0134999_1696_2370 205
179 3300005338 Ga0068868_100000237 Ga0068868_1000002374 206
180 3300005347 Ga0070668_100145703 Ga0070668_1001457032 206
181 3300005539 Ga0068853_100036747 Ga0068853_1000367475 206
182 3300006038 Ga0075365_10330841 Ga0075365_103308412 206
183 3300013104 Ga0157370_10086037 Ga0157370_100860372 206
184 3300026041 Ga0207639_10166460 Ga0207639_101664601 206
185 3300026067 Ga0207678_10151122 Ga0207678_101511223 206
186 3300026088 Ga0207641_10029710 Ga0207641_100297107 206
187 3300026095 Ga0207676_10094294 Ga0207676_100942943 206
188 3300037418 Ga0395900_0284787 Ga0395900_0284787_934_1599 206
189 3300037471 Ga0395905_0153227 Ga0395905_0153227_493_1179 206
190 3300037471 Ga0395905_0342313 Ga0395905_0342313_390_1055 206
191 3300038443 Ga0395901_0330627 Ga0395901_0330627_182_847 206
192 3300042439 Ga0439464_0007229 Ga0439464_0007229_1651_2310 206
193 3300005841 Ga0068863_100264835 Ga0068863_1002648352 207
194 3300026088 Ga0207641_10060791 Ga0207641_100607913 207
195 3300031548 Ga0307408_100042329 Ga0307408_1000423292 207
196 3300031731 Ga0307405_10012233 Ga0307405_100122334 207
197 3300031824 Ga0307413_10332985 Ga0307413_103329852 207
198 3300031852 Ga0307410_10064236 Ga0307410_100642365 207
199 3300031901 Ga0307406_10009362 Ga0307406_100093625 207
200 3300031903 Ga0307407_10051046 Ga0307407_100510462 207
201 3300031911 Ga0307412_10020992 Ga0307412_100209924 207
202 3300031995 Ga0307409_100643043 Ga0307409_1006430431 207
203 3300032005 Ga0307411_10272209 Ga0307411_102722092 207
204 3300032126 Ga0307415_100102676 Ga0307415_1001026764 207
205 3300046684 Ga0495669_0040505 Ga0495669_0040505_1039_1713 207
206 3300003323 rootH1_10208177 rootH1_102081772 208
207 3300005327 Ga0070658_10026100 Ga0070658_100261006 208
208 3300005330 Ga0070690_100045194 Ga0070690_1000451943 208
209 3300005335 Ga0070666_10007245 Ga0070666_100072454 208
210 3300005340 Ga0070689_100099347 Ga0070689_1000993474 208
211 3300005355 Ga0070671_100045988 Ga0070671_1000459883 208
212 3300005356 Ga0070674_100031836 Ga0070674_1000318362 208
213 3300005364 Ga0070673_100008272 Ga0070673_1000082722 208
214 3300005367 Ga0070667_100040495 Ga0070667_1000404953 208
215 3300005444 Ga0070694_100167802 Ga0070694_1001678022 208
216 3300005457 Ga0070662_100302892 Ga0070662_1003028921 208
217 3300005459 Ga0068867_100154331 Ga0068867_1001543312 208
218 3300005467 Ga0070706_100248834 Ga0070706_1002488343 208
219 3300005530 Ga0070679_100439976 Ga0070679_1004399762 208
220 3300005545 Ga0070695_100023104 Ga0070695_1000231044 208
221 3300005546 Ga0070696_100006532 Ga0070696_1000065328 208
222 3300005547 Ga0070693_100205124 Ga0070693_1002051242 208
223 3300005578 Ga0068854_100366947 Ga0068854_1003669471 208
224 3300005616 Ga0068852_100242350 Ga0068852_1002423502 208
225 3300005617 Ga0068859_100014674 Ga0068859_1000146747 208
226 3300005842 Ga0068858_100001063 Ga0068858_10000106333 208
227 3300006931 Ga0097620_100014673 Ga0097620_1000146734 208
228 3300009147 Ga0114129_10593315 Ga0114129_105933154 208
229 3300009177 Ga0105248_10123267 Ga0105248_101232672 208
230 3300014968 Ga0157379_10193202 Ga0157379_101932023 208
231 3300025903 Ga0207680_10015753 Ga0207680_100157536 208
232 3300025904 Ga0207647_10004799 Ga0207647_100047996 208
233 3300025910 Ga0207684_10322330 Ga0207684_103223302 208
234 3300025919 Ga0207657_10207610 Ga0207657_102076102 208
235 3300025919 Ga0207657_10314356 Ga0207657_103143561 208
236 3300025921 Ga0207652_10258022 Ga0207652_102580222 208
237 3300025931 Ga0207644_10024755 Ga0207644_100247554 208
238 3300025932 Ga0207690_10059565 Ga0207690_100595654 208
239 3300025933 Ga0207706_10243416 Ga0207706_102434162 208
240 3300025937 Ga0207669_10061892 Ga0207669_100618922 208
241 3300025940 Ga0207691_10526373 Ga0207691_105263731 208
242 3300025941 Ga0207711_10000826 Ga0207711_100008263 208
243 3300025960 Ga0207651_10026562 Ga0207651_100265622 208
244 3300025986 Ga0207658_10021355 Ga0207658_100213554 208
245 3300026023 Ga0207677_10009046 Ga0207677_100090464 208
246 3300026035 Ga0207703_10008014 Ga0207703_100080147 208
247 3300026142 Ga0207698_10252468 Ga0207698_102524682 208
248 3300031731 Ga0307405_10460207 Ga0307405_104602072 208
249 3300041405 Ga0439438_031102 Ga0439438_031102_600_1268 208
250 3300042142 Ga0450905_005530 Ga0450905_005530_639_1307 208
251 3300042144 Ga0450889_000034 Ga0450889_000034_5821_6489 208
252 3300050507 nmdc:mga05p37_230730_c1 nmdc:mga05p37_230730_c1_27_695 208
253 3300005327 Ga0070658_10142407 Ga0070658_101424073 209
254 3300005330 Ga0070690_100052565 Ga0070690_1000525653 209
255 3300005331 Ga0070670_100181430 Ga0070670_1001814302 209
256 3300005335 Ga0070666_10018022 Ga0070666_100180226 209
257 3300005337 Ga0070682_100354673 Ga0070682_1003546732 209
258 3300005340 Ga0070689_100451579 Ga0070689_1004515792 209
259 3300005355 Ga0070671_100013668 Ga0070671_1000136684 209
260 3300005355 Ga0070671_100014207 Ga0070671_1000142072 209
261 3300005356 Ga0070674_100006617 Ga0070674_1000066172 209
262 3300005364 Ga0070673_100013344 Ga0070673_1000133447 209
263 3300005364 Ga0070673_100168440 Ga0070673_1001684401 209
264 3300005364 Ga0070673_100504370 Ga0070673_1005043702 209
265 3300005367 Ga0070667_100385435 Ga0070667_1003854352 209
266 3300005456 Ga0070678_100055768 Ga0070678_1000557681 209
267 3300005457 Ga0070662_100003264 Ga0070662_10000326413 209
268 3300005459 Ga0068867_100002869 Ga0068867_1000028695 209
269 3300005466 Ga0070685_10135386 Ga0070685_101353861 209
270 3300005543 Ga0070672_100085728 Ga0070672_1000857282 209
271 3300005543 Ga0070672_100118015 Ga0070672_1001180152 209
272 3300005544 Ga0070686_100129525 Ga0070686_1001295251 209
273 3300005547 Ga0070693_100318725 Ga0070693_1003187251 209
274 3300005834 Ga0068851_10009411 Ga0068851_100094116 209
275 3300005840 Ga0068870_10131204 Ga0068870_101312043 209
276 3300006358 Ga0068871_100013156 Ga0068871_1000131567 209
277 3300009177 Ga0105248_10285213 Ga0105248_102852132 209
278 3300009177 Ga0105248_11442376 Ga0105248_114423761 209
279 3300013105 Ga0157369_10206595 Ga0157369_102065952 209
280 3300013308 Ga0157375_10541402 Ga0157375_105414022 209
281 3300025315 Ga0207697_10011363 Ga0207697_100113636 209
282 3300025908 Ga0207643_10096149 Ga0207643_100961494 209
283 3300025931 Ga0207644_10083987 Ga0207644_100839872 209
284 3300025933 Ga0207706_10215242 Ga0207706_102152422 209
285 3300025936 Ga0207670_10178205 Ga0207670_101782053 209
286 3300025940 Ga0207691_10026477 Ga0207691_100264775 209
287 3300025940 Ga0207691_10103966 Ga0207691_101039662 209
288 3300025960 Ga0207651_10095478 Ga0207651_100954782 209
289 3300025960 Ga0207651_10370540 Ga0207651_103705402 209
290 3300025972 Ga0207668_10597214 Ga0207668_105972141 209
291 3300025986 Ga0207658_10707872 Ga0207658_107078721 209
292 3300026078 Ga0207702_10027154 Ga0207702_100271546 209
293 3300026118 Ga0207675_100610585 Ga0207675_1006105851 209
294 3300026121 Ga0207683_10142139 Ga0207683_101421392 209
295 3300028379 Ga0268266_10029060 Ga0268266_100290604 209
296 3300028379 Ga0268266_10166205 Ga0268266_101662052 209
297 3300031548 Ga0307408_100032429 Ga0307408_1000324292 209
298 3300031731 Ga0307405_10131603 Ga0307405_101316032 209
299 3300031911 Ga0307412_10064806 Ga0307412_100648062 209
300 3300031995 Ga0307409_100182249 Ga0307409_1001822492 209
301 3300032126 Ga0307415_100080796 Ga0307415_1000807962 209
302 3300035111 Ga0373923_0178101 Ga0373923_0178101_258_917 209
303 3300037418 Ga0395900_0000031 Ga0395900_0000031_54184_54867 209
304 3300037418 Ga0395900_0013399 Ga0395900_0013399_1093_1788 209
305 3300037418 Ga0395900_0263696 Ga0395900_0263696_847_1539 209
306 3300037466 Ga0395898_0003373 Ga0395898_0003373_11565_12248 209
307 3300037466 Ga0395898_0058977 Ga0395898_0058977_2299_2994 209
308 3300037466 Ga0395898_0241905 Ga0395898_0241905_647_1339 209
309 3300037471 Ga0395905_0027046 Ga0395905_0027046_1749_2444 209
310 3300038443 Ga0395901_0002051 Ga0395901_0002051_12684_13367 209
311 3300038443 Ga0395901_0251891 Ga0395901_0251891_546_1238 209
312 3300046537 Ga0495598_0007122 Ga0495598_0007122_1826_2485 209
313 3300046558 Ga0495633_0077772 Ga0495633_0077772_94_753 209
314 3300046684 Ga0495669_0021229 Ga0495669_0021229_734_1393 209
315 3300046691 Ga0495670_0001581 Ga0495670_0001581_3152_3811 209
316 3300048911 Ga0496108_0487484 Ga0496108_0487484_170_829 209
317 3300049583 Ga0501067_0236146 Ga0501067_0236146_336_995 209
318 3300005339 Ga0070660_100227333 Ga0070660_1002273332 210
319 3300005344 Ga0070661_100043546 Ga0070661_1000435464 210
320 3300005355 Ga0070671_100015603 Ga0070671_1000156031 210
321 3300005355 Ga0070671_100166042 Ga0070671_1001660423 210
322 3300005435 Ga0070714_100042688 Ga0070714_1000426884 210
323 3300005435 Ga0070714_100374999 Ga0070714_1003749992 210
324 3300005436 Ga0070713_100056520 Ga0070713_1000565205 210
325 3300005455 Ga0070663_100007211 Ga0070663_1000072113 210
326 3300005459 Ga0068867_100058279 Ga0068867_1000582792 210
327 3300005563 Ga0068855_100853875 Ga0068855_1008538751 210
328 3300005578 Ga0068854_100015826 Ga0068854_1000158265 210
329 3300005614 Ga0068856_100278743 Ga0068856_1002787432 210
330 3300005618 Ga0068864_100098577 Ga0068864_1000985776 210
331 3300006028 Ga0070717_10028934 Ga0070717_100289345 210
332 3300006173 Ga0070716_100030809 Ga0070716_1000308092 210
333 3300006175 Ga0070712_100010413 Ga0070712_1000104136 210
334 3300006237 Ga0097621_100827397 Ga0097621_1008273971 210
335 3300009093 Ga0105240_10373909 Ga0105240_103739092 210
336 3300009177 Ga0105248_10057467 Ga0105248_100574676 210
337 3300013100 Ga0157373_10187142 Ga0157373_101871422 210
338 3300013104 Ga0157370_10339489 Ga0157370_103394892 210
339 3300013306 Ga0163162_10240053 Ga0163162_102400532 210
340 3300013307 Ga0157372_10506167 Ga0157372_105061672 210
341 3300021384 Ga0213876_10074375 Ga0213876_100743752 210
342 3300025909 Ga0207705_10028159 Ga0207705_100281593 210
343 3300025913 Ga0207695_10252223 Ga0207695_102522232 210
344 3300025915 Ga0207693_10020143 Ga0207693_100201435 210
345 3300025919 Ga0207657_10132709 Ga0207657_101327093 210
346 3300025920 Ga0207649_10214436 Ga0207649_102144362 210
347 3300025925 Ga0207650_10442296 Ga0207650_104422961 210
348 3300025929 Ga0207664_10092944 Ga0207664_100929442 210
349 3300025931 Ga0207644_10336153 Ga0207644_103361532 210
350 3300025945 Ga0207679_10367917 Ga0207679_103679172 210
351 3300025949 Ga0207667_10060438 Ga0207667_100604384 210
352 3300025981 Ga0207640_10246742 Ga0207640_102467422 210
353 3300026067 Ga0207678_10001628 Ga0207678_1000162826 210
354 3300026089 Ga0207648_10239787 Ga0207648_102397872 210
355 3300026095 Ga0207676_10395544 Ga0207676_103955443 210
356 3300026142 Ga0207698_10313869 Ga0207698_103138692 210
357 3300035692 Ga0373935_0024057 Ga0373935_0024057_3072_3734 210
358 3300039437 Ga0436365_0504349 Ga0436365_0504349_958_1656 210
359 3300039450 Ga0436363_0214937 Ga0436363_0214937_27_725 210
360 3300044683 Ga0466965_0161247 Ga0466965_0161247_404_1105 210
361 3300044901 Ga0466960_0006351 Ga0466960_0006351_401_1102 210
362 3300048904 Ga0496101_0020211 Ga0496101_0020211_2214_2876 210
363 3300048918 Ga0496115_0011238 Ga0496115_0011238_1984_2646 210
364 3300001978 JGI24747J21853_1001580 JGI24747J21853_10015802 211
365 3300001989 JGI24739J22299_10008945 JGI24739J22299_100089454 211
366 3300002073 JGI24745J21846_1002754 JGI24745J21846_10027543 211
367 3300002075 JGI24738J21930_10018195 JGI24738J21930_100181953 211
368 3300002077 JGI24744J21845_10000287 JGI24744J21845_100002876 211
369 3300005328 Ga0070676_10046893 Ga0070676_100468932 211
370 3300005331 Ga0070670_100124951 Ga0070670_1001249512 211
371 3300005334 Ga0068869_100059083 Ga0068869_1000590832 211
372 3300005335 Ga0070666_10018242 Ga0070666_100182426 211
373 3300005338 Ga0068868_100006807 Ga0068868_1000068077 211
374 3300005338 Ga0068868_100299968 Ga0068868_1002999681 211
375 3300005339 Ga0070660_100102984 Ga0070660_1001029843 211
376 3300005339 Ga0070660_100434711 Ga0070660_1004347112 211
377 3300005344 Ga0070661_100051844 Ga0070661_1000518442 211
378 3300005347 Ga0070668_100073903 Ga0070668_1000739036 211
379 3300005354 Ga0070675_100087001 Ga0070675_1000870012 211
380 3300005354 Ga0070675_100092888 Ga0070675_1000928883 211
381 3300005355 Ga0070671_100077208 Ga0070671_1000772082 211
382 3300005356 Ga0070674_100006593 Ga0070674_1000065939 211
383 3300005356 Ga0070674_100032380 Ga0070674_1000323804 211
384 3300005364 Ga0070673_100090533 Ga0070673_1000905332 211
385 3300005366 Ga0070659_100143512 Ga0070659_1001435121 211
386 3300005367 Ga0070667_100334121 Ga0070667_1003341211 211
387 3300005456 Ga0070678_100021464 Ga0070678_1000214642 211
388 3300005457 Ga0070662_100286832 Ga0070662_1002868321 211
389 3300005459 Ga0068867_100145751 Ga0068867_1001457513 211
390 3300005543 Ga0070672_100000482 Ga0070672_10000048211 211
391 3300005543 Ga0070672_100247642 Ga0070672_1002476424 211
392 3300005548 Ga0070665_100016225 Ga0070665_1000162256 211
393 3300005548 Ga0070665_100138768 Ga0070665_1001387684 211
394 3300005564 Ga0070664_100141257 Ga0070664_1001412572 211
395 3300005577 Ga0068857_100332360 Ga0068857_1003323602 211
396 3300005578 Ga0068854_100091847 Ga0068854_1000918474 211
397 3300005614 Ga0068856_100042138 Ga0068856_1000421384 211
398 3300005616 Ga0068852_100012312 Ga0068852_1000123125 211
399 3300005616 Ga0068852_100093094 Ga0068852_1000930942 211
400 3300005617 Ga0068859_100069745 Ga0068859_1000697452 211
401 3300005617 Ga0068859_100552657 Ga0068859_1005526572 211
402 3300005618 Ga0068864_100089105 Ga0068864_1000891052 211
403 3300005718 Ga0068866_10004001 Ga0068866_100040012 211
404 3300005718 Ga0068866_10005219 Ga0068866_100052194 211
405 3300005719 Ga0068861_100203868 Ga0068861_1002038681 211
406 3300005840 Ga0068870_10033540 Ga0068870_100335406 211
407 3300005841 Ga0068863_100001961 Ga0068863_10000196112 211
408 3300005842 Ga0068858_100080260 Ga0068858_1000802603 211
409 3300005843 Ga0068860_100147325 Ga0068860_1001473253 211
410 3300006237 Ga0097621_100104514 Ga0097621_1001045142 211
411 3300006881 Ga0068865_100004584 Ga0068865_1000045845 211
412 3300006931 Ga0097620_100069748 Ga0097620_1000697482 211
413 3300006931 Ga0097620_100552648 Ga0097620_1005526482 211
414 3300009098 Ga0105245_10017352 Ga0105245_100173527 211
415 3300009098 Ga0105245_10019353 Ga0105245_100193537 211
416 3300009148 Ga0105243_10244968 Ga0105243_102449681 211
417 3300009176 Ga0105242_10002696 Ga0105242_100026964 211
418 3300009176 Ga0105242_10296319 Ga0105242_102963192 211
419 3300009177 Ga0105248_10239202 Ga0105248_102392023 211
420 3300009545 Ga0105237_10554693 Ga0105237_105546931 211
421 3300009551 Ga0105238_10074784 Ga0105238_100747844 211
422 3300009551 Ga0105238_10281994 Ga0105238_102819942 211
423 3300009551 Ga0105238_10389906 Ga0105238_103899064 211
424 3300010375 Ga0105239_10046622 Ga0105239_100466224 211
425 3300013102 Ga0157371_10005796 Ga0157371_1000579613 211
426 3300013296 Ga0157374_10018582 Ga0157374_100185822 211
427 3300013296 Ga0157374_10067803 Ga0157374_100678036 211
428 3300013297 Ga0157378_10182570 Ga0157378_101825702 211
429 3300013306 Ga0163162_10216505 Ga0163162_102165053 211
430 3300013307 Ga0157372_11024391 Ga0157372_110243911 211
431 3300013308 Ga0157375_10028047 Ga0157375_100280473 211
432 3300013308 Ga0157375_10104755 Ga0157375_101047552 211
433 3300013308 Ga0157375_10118248 Ga0157375_101182482 211
434 3300014325 Ga0163163_10033263 Ga0163163_100332633 211
435 3300014968 Ga0157379_10129648 Ga0157379_101296483 211
436 3300014969 Ga0157376_10020862 Ga0157376_100208624 211
437 3300025315 Ga0207697_10008065 Ga0207697_100080653 211
438 3300025893 Ga0207682_10003391 Ga0207682_100033912 211
439 3300025901 Ga0207688_10025127 Ga0207688_100251274 211
440 3300025903 Ga0207680_10004711 Ga0207680_100047113 211
441 3300025903 Ga0207680_10145817 Ga0207680_101458172 211
442 3300025904 Ga0207647_10014821 Ga0207647_100148217 211
443 3300025907 Ga0207645_10023605 Ga0207645_100236054 211
444 3300025908 Ga0207643_10270556 Ga0207643_102705562 211
445 3300025919 Ga0207657_10039319 Ga0207657_100393195 211
446 3300025919 Ga0207657_10042957 Ga0207657_100429573 211
447 3300025919 Ga0207657_10231699 Ga0207657_102316992 211
448 3300025920 Ga0207649_10372656 Ga0207649_103726562 211
449 3300025924 Ga0207694_10087365 Ga0207694_100873653 211
450 3300025926 Ga0207659_10054284 Ga0207659_100542843 211
451 3300025927 Ga0207687_10294734 Ga0207687_102947343 211
452 3300025931 Ga0207644_10000196 Ga0207644_1000019611 211
453 3300025931 Ga0207644_10094735 Ga0207644_100947352 211
454 3300025932 Ga0207690_10076399 Ga0207690_100763995 211
455 3300025933 Ga0207706_10000840 Ga0207706_1000084013 211
456 3300025933 Ga0207706_10004449 Ga0207706_1000444913 211
457 3300025935 Ga0207709_10331398 Ga0207709_103313982 211
458 3300025940 Ga0207691_10000705 Ga0207691_1000070517 211
459 3300025940 Ga0207691_10015370 Ga0207691_100153706 211
460 3300025941 Ga0207711_10005440 Ga0207711_100054402 211
461 3300025942 Ga0207689_10010936 Ga0207689_100109369 211
462 3300025945 Ga0207679_10122637 Ga0207679_101226372 211
463 3300025960 Ga0207651_10000999 Ga0207651_1000099915 211
464 3300025960 Ga0207651_10160136 Ga0207651_101601363 211
465 3300025972 Ga0207668_10286224 Ga0207668_102862243 211
466 3300025981 Ga0207640_10179242 Ga0207640_101792422 211
467 3300025981 Ga0207640_10713191 Ga0207640_107131911 211
468 3300025986 Ga0207658_10033791 Ga0207658_100337916 211
469 3300025986 Ga0207658_10156901 Ga0207658_101569012 211
470 3300026023 Ga0207677_10018096 Ga0207677_100180963 211
471 3300026023 Ga0207677_10117830 Ga0207677_101178304 211
472 3300026023 Ga0207677_10409135 Ga0207677_104091352 211
473 3300026035 Ga0207703_10069607 Ga0207703_100696072 211
474 3300026035 Ga0207703_10337034 Ga0207703_103370341 211
475 3300026041 Ga0207639_10158071 Ga0207639_101580713 211
476 3300026067 Ga0207678_10004245 Ga0207678_100042457 211
477 3300026067 Ga0207678_10060651 Ga0207678_100606514 211
478 3300026089 Ga0207648_10000889 Ga0207648_1000088916 211
479 3300026089 Ga0207648_10009239 Ga0207648_100092395 211
480 3300026095 Ga0207676_10143031 Ga0207676_101430312 211
481 3300026116 Ga0207674_10350189 Ga0207674_103501891 211
482 3300026121 Ga0207683_10001943 Ga0207683_1000194317 211
483 3300026121 Ga0207683_10002694 Ga0207683_100026942 211
484 3300026142 Ga0207698_10005796 Ga0207698_100057963 211
485 3300028381 Ga0268264_10124925 Ga0268264_101249253 211
486 3300037312 Ga0395899_0000103 Ga0395899_0000103_117290_118000 211
487 3300037312 Ga0395899_0031413 Ga0395899_0031413_2123_2788 211
488 3300037418 Ga0395900_0002384 Ga0395900_0002384_5513_6223 211
489 3300037418 Ga0395900_0289330 Ga0395900_0289330_233_949 211
490 3300037466 Ga0395898_0000053 Ga0395898_0000053_171891_172601 211
491 3300037466 Ga0395898_0055086 Ga0395898_0055086_2011_2676 211
492 3300037471 Ga0395905_0000031 Ga0395905_0000031_114157_114867 211
493 3300038443 Ga0395901_0000163 Ga0395901_0000163_74973_75683 211
494 3300038443 Ga0395901_0172036 Ga0395901_0172036_589_1254 211
495 3300044694 Ga0466963_0003565 Ga0466963_0003565_5532_6197 211
496 3300044719 Ga0466971_0001977 Ga0466971_0001977_2464_3129 211
497 3300044842 Ga0466957_0026243 Ga0466957_0026243_386_1051 211
498 3300044901 Ga0466960_0261844 Ga0466960_0261844_160_861 211
499 3300045836 Ga0466958_0003049 Ga0466958_0003049_2113_2778 211
500 3300045976 Ga0466967_0053129 Ga0466967_0053129_200_865 211
501 3300048903 Ga0496100_0005386 Ga0496100_0005386_5568_6233 211
502 3300048904 Ga0496101_0006613 Ga0496101_0006613_4112_4777 211
503 3300048905 Ga0496102_0046197 Ga0496102_0046197_1226_1891 211
504 3300048905 Ga0496102_0403847 Ga0496102_0403847_436_1101 211
505 3300048906 Ga0496103_0010493 Ga0496103_0010493_2473_3138 211
506 3300048907 Ga0496104_0034086 Ga0496104_0034086_643_1308 211
507 3300048908 Ga0496105_0097795 Ga0496105_0097795_1117_1782 211
508 3300048909 Ga0496106_0003808 Ga0496106_0003808_8249_8914 211
509 3300048909 Ga0496106_0176142 Ga0496106_0176142_950_1615 211
510 3300048910 Ga0496107_0009640 Ga0496107_0009640_2157_2822 211
511 3300048910 Ga0496107_0381868 Ga0496107_0381868_15_680 211
512 3300048911 Ga0496108_0000396 Ga0496108_0000396_12702_13367 211
513 3300048912 Ga0496109_0003559 Ga0496109_0003559_1771_2436 211
514 3300048913 Ga0496110_0002181 Ga0496110_0002181_4211_4876 211
515 3300048914 Ga0496111_0000917 Ga0496111_0000917_4879_5544 211
516 3300048915 Ga0496112_0003726 Ga0496112_0003726_6439_7104 211
517 3300048915 Ga0496112_0165703 Ga0496112_0165703_1293_1958 211
518 3300048916 Ga0496113_0002217 Ga0496113_0002217_3006_3671 211
519 3300048917 Ga0496114_0000152 Ga0496114_0000152_46578_47246 211
520 3300061719 Ga0466962_0003110 Ga0466962_0003110_2512_3177 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02224

Cytidylate_kin

Cytidylate kinase

10

211

0.94

PF13207

AAA_17

AAA domain

14

165

0.57

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fem-assembly1.cif.gz_A mutant r188m of the cytidine monophosphate kinase from e. coli 0.8909 11 202
1cke-assembly1.cif.gz_A cmp kinase from escherichia coli free enzyme structure 0.8879 11 202
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.8791 7 202
3r20-assembly1.cif.gz_A crystal structure of cytidylate kinase from mycobacterium smegmatis 0.8378 10 197
4e22-assembly1.cif.gz_A structure of cytidine monophosphate kinase from yersinia pseudotuberculosis 0.829 7 202
ID Description Score Start End Superfamily
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8909 11 202 3.40.50.300
2femA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8226 11 202 3.40.50.300
2h92C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7808 10 200 3.40.50.300
4dieB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7542 10 200 3.40.50.300
3w90A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7332 12 196 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A285M6Y7-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.9387 7 203 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A3B0RXE6-F1-model_v4 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) 0.9099 7 206 GO:0003866
GO:0005524
GO:0008652
GO:0009073
GO:0009423
GO:0036430
GO:0036431
AF-A0A2N2UIP7-F1-model_v4 Multifunctional fusion protein [Includes: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase)] 0.9001 11 202 GO:0003866
GO:0005524
GO:0005737
GO:0006220
GO:0008652
GO:0009073
GO:0009423
GO:0036430
GO:0036431
AF-A0A389M5X6-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.8987 9 204 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431
AF-A0A0H3XH65-F1-model_v4 Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) 0.891 11 205 GO:0005524
GO:0005737
GO:0006220
GO:0036430
GO:0036431

Feature Viewer

pLDDT pTM Quality
90.56 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map