F458565
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 520 | 212 | 520 | 218 |
Family's Representative Sequence
| Representative Sequence | 3300037312|Ga0395899_0295250|Ga0395899_0295250_433_1083 |
| Length | 216 |
| Sequence | MTSPASPIVIAVDGPAASGKGTIARALAKHYGLPHMDTGMLYRAVALTMFRFGGDPASEFEAVRACEGTPQVDPTDPDLRTEIVSSIASRISAYPAVRAALLQRQQAFASQASGAVLDGRDIGTVIAPHATAKLFVTASPEVRARRRVAELLKRGMPAHYEDVLIDIRARDERDSKRDAAPLVQADDADLLDTSEMDIDEAIAAAIALVEAKIGAN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 6 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 57 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 58 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 59 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 94 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 153 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 154 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 155 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 160 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 161 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 165 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 166 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 167 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 168 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 172 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 173 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 174 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 175 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 176 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 181 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 194 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 195 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 200 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 201 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 202 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 203 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 204 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 206 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 208 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 209 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 210 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 211 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 212 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0 |
| Rhizoplane | 5 |
| Rhizosphere | 92.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24747J21853_1001580 | 3300001978 | Bacteria | 1734 |
| 2 | JGI24739J22299_10008945 | 3300001989 | Bacteria | 3736 |
| 3 | JGI24737J22298_10026431 | 3300001990 | Bacteria | 1833 |
| 4 | JGI24735J21928_10031377 | 3300002067 | Bacteria | 1575 |
| 5 | JGI24735J21928_10035780 | 3300002067 | Bacteria | 1458 |
| 6 | JGI24735J21928_10040219 | 3300002067 | Bacteria | 1366 |
| 7 | JGI24745J21846_1002754 | 3300002073 | Bacteria | 1812 |
| 8 | JGI24738J21930_10018195 | 3300002075 | Bacteria | 1470 |
| 9 | JGI24744J21845_10000287 | 3300002077 | Bacteria | 8385 |
| 10 | rootH1_10208177 | 3300003323 | Bacteria | 1327 |
| 11 | Ga0070658_10026100 | 3300005327 | Bacteria | 4686 |
| 12 | Ga0070658_10033381 | 3300005327 | Bacteria | 4140 |
| 13 | Ga0070658_10076276 | 3300005327 | Bacteria | 2749 |
| 14 | Ga0070658_10142407 | 3300005327 | Bacteria | 2003 |
| 15 | Ga0070658_10577640 | 3300005327 | Bacteria | 973 |
| 16 | Ga0070658_10710753 | 3300005327 | Bacteria | 872 |
| 17 | Ga0070676_10046893 | 3300005328 | Bacteria | 2521 |
| 18 | Ga0070683_100295705 | 3300005329 | Bacteria | 1540 |
| 19 | Ga0070690_100045194 | 3300005330 | Bacteria | 2797 |
| 20 | Ga0070690_100052565 | 3300005330 | Bacteria | 2604 |
| 21 | Ga0070670_100030359 | 3300005331 | Bacteria | 4655 |
| 22 | Ga0070670_100124951 | 3300005331 | Bacteria | 2221 |
| 23 | Ga0070670_100181430 | 3300005331 | Bacteria | 1828 |
| 24 | Ga0070670_100279175 | 3300005331 | Bacteria | 1459 |
| 25 | Ga0068869_100059083 | 3300005334 | Bacteria | 2806 |
| 26 | Ga0070666_10007245 | 3300005335 | Bacteria | 6839 |
| 27 | Ga0070666_10018022 | 3300005335 | Bacteria | 4533 |
| 28 | Ga0070666_10018242 | 3300005335 | Bacteria | 4508 |
| 29 | Ga0070682_100354673 | 3300005337 | Bacteria | 1095 |
| 30 | Ga0068868_100000237 | 3300005338 | Bacteria | 37449 |
| 31 | Ga0068868_100006807 | 3300005338 | Bacteria | 8117 |
| 32 | Ga0068868_100299968 | 3300005338 | Bacteria | 1364 |
| 33 | Ga0070660_100003366 | 3300005339 | Bacteria | 10999 |
| 34 | Ga0070660_100102984 | 3300005339 | Bacteria | 2263 |
| 35 | Ga0070660_100179609 | 3300005339 | Bacteria | 1712 |
| 36 | Ga0070660_100227333 | 3300005339 | Bacteria | 1517 |
| 37 | Ga0070660_100434711 | 3300005339 | Bacteria | 1087 |
| 38 | Ga0070689_100099347 | 3300005340 | Bacteria | 2303 |
| 39 | Ga0070689_100451579 | 3300005340 | Bacteria | 1094 |
| 40 | Ga0070661_100007217 | 3300005344 | Bacteria | 7661 |
| 41 | Ga0070661_100043546 | 3300005344 | Bacteria | 3279 |
| 42 | Ga0070661_100051844 | 3300005344 | Bacteria | 3003 |
| 43 | Ga0070661_100109566 | 3300005344 | Bacteria | 2061 |
| 44 | Ga0070692_10036947 | 3300005345 | Bacteria | 2481 |
| 45 | Ga0070668_100006254 | 3300005347 | Bacteria | 8821 |
| 46 | Ga0070668_100073903 | 3300005347 | Bacteria | 2659 |
| 47 | Ga0070668_100145703 | 3300005347 | Bacteria | 1912 |
| 48 | Ga0070668_100328395 | 3300005347 | Bacteria | 1289 |
| 49 | Ga0070668_100336378 | 3300005347 | Bacteria | 1275 |
| 50 | Ga0070669_100165589 | 3300005353 | Bacteria | 1721 |
| 51 | Ga0070675_100087001 | 3300005354 | Bacteria | 2613 |
| 52 | Ga0070675_100092888 | 3300005354 | Bacteria | 2530 |
| 53 | Ga0070671_100013668 | 3300005355 | Bacteria | 6547 |
| 54 | Ga0070671_100014207 | 3300005355 | Bacteria | 6430 |
| 55 | Ga0070671_100015603 | 3300005355 | Bacteria | 6138 |
| 56 | Ga0070671_100045988 | 3300005355 | Bacteria | 3629 |
| 57 | Ga0070671_100077208 | 3300005355 | Bacteria | 2783 |
| 58 | Ga0070671_100166042 | 3300005355 | Bacteria | 1866 |
| 59 | Ga0070671_100218283 | 3300005355 | Bacteria | 1618 |
| 60 | Ga0070674_100006593 | 3300005356 | Bacteria | 6786 |
| 61 | Ga0070674_100006617 | 3300005356 | Bacteria | 6775 |
| 62 | Ga0070674_100031836 | 3300005356 | Bacteria | 3499 |
| 63 | Ga0070674_100032380 | 3300005356 | Bacteria | 3472 |
| 64 | Ga0070673_100008272 | 3300005364 | Bacteria | 6909 |
| 65 | Ga0070673_100013344 | 3300005364 | Bacteria | 5679 |
| 66 | Ga0070673_100090533 | 3300005364 | Bacteria | 2499 |
| 67 | Ga0070673_100168440 | 3300005364 | Bacteria | 1868 |
| 68 | Ga0070673_100504370 | 3300005364 | Bacteria | 1095 |
| 69 | Ga0070659_100023121 | 3300005366 | Bacteria | 4752 |
| 70 | Ga0070659_100143512 | 3300005366 | Bacteria | 1944 |
| 71 | Ga0070659_100149803 | 3300005366 | Bacteria | 1903 |
| 72 | Ga0070659_100214018 | 3300005366 | Bacteria | 1589 |
| 73 | Ga0070659_100248607 | 3300005366 | Bacteria | 1473 |
| 74 | Ga0070667_100040495 | 3300005367 | Bacteria | 3907 |
| 75 | Ga0070667_100122321 | 3300005367 | Bacteria | 2265 |
| 76 | Ga0070667_100334121 | 3300005367 | Bacteria | 1369 |
| 77 | Ga0070667_100385435 | 3300005367 | Bacteria | 1274 |
| 78 | Ga0070667_100634877 | 3300005367 | Bacteria | 985 |
| 79 | Ga0070667_100832733 | 3300005367 | Bacteria | 857 |
| 80 | Ga0070714_100042688 | 3300005435 | Bacteria | 3832 |
| 81 | Ga0070714_100374999 | 3300005435 | Bacteria | 1340 |
| 82 | Ga0070713_100056520 | 3300005436 | Bacteria | 3264 |
| 83 | Ga0070694_100167802 | 3300005444 | Bacteria | 1615 |
| 84 | Ga0070663_100007211 | 3300005455 | Bacteria | 6753 |
| 85 | Ga0070663_100021827 | 3300005455 | Bacteria | 4265 |
| 86 | Ga0070663_100025599 | 3300005455 | Bacteria | 3986 |
| 87 | Ga0070663_100061842 | 3300005455 | Bacteria | 2698 |
| 88 | Ga0070663_100101244 | 3300005455 | Bacteria | 2150 |
| 89 | Ga0070678_100021464 | 3300005456 | Bacteria | 4258 |
| 90 | Ga0070678_100055768 | 3300005456 | Bacteria | 2886 |
| 91 | Ga0070662_100003264 | 3300005457 | Bacteria | 10090 |
| 92 | Ga0070662_100286832 | 3300005457 | Bacteria | 1333 |
| 93 | Ga0070662_100302892 | 3300005457 | Bacteria | 1299 |
| 94 | Ga0070662_101095666 | 3300005457 | Bacteria | 683 |
| 95 | Ga0070681_10531807 | 3300005458 | Unclassified | 1089 |
| 96 | Ga0068867_100002869 | 3300005459 | Bacteria | 12129 |
| 97 | Ga0068867_100058279 | 3300005459 | Bacteria | 2862 |
| 98 | Ga0068867_100145751 | 3300005459 | Bacteria | 1855 |
| 99 | Ga0068867_100154331 | 3300005459 | Bacteria | 1806 |
| 100 | Ga0070685_10135386 | 3300005466 | Bacteria | 1545 |
| 101 | Ga0070706_100248834 | 3300005467 | Bacteria | 1660 |
| 102 | Ga0070679_100439976 | 3300005530 | Bacteria | 1249 |
| 103 | Ga0068853_100036747 | 3300005539 | Bacteria | 4166 |
| 104 | Ga0068853_100079809 | 3300005539 | Bacteria | 2862 |
| 105 | Ga0070672_100000482 | 3300005543 | Bacteria | 23162 |
| 106 | Ga0070672_100085728 | 3300005543 | Bacteria | 2532 |
| 107 | Ga0070672_100118015 | 3300005543 | Bacteria | 2169 |
| 108 | Ga0070672_100247642 | 3300005543 | Bacteria | 1500 |
| 109 | Ga0070672_100851320 | 3300005543 | Bacteria | 804 |
| 110 | Ga0070672_100879626 | 3300005543 | Bacteria | 791 |
| 111 | Ga0070686_100129525 | 3300005544 | Bacteria | 1743 |
| 112 | Ga0070695_100023104 | 3300005545 | Bacteria | 3818 |
| 113 | Ga0070696_100006532 | 3300005546 | Bacteria | 7787 |
| 114 | Ga0070693_100205124 | 3300005547 | Bacteria | 1283 |
| 115 | Ga0070693_100318725 | 3300005547 | Bacteria | 1054 |
| 116 | Ga0070665_100016225 | 3300005548 | Bacteria | 7473 |
| 117 | Ga0070665_100138768 | 3300005548 | Bacteria | 2434 |
| 118 | Ga0068855_100127353 | 3300005563 | Bacteria | 2911 |
| 119 | Ga0068855_100853875 | 3300005563 | Bacteria | 964 |
| 120 | Ga0070664_100030419 | 3300005564 | Bacteria | 4505 |
| 121 | Ga0070664_100038109 | 3300005564 | Bacteria | 4045 |
| 122 | Ga0070664_100141257 | 3300005564 | Bacteria | 2120 |
| 123 | Ga0070664_100191258 | 3300005564 | Bacteria | 1823 |
| 124 | Ga0068857_100332360 | 3300005577 | Bacteria | 1405 |
| 125 | Ga0068854_100015826 | 3300005578 | Bacteria | 5010 |
| 126 | Ga0068854_100091847 | 3300005578 | Bacteria | 2260 |
| 127 | Ga0068854_100366947 | 3300005578 | Bacteria | 1183 |
| 128 | Ga0068856_100042138 | 3300005614 | Bacteria | 4490 |
| 129 | Ga0068856_100278743 | 3300005614 | Bacteria | 1689 |
| 130 | Ga0068856_100334270 | 3300005614 | Bacteria | 1533 |
| 131 | Ga0068852_100012312 | 3300005616 | Bacteria | 6489 |
| 132 | Ga0068852_100036248 | 3300005616 | Bacteria | 4125 |
| 133 | Ga0068852_100074676 | 3300005616 | Bacteria | 2987 |
| 134 | Ga0068852_100093094 | 3300005616 | Bacteria | 2700 |
| 135 | Ga0068852_100242350 | 3300005616 | Bacteria | 1724 |
| 136 | Ga0068859_100003354 | 3300005617 | Bacteria | 16292 |
| 137 | Ga0068859_100014674 | 3300005617 | Bacteria | 7873 |
| 138 | Ga0068859_100069745 | 3300005617 | Bacteria | 3550 |
| 139 | Ga0068859_100106596 | 3300005617 | Bacteria | 2862 |
| 140 | Ga0068859_100552657 | 3300005617 | Bacteria | 1246 |
| 141 | Ga0068864_100089105 | 3300005618 | Bacteria | 2718 |
| 142 | Ga0068864_100098577 | 3300005618 | Bacteria | 2589 |
| 143 | Ga0068866_10004001 | 3300005718 | Bacteria | 6053 |
| 144 | Ga0068866_10005219 | 3300005718 | Bacteria | 5352 |
| 145 | Ga0068866_10131801 | 3300005718 | Bacteria | 1423 |
| 146 | Ga0068861_100203868 | 3300005719 | Bacteria | 1662 |
| 147 | Ga0068851_10003876 | 3300005834 | Bacteria | 6697 |
| 148 | Ga0068851_10009411 | 3300005834 | Bacteria | 4543 |
| 149 | Ga0068870_10033540 | 3300005840 | Bacteria | 2620 |
| 150 | Ga0068870_10131204 | 3300005840 | Bacteria | 1456 |
| 151 | Ga0068863_100001961 | 3300005841 | Bacteria | 20447 |
| 152 | Ga0068863_100138621 | 3300005841 | Bacteria | 2324 |
| 153 | Ga0068863_100264835 | 3300005841 | Bacteria | 1662 |
| 154 | Ga0068858_100001063 | 3300005842 | Bacteria | 28439 |
| 155 | Ga0068858_100080260 | 3300005842 | Bacteria | 3031 |
| 156 | Ga0068858_100549613 | 3300005842 | Bacteria | 1118 |
| 157 | Ga0068860_100100415 | 3300005843 | Bacteria | 2761 |
| 158 | Ga0068860_100147325 | 3300005843 | Bacteria | 2265 |
| 159 | Ga0068860_101177625 | 3300005843 | Bacteria | 786 |
| 160 | Ga0068862_100005659 | 3300005844 | Bacteria | 10428 |
| 161 | Ga0068862_100264722 | 3300005844 | Bacteria | 1570 |
| 162 | Ga0068862_100759856 | 3300005844 | Bacteria | 944 |
| 163 | Ga0070717_10028934 | 3300006028 | Bacteria | 4441 |
| 164 | Ga0075365_10330841 | 3300006038 | Bacteria | 1073 |
| 165 | Ga0070716_100030809 | 3300006173 | Bacteria | 2914 |
| 166 | Ga0070712_100010413 | 3300006175 | Bacteria | 5866 |
| 167 | Ga0097621_100104514 | 3300006237 | Bacteria | 2387 |
| 168 | Ga0097621_100827397 | 3300006237 | Bacteria | 859 |
| 169 | Ga0068871_100013156 | 3300006358 | Bacteria | 6136 |
| 170 | Ga0068865_100004584 | 3300006881 | Bacteria | 8340 |
| 171 | Ga0068865_100277693 | 3300006881 | Bacteria | 1333 |
| 172 | Ga0097620_100003354 | 3300006931 | Bacteria | 16292 |
| 173 | Ga0097620_100014673 | 3300006931 | Bacteria | 7873 |
| 174 | Ga0097620_100069748 | 3300006931 | Bacteria | 3550 |
| 175 | Ga0097620_100106595 | 3300006931 | Bacteria | 2862 |
| 176 | Ga0097620_100552648 | 3300006931 | Bacteria | 1246 |
| 177 | Ga0105240_10373909 | 3300009093 | Bacteria | 1611 |
| 178 | Ga0105245_10017352 | 3300009098 | Bacteria | 6280 |
| 179 | Ga0105245_10019353 | 3300009098 | Bacteria | 5961 |
| 180 | Ga0114129_10593315 | 3300009147 | Bacteria | 1436 |
| 181 | Ga0105243_10244968 | 3300009148 | Bacteria | 1597 |
| 182 | Ga0105242_10002696 | 3300009176 | Bacteria | 13894 |
| 183 | Ga0105242_10296319 | 3300009176 | Bacteria | 1474 |
| 184 | Ga0105248_10057467 | 3300009177 | Bacteria | 4367 |
| 185 | Ga0105248_10097345 | 3300009177 | Bacteria | 3315 |
| 186 | Ga0105248_10123267 | 3300009177 | Bacteria | 2924 |
| 187 | Ga0105248_10150526 | 3300009177 | Bacteria | 2625 |
| 188 | Ga0105248_10200160 | 3300009177 | Bacteria | 2250 |
| 189 | Ga0105248_10239202 | 3300009177 | Bacteria | 2044 |
| 190 | Ga0105248_10285213 | 3300009177 | Bacteria | 1859 |
| 191 | Ga0105248_10495441 | 3300009177 | Bacteria | 1377 |
| 192 | Ga0105248_11442376 | 3300009177 | Bacteria | 779 |
| 193 | Ga0105237_10554693 | 3300009545 | Bacteria | 1156 |
| 194 | Ga0105238_10074784 | 3300009551 | Bacteria | 3380 |
| 195 | Ga0105238_10281994 | 3300009551 | Bacteria | 1643 |
| 196 | Ga0105238_10389906 | 3300009551 | Bacteria | 1385 |
| 197 | Ga0105239_10046622 | 3300010375 | Bacteria | 4749 |
| 198 | Ga0157373_10119369 | 3300013100 | Bacteria | 1853 |
| 199 | Ga0157373_10187142 | 3300013100 | Bacteria | 1459 |
| 200 | Ga0157371_10005796 | 3300013102 | Bacteria | 10340 |
| 201 | Ga0157371_10261242 | 3300013102 | Bacteria | 1248 |
| 202 | Ga0157370_10086037 | 3300013104 | Bacteria | 2954 |
| 203 | Ga0157370_10339489 | 3300013104 | Bacteria | 1385 |
| 204 | Ga0157369_10206595 | 3300013105 | Bacteria | 2059 |
| 205 | Ga0157374_10000688 | 3300013296 | Bacteria | 29808 |
| 206 | Ga0157374_10018582 | 3300013296 | Bacteria | 6138 |
| 207 | Ga0157374_10067803 | 3300013296 | Bacteria | 3356 |
| 208 | Ga0157374_10419440 | 3300013296 | Bacteria | 1337 |
| 209 | Ga0157378_10182570 | 3300013297 | Bacteria | 1974 |
| 210 | Ga0163162_10216505 | 3300013306 | Bacteria | 2045 |
| 211 | Ga0163162_10240053 | 3300013306 | Bacteria | 1943 |
| 212 | Ga0157372_10506167 | 3300013307 | Bacteria | 1408 |
| 213 | Ga0157372_11024391 | 3300013307 | Bacteria | 956 |
| 214 | Ga0157375_10028047 | 3300013308 | Bacteria | 5272 |
| 215 | Ga0157375_10104755 | 3300013308 | Bacteria | 2918 |
| 216 | Ga0157375_10118248 | 3300013308 | Bacteria | 2757 |
| 217 | Ga0157375_10184436 | 3300013308 | Bacteria | 2239 |
| 218 | Ga0157375_10541402 | 3300013308 | Bacteria | 1326 |
| 219 | Ga0163163_10033263 | 3300014325 | Bacteria | 4987 |
| 220 | Ga0163163_10712313 | 3300014325 | Bacteria | 1067 |
| 221 | Ga0157379_10036388 | 3300014968 | Bacteria | 4390 |
| 222 | Ga0157379_10129648 | 3300014968 | Bacteria | 2269 |
| 223 | Ga0157379_10193202 | 3300014968 | Bacteria | 1839 |
| 224 | Ga0157376_10020862 | 3300014969 | Bacteria | 5078 |
| 225 | Ga0213876_10074375 | 3300021384 | Bacteria | 1794 |
| 226 | Ga0213875_10004443 | 3300021388 | Bacteria | 7699 |
| 227 | Ga0207697_10008065 | 3300025315 | Bacteria | 4647 |
| 228 | Ga0207697_10011363 | 3300025315 | Bacteria | 3767 |
| 229 | Ga0207656_10168284 | 3300025321 | Bacteria | 1046 |
| 230 | Ga0207682_10003391 | 3300025893 | Bacteria | 6936 |
| 231 | Ga0207682_10012163 | 3300025893 | Bacteria | 3360 |
| 232 | Ga0207682_10049271 | 3300025893 | Bacteria | 1739 |
| 233 | Ga0207642_10125270 | 3300025899 | Bacteria | 1332 |
| 234 | Ga0207688_10025127 | 3300025901 | Bacteria | 3269 |
| 235 | Ga0207680_10004711 | 3300025903 | Bacteria | 6484 |
| 236 | Ga0207680_10015753 | 3300025903 | Bacteria | 3953 |
| 237 | Ga0207680_10145817 | 3300025903 | Bacteria | 1573 |
| 238 | Ga0207647_10004799 | 3300025904 | Bacteria | 10005 |
| 239 | Ga0207647_10014821 | 3300025904 | Bacteria | 5362 |
| 240 | Ga0207647_10157330 | 3300025904 | Bacteria | 1326 |
| 241 | Ga0207645_10023605 | 3300025907 | Bacteria | 3994 |
| 242 | Ga0207643_10096149 | 3300025908 | Bacteria | 1732 |
| 243 | Ga0207643_10270556 | 3300025908 | Bacteria | 1051 |
| 244 | Ga0207705_10017883 | 3300025909 | Bacteria | 5070 |
| 245 | Ga0207705_10028159 | 3300025909 | Bacteria | 4006 |
| 246 | Ga0207705_10099952 | 3300025909 | Bacteria | 2133 |
| 247 | Ga0207705_10137685 | 3300025909 | Bacteria | 1821 |
| 248 | Ga0207705_10182489 | 3300025909 | Bacteria | 1584 |
| 249 | Ga0207705_10208989 | 3300025909 | Bacteria | 1480 |
| 250 | Ga0207684_10322330 | 3300025910 | Bacteria | 1332 |
| 251 | Ga0207707_10257532 | 3300025912 | Bacteria | 1515 |
| 252 | Ga0207707_10576242 | 3300025912 | Unclassified | 954 |
| 253 | Ga0207695_10252223 | 3300025913 | Bacteria | 1664 |
| 254 | Ga0207693_10020143 | 3300025915 | Bacteria | 5306 |
| 255 | Ga0207657_10031106 | 3300025919 | Bacteria | 4839 |
| 256 | Ga0207657_10039319 | 3300025919 | Bacteria | 4205 |
| 257 | Ga0207657_10042957 | 3300025919 | Bacteria | 3985 |
| 258 | Ga0207657_10132709 | 3300025919 | Bacteria | 2040 |
| 259 | Ga0207657_10207610 | 3300025919 | Bacteria | 1573 |
| 260 | Ga0207657_10231699 | 3300025919 | Bacteria | 1477 |
| 261 | Ga0207657_10260301 | 3300025919 | Bacteria | 1381 |
| 262 | Ga0207657_10314356 | 3300025919 | Bacteria | 1239 |
| 263 | Ga0207657_10330439 | 3300025919 | Bacteria | 1204 |
| 264 | Ga0207657_10656807 | 3300025919 | Bacteria | 816 |
| 265 | Ga0207649_10028121 | 3300025920 | Bacteria | 3308 |
| 266 | Ga0207649_10095519 | 3300025920 | Bacteria | 1956 |
| 267 | Ga0207649_10214436 | 3300025920 | Bacteria | 1367 |
| 268 | Ga0207649_10372656 | 3300025920 | Bacteria | 1062 |
| 269 | Ga0207652_10258022 | 3300025921 | Bacteria | 1572 |
| 270 | Ga0207681_10176013 | 3300025923 | Bacteria | 1626 |
| 271 | Ga0207694_10087365 | 3300025924 | Bacteria | 2456 |
| 272 | Ga0207650_10442296 | 3300025925 | Bacteria | 1081 |
| 273 | Ga0207659_10054284 | 3300025926 | Bacteria | 2861 |
| 274 | Ga0207687_10294734 | 3300025927 | Bacteria | 1305 |
| 275 | Ga0207664_10092944 | 3300025929 | Bacteria | 2477 |
| 276 | Ga0207644_10000196 | 3300025931 | Bacteria | 43119 |
| 277 | Ga0207644_10024755 | 3300025931 | Bacteria | 4123 |
| 278 | Ga0207644_10083987 | 3300025931 | Bacteria | 2359 |
| 279 | Ga0207644_10094735 | 3300025931 | Bacteria | 2231 |
| 280 | Ga0207644_10211758 | 3300025931 | Bacteria | 1533 |
| 281 | Ga0207644_10265214 | 3300025931 | Bacteria | 1374 |
| 282 | Ga0207644_10336153 | 3300025931 | Bacteria | 1224 |
| 283 | Ga0207690_10056203 | 3300025932 | Bacteria | 2654 |
| 284 | Ga0207690_10059565 | 3300025932 | Bacteria | 2587 |
| 285 | Ga0207690_10076399 | 3300025932 | Bacteria | 2326 |
| 286 | Ga0207706_10000840 | 3300025933 | Bacteria | 31741 |
| 287 | Ga0207706_10004449 | 3300025933 | Bacteria | 13166 |
| 288 | Ga0207706_10022419 | 3300025933 | Bacteria | 5668 |
| 289 | Ga0207706_10215242 | 3300025933 | Bacteria | 1683 |
| 290 | Ga0207706_10243416 | 3300025933 | Bacteria | 1572 |
| 291 | Ga0207709_10331398 | 3300025935 | Bacteria | 1143 |
| 292 | Ga0207670_10178205 | 3300025936 | Bacteria | 1599 |
| 293 | Ga0207669_10061892 | 3300025937 | Bacteria | 2302 |
| 294 | Ga0207704_10638721 | 3300025938 | Bacteria | 875 |
| 295 | Ga0207691_10000705 | 3300025940 | Bacteria | 33075 |
| 296 | Ga0207691_10015370 | 3300025940 | Bacteria | 7283 |
| 297 | Ga0207691_10026477 | 3300025940 | Bacteria | 5440 |
| 298 | Ga0207691_10059530 | 3300025940 | Bacteria | 3472 |
| 299 | Ga0207691_10103966 | 3300025940 | Bacteria | 2532 |
| 300 | Ga0207691_10526373 | 3300025940 | Bacteria | 1003 |
| 301 | Ga0207691_10591179 | 3300025940 | Bacteria | 940 |
| 302 | Ga0207711_10000826 | 3300025941 | Bacteria | 30270 |
| 303 | Ga0207711_10005440 | 3300025941 | Bacteria | 10766 |
| 304 | Ga0207711_10005651 | 3300025941 | Bacteria | 10566 |
| 305 | Ga0207711_10398973 | 3300025941 | Bacteria | 1278 |
| 306 | Ga0207711_10727142 | 3300025941 | Bacteria | 926 |
| 307 | Ga0207689_10010936 | 3300025942 | Bacteria | 7801 |
| 308 | Ga0207661_10234000 | 3300025944 | Bacteria | 1628 |
| 309 | Ga0207661_10412039 | 3300025944 | Bacteria | 1227 |
| 310 | Ga0207679_10023034 | 3300025945 | Bacteria | 4251 |
| 311 | Ga0207679_10076662 | 3300025945 | Bacteria | 2541 |
| 312 | Ga0207679_10086567 | 3300025945 | Bacteria | 2410 |
| 313 | Ga0207679_10122637 | 3300025945 | Bacteria | 2072 |
| 314 | Ga0207679_10367917 | 3300025945 | Bacteria | 1257 |
| 315 | Ga0207667_10060438 | 3300025949 | Bacteria | 3966 |
| 316 | Ga0207667_10136274 | 3300025949 | Bacteria | 2528 |
| 317 | Ga0207651_10000999 | 3300025960 | Bacteria | 12480 |
| 318 | Ga0207651_10026562 | 3300025960 | Bacteria | 3620 |
| 319 | Ga0207651_10078621 | 3300025960 | Bacteria | 2367 |
| 320 | Ga0207651_10095478 | 3300025960 | Bacteria | 2190 |
| 321 | Ga0207651_10160136 | 3300025960 | Bacteria | 1763 |
| 322 | Ga0207651_10370540 | 3300025960 | Bacteria | 1211 |
| 323 | Ga0207668_10191711 | 3300025972 | Bacteria | 1620 |
| 324 | Ga0207668_10286224 | 3300025972 | Bacteria | 1354 |
| 325 | Ga0207668_10597214 | 3300025972 | Bacteria | 961 |
| 326 | Ga0207640_10179242 | 3300025981 | Bacteria | 1587 |
| 327 | Ga0207640_10246742 | 3300025981 | Bacteria | 1383 |
| 328 | Ga0207640_10713191 | 3300025981 | Bacteria | 861 |
| 329 | Ga0207658_10008208 | 3300025986 | Bacteria | 7114 |
| 330 | Ga0207658_10021355 | 3300025986 | Bacteria | 4493 |
| 331 | Ga0207658_10033791 | 3300025986 | Bacteria | 3649 |
| 332 | Ga0207658_10156901 | 3300025986 | Bacteria | 1861 |
| 333 | Ga0207658_10707872 | 3300025986 | Bacteria | 910 |
| 334 | Ga0207658_10769948 | 3300025986 | Bacteria | 872 |
| 335 | Ga0207677_10009046 | 3300026023 | Bacteria | 5589 |
| 336 | Ga0207677_10018096 | 3300026023 | Bacteria | 4222 |
| 337 | Ga0207677_10021077 | 3300026023 | Bacteria | 3974 |
| 338 | Ga0207677_10117830 | 3300026023 | Bacteria | 1991 |
| 339 | Ga0207677_10409135 | 3300026023 | Bacteria | 1152 |
| 340 | Ga0207703_10008014 | 3300026035 | Bacteria | 8349 |
| 341 | Ga0207703_10069607 | 3300026035 | Bacteria | 2902 |
| 342 | Ga0207703_10182061 | 3300026035 | Bacteria | 1855 |
| 343 | Ga0207703_10337034 | 3300026035 | Bacteria | 1385 |
| 344 | Ga0207639_10107899 | 3300026041 | Bacteria | 2263 |
| 345 | Ga0207639_10135502 | 3300026041 | Bacteria | 2044 |
| 346 | Ga0207639_10158071 | 3300026041 | Bacteria | 1907 |
| 347 | Ga0207639_10166460 | 3300026041 | Bacteria | 1863 |
| 348 | Ga0207678_10001628 | 3300026067 | Bacteria | 20589 |
| 349 | Ga0207678_10004245 | 3300026067 | Bacteria | 12855 |
| 350 | Ga0207678_10009726 | 3300026067 | Bacteria | 8455 |
| 351 | Ga0207678_10010002 | 3300026067 | Bacteria | 8323 |
| 352 | Ga0207678_10060651 | 3300026067 | Bacteria | 3253 |
| 353 | Ga0207678_10151122 | 3300026067 | Bacteria | 1983 |
| 354 | Ga0207678_10163402 | 3300026067 | Bacteria | 1902 |
| 355 | Ga0207702_10027154 | 3300026078 | Bacteria | 4753 |
| 356 | Ga0207641_10029710 | 3300026088 | Bacteria | 4521 |
| 357 | Ga0207641_10060791 | 3300026088 | Bacteria | 3221 |
| 358 | Ga0207641_10188806 | 3300026088 | Bacteria | 1892 |
| 359 | Ga0207648_10000889 | 3300026089 | Bacteria | 33700 |
| 360 | Ga0207648_10009239 | 3300026089 | Bacteria | 9469 |
| 361 | Ga0207648_10239787 | 3300026089 | Bacteria | 1614 |
| 362 | Ga0207676_10094294 | 3300026095 | Bacteria | 2466 |
| 363 | Ga0207676_10143031 | 3300026095 | Bacteria | 2050 |
| 364 | Ga0207676_10395544 | 3300026095 | Bacteria | 1290 |
| 365 | Ga0207674_10350189 | 3300026116 | Bacteria | 1428 |
| 366 | Ga0207675_100610585 | 3300026118 | Bacteria | 1094 |
| 367 | Ga0207683_10001943 | 3300026121 | Bacteria | 18297 |
| 368 | Ga0207683_10002694 | 3300026121 | Bacteria | 15527 |
| 369 | Ga0207683_10142139 | 3300026121 | Bacteria | 2163 |
| 370 | Ga0207683_10292282 | 3300026121 | Bacteria | 1490 |
| 371 | Ga0207698_10005796 | 3300026142 | Bacteria | 7668 |
| 372 | Ga0207698_10252468 | 3300026142 | Bacteria | 1615 |
| 373 | Ga0207698_10313869 | 3300026142 | Bacteria | 1465 |
| 374 | Ga0268266_10029060 | 3300028379 | Bacteria | 4698 |
| 375 | Ga0268266_10166205 | 3300028379 | Bacteria | 1999 |
| 376 | Ga0268265_10003952 | 3300028380 | Bacteria | 10443 |
| 377 | Ga0268265_10260527 | 3300028380 | Bacteria | 1541 |
| 378 | Ga0268265_10260898 | 3300028380 | Bacteria | 1540 |
| 379 | Ga0268264_10124925 | 3300028381 | Bacteria | 2273 |
| 380 | Ga0268264_10144671 | 3300028381 | Bacteria | 2124 |
| 381 | Ga0268264_10363903 | 3300028381 | Bacteria | 1380 |
| 382 | Ga0307408_100032429 | 3300031548 | Bacteria | 3642 |
| 383 | Ga0307408_100042329 | 3300031548 | Bacteria | 3234 |
| 384 | Ga0307405_10012233 | 3300031731 | Bacteria | 4533 |
| 385 | Ga0307405_10131603 | 3300031731 | Bacteria | 1729 |
| 386 | Ga0307405_10286788 | 3300031731 | Bacteria | 1242 |
| 387 | Ga0307405_10460207 | 3300031731 | Bacteria | 1011 |
| 388 | Ga0307413_10332985 | 3300031824 | Bacteria | 1164 |
| 389 | Ga0307410_10002455 | 3300031852 | Bacteria | 8952 |
| 390 | Ga0307410_10064236 | 3300031852 | Bacteria | 2521 |
| 391 | Ga0307410_10476803 | 3300031852 | Bacteria | 1023 |
| 392 | Ga0307406_10009362 | 3300031901 | Bacteria | 5491 |
| 393 | Ga0307407_10051046 | 3300031903 | Bacteria | 2369 |
| 394 | Ga0307407_10199116 | 3300031903 | Bacteria | 1341 |
| 395 | Ga0307412_10020992 | 3300031911 | Bacteria | 3983 |
| 396 | Ga0307412_10064806 | 3300031911 | Bacteria | 2470 |
| 397 | Ga0307409_100182249 | 3300031995 | Bacteria | 1860 |
| 398 | Ga0307409_100643043 | 3300031995 | Bacteria | 1053 |
| 399 | Ga0307414_10254795 | 3300032004 | Bacteria | 1461 |
| 400 | Ga0307411_10061374 | 3300032005 | Bacteria | 2502 |
| 401 | Ga0307411_10272209 | 3300032005 | Bacteria | 1343 |
| 402 | Ga0307411_10759268 | 3300032005 | Bacteria | 850 |
| 403 | Ga0307415_100080796 | 3300032126 | Bacteria | 2320 |
| 404 | Ga0307415_100102676 | 3300032126 | Bacteria | 2101 |
| 405 | Ga0373928_0097196 | 3300035084 | Bacteria | 763 |
| 406 | Ga0373923_0178101 | 3300035111 | Bacteria | 976 |
| 407 | Ga0373935_0024057 | 3300035692 | Bacteria | 3746 |
| 408 | Ga0395899_0000103 | 3300037312 | Bacteria | 147274 |
| 409 | Ga0395899_0031413 | 3300037312 | Bacteria | 3991 |
| 410 | Ga0395899_0038808 | 3300037312 | Bacteria | 3566 |
| 411 | Ga0395899_0084262 | 3300037312 | Bacteria | 2310 |
| 412 | Ga0395899_0100349 | 3300037312 | Bacteria | 2090 |
| 413 | Ga0395899_0295250 | 3300037312 | Bacteria | 1098 |
| 414 | Ga0395900_0000031 | 3300037418 | Bacteria | 262393 |
| 415 | Ga0395900_0000862 | 3300037418 | Bacteria | 40012 |
| 416 | Ga0395900_0002384 | 3300037418 | Bacteria | 20759 |
| 417 | Ga0395900_0013399 | 3300037418 | Bacteria | 8377 |
| 418 | Ga0395900_0063590 | 3300037418 | Bacteria | 3793 |
| 419 | Ga0395900_0203635 | 3300037418 | Bacteria | 2001 |
| 420 | Ga0395900_0263696 | 3300037418 | Bacteria | 1719 |
| 421 | Ga0395900_0284787 | 3300037418 | Bacteria | 1643 |
| 422 | Ga0395900_0289330 | 3300037418 | Bacteria | 1627 |
| 423 | Ga0395900_0434466 | 3300037418 | Bacteria | 1271 |
| 424 | Ga0395900_0597365 | 3300037418 | Bacteria | 1044 |
| 425 | Ga0395898_0000053 | 3300037466 | Bacteria | 279600 |
| 426 | Ga0395898_0003373 | 3300037466 | Bacteria | 17893 |
| 427 | Ga0395898_0055086 | 3300037466 | Bacteria | 3879 |
| 428 | Ga0395898_0058977 | 3300037466 | Bacteria | 3735 |
| 429 | Ga0395898_0085812 | 3300037466 | Bacteria | 3034 |
| 430 | Ga0395898_0157671 | 3300037466 | Bacteria | 2171 |
| 431 | Ga0395898_0211248 | 3300037466 | Bacteria | 1851 |
| 432 | Ga0395898_0241905 | 3300037466 | Bacteria | 1721 |
| 433 | Ga0395898_0250029 | 3300037466 | Bacteria | 1691 |
| 434 | Ga0395898_0376696 | 3300037466 | Bacteria | 1353 |
| 435 | Ga0395905_0000031 | 3300037471 | Bacteria | 286757 |
| 436 | Ga0395905_0000365 | 3300037471 | Bacteria | 64175 |
| 437 | Ga0395905_0027046 | 3300037471 | Bacteria | 5409 |
| 438 | Ga0395905_0066499 | 3300037471 | Bacteria | 3375 |
| 439 | Ga0395905_0099067 | 3300037471 | Bacteria | 2737 |
| 440 | Ga0395905_0153227 | 3300037471 | Bacteria | 2168 |
| 441 | Ga0395905_0342313 | 3300037471 | Bacteria | 1386 |
| 442 | Ga0395905_0488765 | 3300037471 | Bacteria | 1130 |
| 443 | Ga0395905_0498737 | 3300037471 | Bacteria | 1117 |
| 444 | Ga0436364_1311127 | 3300037853 | Bacteria | 690 |
| 445 | Ga0436364_1360610 | 3300037853 | Bacteria | 32497 |
| 446 | Ga0395901_0000163 | 3300038443 | Bacteria | 87103 |
| 447 | Ga0395901_0002051 | 3300038443 | Bacteria | 20650 |
| 448 | Ga0395901_0035805 | 3300038443 | Bacteria | 5129 |
| 449 | Ga0395901_0042145 | 3300038443 | Bacteria | 4732 |
| 450 | Ga0395901_0134999 | 3300038443 | Bacteria | 2593 |
| 451 | Ga0395901_0172036 | 3300038443 | Bacteria | 2272 |
| 452 | Ga0395901_0210614 | 3300038443 | Bacteria | 2034 |
| 453 | Ga0395901_0245226 | 3300038443 | Bacteria | 1867 |
| 454 | Ga0395901_0251891 | 3300038443 | Bacteria | 1839 |
| 455 | Ga0395901_0330627 | 3300038443 | Bacteria | 1575 |
| 456 | Ga0395901_0803286 | 3300038443 | Bacteria | 929 |
| 457 | Ga0395901_0939074 | 3300038443 | Bacteria | 844 |
| 458 | Ga0436365_0504349 | 3300039437 | Bacteria | 9584 |
| 459 | Ga0436363_0214937 | 3300039450 | Bacteria | 778 |
| 460 | Ga0439438_031102 | 3300041405 | Bacteria | 1420 |
| 461 | Ga0450905_005530 | 3300042142 | Bacteria | 1698 |
| 462 | Ga0450889_000034 | 3300042144 | Bacteria | 11809 |
| 463 | Ga0439464_0007229 | 3300042439 | Bacteria | 2902 |
| 464 | Ga0466965_0161247 | 3300044683 | Bacteria | 1176 |
| 465 | Ga0466963_0003565 | 3300044694 | Bacteria | 8939 |
| 466 | Ga0466963_0007455 | 3300044694 | Bacteria | 6524 |
| 467 | Ga0466963_0050713 | 3300044694 | Bacteria | 2747 |
| 468 | Ga0466963_0117592 | 3300044694 | Bacteria | 1827 |
| 469 | Ga0466971_0001977 | 3300044719 | Bacteria | 8670 |
| 470 | Ga0466957_0026243 | 3300044842 | Bacteria | 3455 |
| 471 | Ga0466960_0006351 | 3300044901 | Bacteria | 4739 |
| 472 | Ga0466960_0261844 | 3300044901 | Bacteria | 964 |
| 473 | Ga0466958_0003049 | 3300045836 | Bacteria | 8588 |
| 474 | Ga0466967_0036370 | 3300045976 | Bacteria | 4203 |
| 475 | Ga0466967_0052221 | 3300045976 | Bacteria | 3587 |
| 476 | Ga0466967_0053129 | 3300045976 | Bacteria | 3560 |
| 477 | Ga0466967_0183430 | 3300045976 | Bacteria | 1975 |
| 478 | Ga0466967_0501958 | 3300045976 | Bacteria | 1191 |
| 479 | Ga0495598_0007122 | 3300046537 | Bacteria | 2553 |
| 480 | Ga0495633_0077772 | 3300046558 | Bacteria | 1545 |
| 481 | Ga0495669_0021229 | 3300046684 | Bacteria | 2817 |
| 482 | Ga0495669_0040505 | 3300046684 | Bacteria | 2066 |
| 483 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 484 | Ga0495670_0001581 | 3300046691 | Bacteria | 11130 |
| 485 | Ga0495649_0117925 | 3300046694 | Bacteria | 1405 |
| 486 | Ga0496100_0005386 | 3300048903 | Bacteria | 6884 |
| 487 | Ga0496101_0006613 | 3300048904 | Bacteria | 7469 |
| 488 | Ga0496101_0020211 | 3300048904 | Bacteria | 4553 |
| 489 | Ga0496102_0046197 | 3300048905 | Bacteria | 3954 |
| 490 | Ga0496102_0403847 | 3300048905 | Bacteria | 1284 |
| 491 | Ga0496103_0010493 | 3300048906 | Bacteria | 5483 |
| 492 | Ga0496104_0034086 | 3300048907 | Bacteria | 4745 |
| 493 | Ga0496105_0097795 | 3300048908 | Bacteria | 2424 |
| 494 | Ga0496106_0003808 | 3300048909 | Bacteria | 11240 |
| 495 | Ga0496106_0176142 | 3300048909 | Bacteria | 1697 |
| 496 | Ga0496107_0009640 | 3300048910 | Bacteria | 6695 |
| 497 | Ga0496107_0381868 | 3300048910 | Bacteria | 1048 |
| 498 | Ga0496108_0000396 | 3300048911 | Bacteria | 35971 |
| 499 | Ga0496108_0313186 | 3300048911 | Bacteria | 1368 |
| 500 | Ga0496108_0487484 | 3300048911 | Bacteria | 1077 |
| 501 | Ga0496109_0003559 | 3300048912 | Bacteria | 13006 |
| 502 | Ga0496109_0199074 | 3300048912 | Bacteria | 1883 |
| 503 | Ga0496110_0002181 | 3300048913 | Bacteria | 14631 |
| 504 | Ga0496111_0000917 | 3300048914 | Bacteria | 16063 |
| 505 | Ga0496112_0003726 | 3300048915 | Bacteria | 12722 |
| 506 | Ga0496112_0054159 | 3300048915 | Bacteria | 3941 |
| 507 | Ga0496112_0165703 | 3300048915 | Bacteria | 2176 |
| 508 | Ga0496113_0002217 | 3300048916 | Bacteria | 11210 |
| 509 | Ga0496113_0107789 | 3300048916 | Bacteria | 2165 |
| 510 | Ga0496114_0000152 | 3300048917 | Bacteria | 50128 |
| 511 | Ga0496115_0011238 | 3300048918 | Bacteria | 6709 |
| 512 | Ga0501067_0236146 | 3300049583 | Bacteria | 1017 |
| 513 | Ga0501249_034346 | 3300049679 | Bacteria | 1137 |
| 514 | nmdc:mga05p37_230730_c1 | 3300050507 | Bacteria | 2230 |
| 515 | Ga0500583_0317756 | 3300053092 | Bacteria | 760 |
| 516 | Ga0500641_0005984 | 3300053096 | Bacteria | 4305 |
| 517 | Ga0500559_0224704 | 3300053136 | Bacteria | 885 |
| 518 | Ga0500588_0042173 | 3300053146 | Bacteria | 1381 |
| 519 | Ga0500645_005952 | 3300053730 | Bacteria | 4415 |
| 520 | Ga0466962_0003110 | 3300061719 | Bacteria | 7886 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100279175 | Ga0070670_1002791751 | 194 |
| 2 | 3300025944 | Ga0207661_10412039 | Ga0207661_104120391 | 195 |
| 3 | 3300005344 | Ga0070661_100007217 | Ga0070661_1000072174 | 196 |
| 4 | 3300005564 | Ga0070664_100038109 | Ga0070664_1000381096 | 196 |
| 5 | 3300005564 | Ga0070664_100191258 | Ga0070664_1001912582 | 196 |
| 6 | 3300005616 | Ga0068852_100036248 | Ga0068852_1000362483 | 196 |
| 7 | 3300005834 | Ga0068851_10003876 | Ga0068851_100038762 | 196 |
| 8 | 3300025920 | Ga0207649_10028121 | Ga0207649_100281213 | 196 |
| 9 | 3300025945 | Ga0207679_10023034 | Ga0207679_100230344 | 196 |
| 10 | 3300025945 | Ga0207679_10086567 | Ga0207679_100865673 | 196 |
| 11 | 3300026041 | Ga0207639_10135502 | Ga0207639_101355023 | 196 |
| 12 | 3300026067 | Ga0207678_10009726 | Ga0207678_100097268 | 196 |
| 13 | 3300002067 | JGI24735J21928_10035780 | JGI24735J21928_100357802 | 197 |
| 14 | 3300005353 | Ga0070669_100165589 | Ga0070669_1001655893 | 197 |
| 15 | 3300005355 | Ga0070671_100218283 | Ga0070671_1002182832 | 197 |
| 16 | 3300005366 | Ga0070659_100149803 | Ga0070659_1001498032 | 197 |
| 17 | 3300005844 | Ga0068862_100759856 | Ga0068862_1007598562 | 197 |
| 18 | 3300025893 | Ga0207682_10012163 | Ga0207682_100121633 | 197 |
| 19 | 3300025931 | Ga0207644_10211758 | Ga0207644_102117582 | 197 |
| 20 | 3300025960 | Ga0207651_10078621 | Ga0207651_100786214 | 197 |
| 21 | 3300025972 | Ga0207668_10191711 | Ga0207668_101917112 | 197 |
| 22 | 3300046691 | Ga0495670_0000002 | Ga0495670_0000002_115269_115901 | 197 |
| 23 | 3300046694 | Ga0495649_0117925 | Ga0495649_0117925_306_938 | 197 |
| 24 | 3300053136 | Ga0500559_0224704 | Ga0500559_0224704_102_734 | 197 |
| 25 | 3300001990 | JGI24737J22298_10026431 | JGI24737J22298_100264312 | 198 |
| 26 | 3300002067 | JGI24735J21928_10031377 | JGI24735J21928_100313772 | 198 |
| 27 | 3300002067 | JGI24735J21928_10040219 | JGI24735J21928_100402191 | 198 |
| 28 | 3300005327 | Ga0070658_10076276 | Ga0070658_100762762 | 198 |
| 29 | 3300005327 | Ga0070658_10577640 | Ga0070658_105776402 | 198 |
| 30 | 3300005327 | Ga0070658_10710753 | Ga0070658_107107531 | 198 |
| 31 | 3300005344 | Ga0070661_100109566 | Ga0070661_1001095663 | 198 |
| 32 | 3300005347 | Ga0070668_100006254 | Ga0070668_1000062544 | 198 |
| 33 | 3300005366 | Ga0070659_100214018 | Ga0070659_1002140182 | 198 |
| 34 | 3300005455 | Ga0070663_100021827 | Ga0070663_1000218273 | 198 |
| 35 | 3300005455 | Ga0070663_100061842 | Ga0070663_1000618423 | 198 |
| 36 | 3300005457 | Ga0070662_101095666 | Ga0070662_1010956661 | 198 |
| 37 | 3300005614 | Ga0068856_100334270 | Ga0068856_1003342702 | 198 |
| 38 | 3300005844 | Ga0068862_100005659 | Ga0068862_1000056595 | 198 |
| 39 | 3300009177 | Ga0105248_10495441 | Ga0105248_104954413 | 198 |
| 40 | 3300013102 | Ga0157371_10261242 | Ga0157371_102612423 | 198 |
| 41 | 3300013296 | Ga0157374_10419440 | Ga0157374_104194401 | 198 |
| 42 | 3300014325 | Ga0163163_10712313 | Ga0163163_107123132 | 198 |
| 43 | 3300014968 | Ga0157379_10036388 | Ga0157379_100363883 | 198 |
| 44 | 3300021388 | Ga0213875_10004443 | Ga0213875_100044433 | 198 |
| 45 | 3300025904 | Ga0207647_10157330 | Ga0207647_101573302 | 198 |
| 46 | 3300025909 | Ga0207705_10017883 | Ga0207705_100178833 | 198 |
| 47 | 3300025909 | Ga0207705_10099952 | Ga0207705_100999522 | 198 |
| 48 | 3300025909 | Ga0207705_10208989 | Ga0207705_102089892 | 198 |
| 49 | 3300025919 | Ga0207657_10330439 | Ga0207657_103304391 | 198 |
| 50 | 3300025919 | Ga0207657_10656807 | Ga0207657_106568071 | 198 |
| 51 | 3300025920 | Ga0207649_10095519 | Ga0207649_100955192 | 198 |
| 52 | 3300025945 | Ga0207679_10076662 | Ga0207679_100766622 | 198 |
| 53 | 3300026067 | Ga0207678_10010002 | Ga0207678_100100026 | 198 |
| 54 | 3300026067 | Ga0207678_10163402 | Ga0207678_101634022 | 198 |
| 55 | 3300028380 | Ga0268265_10003952 | Ga0268265_1000395210 | 198 |
| 56 | 3300031852 | Ga0307410_10476803 | Ga0307410_104768033 | 198 |
| 57 | 3300037853 | Ga0436364_1311127 | Ga0436364_1311127_19_645 | 198 |
| 58 | 3300037853 | Ga0436364_1360610 | Ga0436364_1360610_18597_19223 | 198 |
| 59 | 3300044694 | Ga0466963_0007455 | Ga0466963_0007455_764_1390 | 198 |
| 60 | 3300045976 | Ga0466967_0036370 | Ga0466967_0036370_2654_3280 | 198 |
| 61 | 3300045976 | Ga0466967_0501958 | Ga0466967_0501958_253_879 | 198 |
| 62 | 3300005329 | Ga0070683_100295705 | Ga0070683_1002957052 | 199 |
| 63 | 3300005347 | Ga0070668_100328395 | Ga0070668_1003283953 | 199 |
| 64 | 3300005347 | Ga0070668_100336378 | Ga0070668_1003363783 | 199 |
| 65 | 3300005367 | Ga0070667_100122321 | Ga0070667_1001223212 | 199 |
| 66 | 3300005367 | Ga0070667_100832733 | Ga0070667_1008327331 | 199 |
| 67 | 3300005543 | Ga0070672_100879626 | Ga0070672_1008796261 | 199 |
| 68 | 3300005718 | Ga0068866_10131801 | Ga0068866_101318011 | 199 |
| 69 | 3300005843 | Ga0068860_101177625 | Ga0068860_1011776251 | 199 |
| 70 | 3300006881 | Ga0068865_100277693 | Ga0068865_1002776933 | 199 |
| 71 | 3300013100 | Ga0157373_10119369 | Ga0157373_101193692 | 199 |
| 72 | 3300013296 | Ga0157374_10000688 | Ga0157374_1000068818 | 199 |
| 73 | 3300013308 | Ga0157375_10184436 | Ga0157375_101844362 | 199 |
| 74 | 3300025893 | Ga0207682_10049271 | Ga0207682_100492712 | 199 |
| 75 | 3300025899 | Ga0207642_10125270 | Ga0207642_101252702 | 199 |
| 76 | 3300025923 | Ga0207681_10176013 | Ga0207681_101760132 | 199 |
| 77 | 3300025933 | Ga0207706_10022419 | Ga0207706_100224193 | 199 |
| 78 | 3300025938 | Ga0207704_10638721 | Ga0207704_106387211 | 199 |
| 79 | 3300025940 | Ga0207691_10059530 | Ga0207691_100595304 | 199 |
| 80 | 3300025944 | Ga0207661_10234000 | Ga0207661_102340002 | 199 |
| 81 | 3300025986 | Ga0207658_10769948 | Ga0207658_107699481 | 199 |
| 82 | 3300026035 | Ga0207703_10182061 | Ga0207703_101820611 | 199 |
| 83 | 3300026121 | Ga0207683_10292282 | Ga0207683_102922822 | 199 |
| 84 | 3300028380 | Ga0268265_10260898 | Ga0268265_102608981 | 199 |
| 85 | 3300028381 | Ga0268264_10144671 | Ga0268264_101446712 | 199 |
| 86 | 3300032005 | Ga0307411_10759268 | Ga0307411_107592681 | 199 |
| 87 | 3300053730 | Ga0500645_005952 | Ga0500645_005952_2643_3281 | 199 |
| 88 | 3300005327 | Ga0070658_10033381 | Ga0070658_100333813 | 200 |
| 89 | 3300005339 | Ga0070660_100003366 | Ga0070660_1000033662 | 200 |
| 90 | 3300005366 | Ga0070659_100023121 | Ga0070659_1000231217 | 200 |
| 91 | 3300005455 | Ga0070663_100025599 | Ga0070663_1000255997 | 200 |
| 92 | 3300005539 | Ga0068853_100079809 | Ga0068853_1000798092 | 200 |
| 93 | 3300005564 | Ga0070664_100030419 | Ga0070664_1000304192 | 200 |
| 94 | 3300005616 | Ga0068852_100074676 | Ga0068852_1000746763 | 200 |
| 95 | 3300025321 | Ga0207656_10168284 | Ga0207656_101682842 | 200 |
| 96 | 3300025909 | Ga0207705_10137685 | Ga0207705_101376852 | 200 |
| 97 | 3300025919 | Ga0207657_10031106 | Ga0207657_100311064 | 200 |
| 98 | 3300025932 | Ga0207690_10056203 | Ga0207690_100562036 | 200 |
| 99 | 3300026041 | Ga0207639_10107899 | Ga0207639_101078993 | 200 |
| 100 | 3300037418 | Ga0395900_0203635 | Ga0395900_0203635_181_822 | 200 |
| 101 | 3300037466 | Ga0395898_0157671 | Ga0395898_0157671_489_1130 | 200 |
| 102 | 3300038443 | Ga0395901_0042145 | Ga0395901_0042145_2743_3384 | 200 |
| 103 | 3300044694 | Ga0466963_0050713 | Ga0466963_0050713_1810_2442 | 200 |
| 104 | 3300053092 | Ga0500583_0317756 | Ga0500583_0317756_104_748 | 200 |
| 105 | 3300053096 | Ga0500641_0005984 | Ga0500641_0005984_3312_3953 | 200 |
| 106 | 3300053146 | Ga0500588_0042173 | Ga0500588_0042173_31_675 | 200 |
| 107 | 3300025912 | Ga0207707_10257532 | Ga0207707_102575322 | 201 |
| 108 | 3300037312 | Ga0395899_0295250 | Ga0395899_0295250_433_1083 | 201 |
| 109 | 3300037418 | Ga0395900_0000862 | Ga0395900_0000862_32447_33097 | 201 |
| 110 | 3300037466 | Ga0395898_0211248 | Ga0395898_0211248_980_1630 | 201 |
| 111 | 3300037471 | Ga0395905_0000365 | Ga0395905_0000365_4759_5409 | 201 |
| 112 | 3300038443 | Ga0395901_0035805 | Ga0395901_0035805_3058_3708 | 201 |
| 113 | 3300005617 | Ga0068859_100003354 | Ga0068859_1000033545 | 202 |
| 114 | 3300005841 | Ga0068863_100138621 | Ga0068863_1001386216 | 202 |
| 115 | 3300005843 | Ga0068860_100100415 | Ga0068860_1001004154 | 202 |
| 116 | 3300006931 | Ga0097620_100003354 | Ga0097620_1000033545 | 202 |
| 117 | 3300009177 | Ga0105248_10150526 | Ga0105248_101505263 | 202 |
| 118 | 3300025941 | Ga0207711_10398973 | Ga0207711_103989731 | 202 |
| 119 | 3300026023 | Ga0207677_10021077 | Ga0207677_100210772 | 202 |
| 120 | 3300035084 | Ga0373928_0097196 | Ga0373928_0097196_76_714 | 202 |
| 121 | 3300037312 | Ga0395899_0038808 | Ga0395899_0038808_1191_1829 | 202 |
| 122 | 3300037466 | Ga0395898_0250029 | Ga0395898_0250029_807_1445 | 202 |
| 123 | 3300005339 | Ga0070660_100179609 | Ga0070660_1001796093 | 203 |
| 124 | 3300005366 | Ga0070659_100248607 | Ga0070659_1002486072 | 203 |
| 125 | 3300005367 | Ga0070667_100634877 | Ga0070667_1006348772 | 203 |
| 126 | 3300005543 | Ga0070672_100851320 | Ga0070672_1008513201 | 203 |
| 127 | 3300005617 | Ga0068859_100106596 | Ga0068859_1001065963 | 203 |
| 128 | 3300005842 | Ga0068858_100549613 | Ga0068858_1005496132 | 203 |
| 129 | 3300006931 | Ga0097620_100106595 | Ga0097620_1001065953 | 203 |
| 130 | 3300009177 | Ga0105248_10097345 | Ga0105248_100973454 | 203 |
| 131 | 3300009177 | Ga0105248_10200160 | Ga0105248_102001601 | 203 |
| 132 | 3300025919 | Ga0207657_10260301 | Ga0207657_102603013 | 203 |
| 133 | 3300025931 | Ga0207644_10265214 | Ga0207644_102652142 | 203 |
| 134 | 3300025940 | Ga0207691_10591179 | Ga0207691_105911791 | 203 |
| 135 | 3300025941 | Ga0207711_10005651 | Ga0207711_100056514 | 203 |
| 136 | 3300025941 | Ga0207711_10727142 | Ga0207711_107271422 | 203 |
| 137 | 3300025986 | Ga0207658_10008208 | Ga0207658_100082086 | 203 |
| 138 | 3300026088 | Ga0207641_10188806 | Ga0207641_101888062 | 203 |
| 139 | 3300028381 | Ga0268264_10363903 | Ga0268264_103639033 | 203 |
| 140 | 3300037312 | Ga0395899_0084262 | Ga0395899_0084262_825_1481 | 203 |
| 141 | 3300037312 | Ga0395899_0100349 | Ga0395899_0100349_1324_1980 | 203 |
| 142 | 3300037418 | Ga0395900_0063590 | Ga0395900_0063590_1101_1757 | 203 |
| 143 | 3300037418 | Ga0395900_0597365 | Ga0395900_0597365_130_786 | 203 |
| 144 | 3300037466 | Ga0395898_0085812 | Ga0395898_0085812_1769_2425 | 203 |
| 145 | 3300037466 | Ga0395898_0376696 | Ga0395898_0376696_566_1222 | 203 |
| 146 | 3300037471 | Ga0395905_0066499 | Ga0395905_0066499_72_728 | 203 |
| 147 | 3300037471 | Ga0395905_0099067 | Ga0395905_0099067_2010_2666 | 203 |
| 148 | 3300037471 | Ga0395905_0488765 | Ga0395905_0488765_457_1113 | 203 |
| 149 | 3300037471 | Ga0395905_0498737 | Ga0395905_0498737_124_780 | 203 |
| 150 | 3300038443 | Ga0395901_0210614 | Ga0395901_0210614_825_1481 | 203 |
| 151 | 3300038443 | Ga0395901_0245226 | Ga0395901_0245226_111_767 | 203 |
| 152 | 3300038443 | Ga0395901_0803286 | Ga0395901_0803286_169_825 | 203 |
| 153 | 3300038443 | Ga0395901_0939074 | Ga0395901_0939074_169_825 | 203 |
| 154 | 3300045976 | Ga0466967_0183430 | Ga0466967_0183430_1205_1861 | 203 |
| 155 | 3300048911 | Ga0496108_0313186 | Ga0496108_0313186_109_765 | 203 |
| 156 | 3300048912 | Ga0496109_0199074 | Ga0496109_0199074_476_1132 | 203 |
| 157 | 3300048915 | Ga0496112_0054159 | Ga0496112_0054159_2606_3262 | 203 |
| 158 | 3300048916 | Ga0496113_0107789 | Ga0496113_0107789_550_1206 | 203 |
| 159 | 3300049679 | Ga0501249_034346 | Ga0501249_034346_342_986 | 203 |
| 160 | 3300005345 | Ga0070692_10036947 | Ga0070692_100369474 | 204 |
| 161 | 3300005455 | Ga0070663_100101244 | Ga0070663_1001012442 | 204 |
| 162 | 3300005458 | Ga0070681_10531807 | Ga0070681_105318071 | 204 |
| 163 | 3300005563 | Ga0068855_100127353 | Ga0068855_1001273534 | 204 |
| 164 | 3300025909 | Ga0207705_10182489 | Ga0207705_101824893 | 204 |
| 165 | 3300025912 | Ga0207707_10576242 | Ga0207707_105762421 | 204 |
| 166 | 3300025949 | Ga0207667_10136274 | Ga0207667_101362744 | 204 |
| 167 | 3300044694 | Ga0466963_0117592 | Ga0466963_0117592_606_1250 | 204 |
| 168 | 3300045976 | Ga0466967_0052221 | Ga0466967_0052221_438_1082 | 204 |
| 169 | 3300005331 | Ga0070670_100030359 | Ga0070670_1000303592 | 205 |
| 170 | 3300005844 | Ga0068862_100264722 | Ga0068862_1002647222 | 205 |
| 171 | 3300028380 | Ga0268265_10260527 | Ga0268265_102605272 | 205 |
| 172 | 3300031731 | Ga0307405_10286788 | Ga0307405_102867881 | 205 |
| 173 | 3300031852 | Ga0307410_10002455 | Ga0307410_1000245511 | 205 |
| 174 | 3300031903 | Ga0307407_10199116 | Ga0307407_101991163 | 205 |
| 175 | 3300032004 | Ga0307414_10254795 | Ga0307414_102547952 | 205 |
| 176 | 3300032005 | Ga0307411_10061374 | Ga0307411_100613742 | 205 |
| 177 | 3300037418 | Ga0395900_0434466 | Ga0395900_0434466_476_1150 | 205 |
| 178 | 3300038443 | Ga0395901_0134999 | Ga0395901_0134999_1696_2370 | 205 |
| 179 | 3300005338 | Ga0068868_100000237 | Ga0068868_1000002374 | 206 |
| 180 | 3300005347 | Ga0070668_100145703 | Ga0070668_1001457032 | 206 |
| 181 | 3300005539 | Ga0068853_100036747 | Ga0068853_1000367475 | 206 |
| 182 | 3300006038 | Ga0075365_10330841 | Ga0075365_103308412 | 206 |
| 183 | 3300013104 | Ga0157370_10086037 | Ga0157370_100860372 | 206 |
| 184 | 3300026041 | Ga0207639_10166460 | Ga0207639_101664601 | 206 |
| 185 | 3300026067 | Ga0207678_10151122 | Ga0207678_101511223 | 206 |
| 186 | 3300026088 | Ga0207641_10029710 | Ga0207641_100297107 | 206 |
| 187 | 3300026095 | Ga0207676_10094294 | Ga0207676_100942943 | 206 |
| 188 | 3300037418 | Ga0395900_0284787 | Ga0395900_0284787_934_1599 | 206 |
| 189 | 3300037471 | Ga0395905_0153227 | Ga0395905_0153227_493_1179 | 206 |
| 190 | 3300037471 | Ga0395905_0342313 | Ga0395905_0342313_390_1055 | 206 |
| 191 | 3300038443 | Ga0395901_0330627 | Ga0395901_0330627_182_847 | 206 |
| 192 | 3300042439 | Ga0439464_0007229 | Ga0439464_0007229_1651_2310 | 206 |
| 193 | 3300005841 | Ga0068863_100264835 | Ga0068863_1002648352 | 207 |
| 194 | 3300026088 | Ga0207641_10060791 | Ga0207641_100607913 | 207 |
| 195 | 3300031548 | Ga0307408_100042329 | Ga0307408_1000423292 | 207 |
| 196 | 3300031731 | Ga0307405_10012233 | Ga0307405_100122334 | 207 |
| 197 | 3300031824 | Ga0307413_10332985 | Ga0307413_103329852 | 207 |
| 198 | 3300031852 | Ga0307410_10064236 | Ga0307410_100642365 | 207 |
| 199 | 3300031901 | Ga0307406_10009362 | Ga0307406_100093625 | 207 |
| 200 | 3300031903 | Ga0307407_10051046 | Ga0307407_100510462 | 207 |
| 201 | 3300031911 | Ga0307412_10020992 | Ga0307412_100209924 | 207 |
| 202 | 3300031995 | Ga0307409_100643043 | Ga0307409_1006430431 | 207 |
| 203 | 3300032005 | Ga0307411_10272209 | Ga0307411_102722092 | 207 |
| 204 | 3300032126 | Ga0307415_100102676 | Ga0307415_1001026764 | 207 |
| 205 | 3300046684 | Ga0495669_0040505 | Ga0495669_0040505_1039_1713 | 207 |
| 206 | 3300003323 | rootH1_10208177 | rootH1_102081772 | 208 |
| 207 | 3300005327 | Ga0070658_10026100 | Ga0070658_100261006 | 208 |
| 208 | 3300005330 | Ga0070690_100045194 | Ga0070690_1000451943 | 208 |
| 209 | 3300005335 | Ga0070666_10007245 | Ga0070666_100072454 | 208 |
| 210 | 3300005340 | Ga0070689_100099347 | Ga0070689_1000993474 | 208 |
| 211 | 3300005355 | Ga0070671_100045988 | Ga0070671_1000459883 | 208 |
| 212 | 3300005356 | Ga0070674_100031836 | Ga0070674_1000318362 | 208 |
| 213 | 3300005364 | Ga0070673_100008272 | Ga0070673_1000082722 | 208 |
| 214 | 3300005367 | Ga0070667_100040495 | Ga0070667_1000404953 | 208 |
| 215 | 3300005444 | Ga0070694_100167802 | Ga0070694_1001678022 | 208 |
| 216 | 3300005457 | Ga0070662_100302892 | Ga0070662_1003028921 | 208 |
| 217 | 3300005459 | Ga0068867_100154331 | Ga0068867_1001543312 | 208 |
| 218 | 3300005467 | Ga0070706_100248834 | Ga0070706_1002488343 | 208 |
| 219 | 3300005530 | Ga0070679_100439976 | Ga0070679_1004399762 | 208 |
| 220 | 3300005545 | Ga0070695_100023104 | Ga0070695_1000231044 | 208 |
| 221 | 3300005546 | Ga0070696_100006532 | Ga0070696_1000065328 | 208 |
| 222 | 3300005547 | Ga0070693_100205124 | Ga0070693_1002051242 | 208 |
| 223 | 3300005578 | Ga0068854_100366947 | Ga0068854_1003669471 | 208 |
| 224 | 3300005616 | Ga0068852_100242350 | Ga0068852_1002423502 | 208 |
| 225 | 3300005617 | Ga0068859_100014674 | Ga0068859_1000146747 | 208 |
| 226 | 3300005842 | Ga0068858_100001063 | Ga0068858_10000106333 | 208 |
| 227 | 3300006931 | Ga0097620_100014673 | Ga0097620_1000146734 | 208 |
| 228 | 3300009147 | Ga0114129_10593315 | Ga0114129_105933154 | 208 |
| 229 | 3300009177 | Ga0105248_10123267 | Ga0105248_101232672 | 208 |
| 230 | 3300014968 | Ga0157379_10193202 | Ga0157379_101932023 | 208 |
| 231 | 3300025903 | Ga0207680_10015753 | Ga0207680_100157536 | 208 |
| 232 | 3300025904 | Ga0207647_10004799 | Ga0207647_100047996 | 208 |
| 233 | 3300025910 | Ga0207684_10322330 | Ga0207684_103223302 | 208 |
| 234 | 3300025919 | Ga0207657_10207610 | Ga0207657_102076102 | 208 |
| 235 | 3300025919 | Ga0207657_10314356 | Ga0207657_103143561 | 208 |
| 236 | 3300025921 | Ga0207652_10258022 | Ga0207652_102580222 | 208 |
| 237 | 3300025931 | Ga0207644_10024755 | Ga0207644_100247554 | 208 |
| 238 | 3300025932 | Ga0207690_10059565 | Ga0207690_100595654 | 208 |
| 239 | 3300025933 | Ga0207706_10243416 | Ga0207706_102434162 | 208 |
| 240 | 3300025937 | Ga0207669_10061892 | Ga0207669_100618922 | 208 |
| 241 | 3300025940 | Ga0207691_10526373 | Ga0207691_105263731 | 208 |
| 242 | 3300025941 | Ga0207711_10000826 | Ga0207711_100008263 | 208 |
| 243 | 3300025960 | Ga0207651_10026562 | Ga0207651_100265622 | 208 |
| 244 | 3300025986 | Ga0207658_10021355 | Ga0207658_100213554 | 208 |
| 245 | 3300026023 | Ga0207677_10009046 | Ga0207677_100090464 | 208 |
| 246 | 3300026035 | Ga0207703_10008014 | Ga0207703_100080147 | 208 |
| 247 | 3300026142 | Ga0207698_10252468 | Ga0207698_102524682 | 208 |
| 248 | 3300031731 | Ga0307405_10460207 | Ga0307405_104602072 | 208 |
| 249 | 3300041405 | Ga0439438_031102 | Ga0439438_031102_600_1268 | 208 |
| 250 | 3300042142 | Ga0450905_005530 | Ga0450905_005530_639_1307 | 208 |
| 251 | 3300042144 | Ga0450889_000034 | Ga0450889_000034_5821_6489 | 208 |
| 252 | 3300050507 | nmdc:mga05p37_230730_c1 | nmdc:mga05p37_230730_c1_27_695 | 208 |
| 253 | 3300005327 | Ga0070658_10142407 | Ga0070658_101424073 | 209 |
| 254 | 3300005330 | Ga0070690_100052565 | Ga0070690_1000525653 | 209 |
| 255 | 3300005331 | Ga0070670_100181430 | Ga0070670_1001814302 | 209 |
| 256 | 3300005335 | Ga0070666_10018022 | Ga0070666_100180226 | 209 |
| 257 | 3300005337 | Ga0070682_100354673 | Ga0070682_1003546732 | 209 |
| 258 | 3300005340 | Ga0070689_100451579 | Ga0070689_1004515792 | 209 |
| 259 | 3300005355 | Ga0070671_100013668 | Ga0070671_1000136684 | 209 |
| 260 | 3300005355 | Ga0070671_100014207 | Ga0070671_1000142072 | 209 |
| 261 | 3300005356 | Ga0070674_100006617 | Ga0070674_1000066172 | 209 |
| 262 | 3300005364 | Ga0070673_100013344 | Ga0070673_1000133447 | 209 |
| 263 | 3300005364 | Ga0070673_100168440 | Ga0070673_1001684401 | 209 |
| 264 | 3300005364 | Ga0070673_100504370 | Ga0070673_1005043702 | 209 |
| 265 | 3300005367 | Ga0070667_100385435 | Ga0070667_1003854352 | 209 |
| 266 | 3300005456 | Ga0070678_100055768 | Ga0070678_1000557681 | 209 |
| 267 | 3300005457 | Ga0070662_100003264 | Ga0070662_10000326413 | 209 |
| 268 | 3300005459 | Ga0068867_100002869 | Ga0068867_1000028695 | 209 |
| 269 | 3300005466 | Ga0070685_10135386 | Ga0070685_101353861 | 209 |
| 270 | 3300005543 | Ga0070672_100085728 | Ga0070672_1000857282 | 209 |
| 271 | 3300005543 | Ga0070672_100118015 | Ga0070672_1001180152 | 209 |
| 272 | 3300005544 | Ga0070686_100129525 | Ga0070686_1001295251 | 209 |
| 273 | 3300005547 | Ga0070693_100318725 | Ga0070693_1003187251 | 209 |
| 274 | 3300005834 | Ga0068851_10009411 | Ga0068851_100094116 | 209 |
| 275 | 3300005840 | Ga0068870_10131204 | Ga0068870_101312043 | 209 |
| 276 | 3300006358 | Ga0068871_100013156 | Ga0068871_1000131567 | 209 |
| 277 | 3300009177 | Ga0105248_10285213 | Ga0105248_102852132 | 209 |
| 278 | 3300009177 | Ga0105248_11442376 | Ga0105248_114423761 | 209 |
| 279 | 3300013105 | Ga0157369_10206595 | Ga0157369_102065952 | 209 |
| 280 | 3300013308 | Ga0157375_10541402 | Ga0157375_105414022 | 209 |
| 281 | 3300025315 | Ga0207697_10011363 | Ga0207697_100113636 | 209 |
| 282 | 3300025908 | Ga0207643_10096149 | Ga0207643_100961494 | 209 |
| 283 | 3300025931 | Ga0207644_10083987 | Ga0207644_100839872 | 209 |
| 284 | 3300025933 | Ga0207706_10215242 | Ga0207706_102152422 | 209 |
| 285 | 3300025936 | Ga0207670_10178205 | Ga0207670_101782053 | 209 |
| 286 | 3300025940 | Ga0207691_10026477 | Ga0207691_100264775 | 209 |
| 287 | 3300025940 | Ga0207691_10103966 | Ga0207691_101039662 | 209 |
| 288 | 3300025960 | Ga0207651_10095478 | Ga0207651_100954782 | 209 |
| 289 | 3300025960 | Ga0207651_10370540 | Ga0207651_103705402 | 209 |
| 290 | 3300025972 | Ga0207668_10597214 | Ga0207668_105972141 | 209 |
| 291 | 3300025986 | Ga0207658_10707872 | Ga0207658_107078721 | 209 |
| 292 | 3300026078 | Ga0207702_10027154 | Ga0207702_100271546 | 209 |
| 293 | 3300026118 | Ga0207675_100610585 | Ga0207675_1006105851 | 209 |
| 294 | 3300026121 | Ga0207683_10142139 | Ga0207683_101421392 | 209 |
| 295 | 3300028379 | Ga0268266_10029060 | Ga0268266_100290604 | 209 |
| 296 | 3300028379 | Ga0268266_10166205 | Ga0268266_101662052 | 209 |
| 297 | 3300031548 | Ga0307408_100032429 | Ga0307408_1000324292 | 209 |
| 298 | 3300031731 | Ga0307405_10131603 | Ga0307405_101316032 | 209 |
| 299 | 3300031911 | Ga0307412_10064806 | Ga0307412_100648062 | 209 |
| 300 | 3300031995 | Ga0307409_100182249 | Ga0307409_1001822492 | 209 |
| 301 | 3300032126 | Ga0307415_100080796 | Ga0307415_1000807962 | 209 |
| 302 | 3300035111 | Ga0373923_0178101 | Ga0373923_0178101_258_917 | 209 |
| 303 | 3300037418 | Ga0395900_0000031 | Ga0395900_0000031_54184_54867 | 209 |
| 304 | 3300037418 | Ga0395900_0013399 | Ga0395900_0013399_1093_1788 | 209 |
| 305 | 3300037418 | Ga0395900_0263696 | Ga0395900_0263696_847_1539 | 209 |
| 306 | 3300037466 | Ga0395898_0003373 | Ga0395898_0003373_11565_12248 | 209 |
| 307 | 3300037466 | Ga0395898_0058977 | Ga0395898_0058977_2299_2994 | 209 |
| 308 | 3300037466 | Ga0395898_0241905 | Ga0395898_0241905_647_1339 | 209 |
| 309 | 3300037471 | Ga0395905_0027046 | Ga0395905_0027046_1749_2444 | 209 |
| 310 | 3300038443 | Ga0395901_0002051 | Ga0395901_0002051_12684_13367 | 209 |
| 311 | 3300038443 | Ga0395901_0251891 | Ga0395901_0251891_546_1238 | 209 |
| 312 | 3300046537 | Ga0495598_0007122 | Ga0495598_0007122_1826_2485 | 209 |
| 313 | 3300046558 | Ga0495633_0077772 | Ga0495633_0077772_94_753 | 209 |
| 314 | 3300046684 | Ga0495669_0021229 | Ga0495669_0021229_734_1393 | 209 |
| 315 | 3300046691 | Ga0495670_0001581 | Ga0495670_0001581_3152_3811 | 209 |
| 316 | 3300048911 | Ga0496108_0487484 | Ga0496108_0487484_170_829 | 209 |
| 317 | 3300049583 | Ga0501067_0236146 | Ga0501067_0236146_336_995 | 209 |
| 318 | 3300005339 | Ga0070660_100227333 | Ga0070660_1002273332 | 210 |
| 319 | 3300005344 | Ga0070661_100043546 | Ga0070661_1000435464 | 210 |
| 320 | 3300005355 | Ga0070671_100015603 | Ga0070671_1000156031 | 210 |
| 321 | 3300005355 | Ga0070671_100166042 | Ga0070671_1001660423 | 210 |
| 322 | 3300005435 | Ga0070714_100042688 | Ga0070714_1000426884 | 210 |
| 323 | 3300005435 | Ga0070714_100374999 | Ga0070714_1003749992 | 210 |
| 324 | 3300005436 | Ga0070713_100056520 | Ga0070713_1000565205 | 210 |
| 325 | 3300005455 | Ga0070663_100007211 | Ga0070663_1000072113 | 210 |
| 326 | 3300005459 | Ga0068867_100058279 | Ga0068867_1000582792 | 210 |
| 327 | 3300005563 | Ga0068855_100853875 | Ga0068855_1008538751 | 210 |
| 328 | 3300005578 | Ga0068854_100015826 | Ga0068854_1000158265 | 210 |
| 329 | 3300005614 | Ga0068856_100278743 | Ga0068856_1002787432 | 210 |
| 330 | 3300005618 | Ga0068864_100098577 | Ga0068864_1000985776 | 210 |
| 331 | 3300006028 | Ga0070717_10028934 | Ga0070717_100289345 | 210 |
| 332 | 3300006173 | Ga0070716_100030809 | Ga0070716_1000308092 | 210 |
| 333 | 3300006175 | Ga0070712_100010413 | Ga0070712_1000104136 | 210 |
| 334 | 3300006237 | Ga0097621_100827397 | Ga0097621_1008273971 | 210 |
| 335 | 3300009093 | Ga0105240_10373909 | Ga0105240_103739092 | 210 |
| 336 | 3300009177 | Ga0105248_10057467 | Ga0105248_100574676 | 210 |
| 337 | 3300013100 | Ga0157373_10187142 | Ga0157373_101871422 | 210 |
| 338 | 3300013104 | Ga0157370_10339489 | Ga0157370_103394892 | 210 |
| 339 | 3300013306 | Ga0163162_10240053 | Ga0163162_102400532 | 210 |
| 340 | 3300013307 | Ga0157372_10506167 | Ga0157372_105061672 | 210 |
| 341 | 3300021384 | Ga0213876_10074375 | Ga0213876_100743752 | 210 |
| 342 | 3300025909 | Ga0207705_10028159 | Ga0207705_100281593 | 210 |
| 343 | 3300025913 | Ga0207695_10252223 | Ga0207695_102522232 | 210 |
| 344 | 3300025915 | Ga0207693_10020143 | Ga0207693_100201435 | 210 |
| 345 | 3300025919 | Ga0207657_10132709 | Ga0207657_101327093 | 210 |
| 346 | 3300025920 | Ga0207649_10214436 | Ga0207649_102144362 | 210 |
| 347 | 3300025925 | Ga0207650_10442296 | Ga0207650_104422961 | 210 |
| 348 | 3300025929 | Ga0207664_10092944 | Ga0207664_100929442 | 210 |
| 349 | 3300025931 | Ga0207644_10336153 | Ga0207644_103361532 | 210 |
| 350 | 3300025945 | Ga0207679_10367917 | Ga0207679_103679172 | 210 |
| 351 | 3300025949 | Ga0207667_10060438 | Ga0207667_100604384 | 210 |
| 352 | 3300025981 | Ga0207640_10246742 | Ga0207640_102467422 | 210 |
| 353 | 3300026067 | Ga0207678_10001628 | Ga0207678_1000162826 | 210 |
| 354 | 3300026089 | Ga0207648_10239787 | Ga0207648_102397872 | 210 |
| 355 | 3300026095 | Ga0207676_10395544 | Ga0207676_103955443 | 210 |
| 356 | 3300026142 | Ga0207698_10313869 | Ga0207698_103138692 | 210 |
| 357 | 3300035692 | Ga0373935_0024057 | Ga0373935_0024057_3072_3734 | 210 |
| 358 | 3300039437 | Ga0436365_0504349 | Ga0436365_0504349_958_1656 | 210 |
| 359 | 3300039450 | Ga0436363_0214937 | Ga0436363_0214937_27_725 | 210 |
| 360 | 3300044683 | Ga0466965_0161247 | Ga0466965_0161247_404_1105 | 210 |
| 361 | 3300044901 | Ga0466960_0006351 | Ga0466960_0006351_401_1102 | 210 |
| 362 | 3300048904 | Ga0496101_0020211 | Ga0496101_0020211_2214_2876 | 210 |
| 363 | 3300048918 | Ga0496115_0011238 | Ga0496115_0011238_1984_2646 | 210 |
| 364 | 3300001978 | JGI24747J21853_1001580 | JGI24747J21853_10015802 | 211 |
| 365 | 3300001989 | JGI24739J22299_10008945 | JGI24739J22299_100089454 | 211 |
| 366 | 3300002073 | JGI24745J21846_1002754 | JGI24745J21846_10027543 | 211 |
| 367 | 3300002075 | JGI24738J21930_10018195 | JGI24738J21930_100181953 | 211 |
| 368 | 3300002077 | JGI24744J21845_10000287 | JGI24744J21845_100002876 | 211 |
| 369 | 3300005328 | Ga0070676_10046893 | Ga0070676_100468932 | 211 |
| 370 | 3300005331 | Ga0070670_100124951 | Ga0070670_1001249512 | 211 |
| 371 | 3300005334 | Ga0068869_100059083 | Ga0068869_1000590832 | 211 |
| 372 | 3300005335 | Ga0070666_10018242 | Ga0070666_100182426 | 211 |
| 373 | 3300005338 | Ga0068868_100006807 | Ga0068868_1000068077 | 211 |
| 374 | 3300005338 | Ga0068868_100299968 | Ga0068868_1002999681 | 211 |
| 375 | 3300005339 | Ga0070660_100102984 | Ga0070660_1001029843 | 211 |
| 376 | 3300005339 | Ga0070660_100434711 | Ga0070660_1004347112 | 211 |
| 377 | 3300005344 | Ga0070661_100051844 | Ga0070661_1000518442 | 211 |
| 378 | 3300005347 | Ga0070668_100073903 | Ga0070668_1000739036 | 211 |
| 379 | 3300005354 | Ga0070675_100087001 | Ga0070675_1000870012 | 211 |
| 380 | 3300005354 | Ga0070675_100092888 | Ga0070675_1000928883 | 211 |
| 381 | 3300005355 | Ga0070671_100077208 | Ga0070671_1000772082 | 211 |
| 382 | 3300005356 | Ga0070674_100006593 | Ga0070674_1000065939 | 211 |
| 383 | 3300005356 | Ga0070674_100032380 | Ga0070674_1000323804 | 211 |
| 384 | 3300005364 | Ga0070673_100090533 | Ga0070673_1000905332 | 211 |
| 385 | 3300005366 | Ga0070659_100143512 | Ga0070659_1001435121 | 211 |
| 386 | 3300005367 | Ga0070667_100334121 | Ga0070667_1003341211 | 211 |
| 387 | 3300005456 | Ga0070678_100021464 | Ga0070678_1000214642 | 211 |
| 388 | 3300005457 | Ga0070662_100286832 | Ga0070662_1002868321 | 211 |
| 389 | 3300005459 | Ga0068867_100145751 | Ga0068867_1001457513 | 211 |
| 390 | 3300005543 | Ga0070672_100000482 | Ga0070672_10000048211 | 211 |
| 391 | 3300005543 | Ga0070672_100247642 | Ga0070672_1002476424 | 211 |
| 392 | 3300005548 | Ga0070665_100016225 | Ga0070665_1000162256 | 211 |
| 393 | 3300005548 | Ga0070665_100138768 | Ga0070665_1001387684 | 211 |
| 394 | 3300005564 | Ga0070664_100141257 | Ga0070664_1001412572 | 211 |
| 395 | 3300005577 | Ga0068857_100332360 | Ga0068857_1003323602 | 211 |
| 396 | 3300005578 | Ga0068854_100091847 | Ga0068854_1000918474 | 211 |
| 397 | 3300005614 | Ga0068856_100042138 | Ga0068856_1000421384 | 211 |
| 398 | 3300005616 | Ga0068852_100012312 | Ga0068852_1000123125 | 211 |
| 399 | 3300005616 | Ga0068852_100093094 | Ga0068852_1000930942 | 211 |
| 400 | 3300005617 | Ga0068859_100069745 | Ga0068859_1000697452 | 211 |
| 401 | 3300005617 | Ga0068859_100552657 | Ga0068859_1005526572 | 211 |
| 402 | 3300005618 | Ga0068864_100089105 | Ga0068864_1000891052 | 211 |
| 403 | 3300005718 | Ga0068866_10004001 | Ga0068866_100040012 | 211 |
| 404 | 3300005718 | Ga0068866_10005219 | Ga0068866_100052194 | 211 |
| 405 | 3300005719 | Ga0068861_100203868 | Ga0068861_1002038681 | 211 |
| 406 | 3300005840 | Ga0068870_10033540 | Ga0068870_100335406 | 211 |
| 407 | 3300005841 | Ga0068863_100001961 | Ga0068863_10000196112 | 211 |
| 408 | 3300005842 | Ga0068858_100080260 | Ga0068858_1000802603 | 211 |
| 409 | 3300005843 | Ga0068860_100147325 | Ga0068860_1001473253 | 211 |
| 410 | 3300006237 | Ga0097621_100104514 | Ga0097621_1001045142 | 211 |
| 411 | 3300006881 | Ga0068865_100004584 | Ga0068865_1000045845 | 211 |
| 412 | 3300006931 | Ga0097620_100069748 | Ga0097620_1000697482 | 211 |
| 413 | 3300006931 | Ga0097620_100552648 | Ga0097620_1005526482 | 211 |
| 414 | 3300009098 | Ga0105245_10017352 | Ga0105245_100173527 | 211 |
| 415 | 3300009098 | Ga0105245_10019353 | Ga0105245_100193537 | 211 |
| 416 | 3300009148 | Ga0105243_10244968 | Ga0105243_102449681 | 211 |
| 417 | 3300009176 | Ga0105242_10002696 | Ga0105242_100026964 | 211 |
| 418 | 3300009176 | Ga0105242_10296319 | Ga0105242_102963192 | 211 |
| 419 | 3300009177 | Ga0105248_10239202 | Ga0105248_102392023 | 211 |
| 420 | 3300009545 | Ga0105237_10554693 | Ga0105237_105546931 | 211 |
| 421 | 3300009551 | Ga0105238_10074784 | Ga0105238_100747844 | 211 |
| 422 | 3300009551 | Ga0105238_10281994 | Ga0105238_102819942 | 211 |
| 423 | 3300009551 | Ga0105238_10389906 | Ga0105238_103899064 | 211 |
| 424 | 3300010375 | Ga0105239_10046622 | Ga0105239_100466224 | 211 |
| 425 | 3300013102 | Ga0157371_10005796 | Ga0157371_1000579613 | 211 |
| 426 | 3300013296 | Ga0157374_10018582 | Ga0157374_100185822 | 211 |
| 427 | 3300013296 | Ga0157374_10067803 | Ga0157374_100678036 | 211 |
| 428 | 3300013297 | Ga0157378_10182570 | Ga0157378_101825702 | 211 |
| 429 | 3300013306 | Ga0163162_10216505 | Ga0163162_102165053 | 211 |
| 430 | 3300013307 | Ga0157372_11024391 | Ga0157372_110243911 | 211 |
| 431 | 3300013308 | Ga0157375_10028047 | Ga0157375_100280473 | 211 |
| 432 | 3300013308 | Ga0157375_10104755 | Ga0157375_101047552 | 211 |
| 433 | 3300013308 | Ga0157375_10118248 | Ga0157375_101182482 | 211 |
| 434 | 3300014325 | Ga0163163_10033263 | Ga0163163_100332633 | 211 |
| 435 | 3300014968 | Ga0157379_10129648 | Ga0157379_101296483 | 211 |
| 436 | 3300014969 | Ga0157376_10020862 | Ga0157376_100208624 | 211 |
| 437 | 3300025315 | Ga0207697_10008065 | Ga0207697_100080653 | 211 |
| 438 | 3300025893 | Ga0207682_10003391 | Ga0207682_100033912 | 211 |
| 439 | 3300025901 | Ga0207688_10025127 | Ga0207688_100251274 | 211 |
| 440 | 3300025903 | Ga0207680_10004711 | Ga0207680_100047113 | 211 |
| 441 | 3300025903 | Ga0207680_10145817 | Ga0207680_101458172 | 211 |
| 442 | 3300025904 | Ga0207647_10014821 | Ga0207647_100148217 | 211 |
| 443 | 3300025907 | Ga0207645_10023605 | Ga0207645_100236054 | 211 |
| 444 | 3300025908 | Ga0207643_10270556 | Ga0207643_102705562 | 211 |
| 445 | 3300025919 | Ga0207657_10039319 | Ga0207657_100393195 | 211 |
| 446 | 3300025919 | Ga0207657_10042957 | Ga0207657_100429573 | 211 |
| 447 | 3300025919 | Ga0207657_10231699 | Ga0207657_102316992 | 211 |
| 448 | 3300025920 | Ga0207649_10372656 | Ga0207649_103726562 | 211 |
| 449 | 3300025924 | Ga0207694_10087365 | Ga0207694_100873653 | 211 |
| 450 | 3300025926 | Ga0207659_10054284 | Ga0207659_100542843 | 211 |
| 451 | 3300025927 | Ga0207687_10294734 | Ga0207687_102947343 | 211 |
| 452 | 3300025931 | Ga0207644_10000196 | Ga0207644_1000019611 | 211 |
| 453 | 3300025931 | Ga0207644_10094735 | Ga0207644_100947352 | 211 |
| 454 | 3300025932 | Ga0207690_10076399 | Ga0207690_100763995 | 211 |
| 455 | 3300025933 | Ga0207706_10000840 | Ga0207706_1000084013 | 211 |
| 456 | 3300025933 | Ga0207706_10004449 | Ga0207706_1000444913 | 211 |
| 457 | 3300025935 | Ga0207709_10331398 | Ga0207709_103313982 | 211 |
| 458 | 3300025940 | Ga0207691_10000705 | Ga0207691_1000070517 | 211 |
| 459 | 3300025940 | Ga0207691_10015370 | Ga0207691_100153706 | 211 |
| 460 | 3300025941 | Ga0207711_10005440 | Ga0207711_100054402 | 211 |
| 461 | 3300025942 | Ga0207689_10010936 | Ga0207689_100109369 | 211 |
| 462 | 3300025945 | Ga0207679_10122637 | Ga0207679_101226372 | 211 |
| 463 | 3300025960 | Ga0207651_10000999 | Ga0207651_1000099915 | 211 |
| 464 | 3300025960 | Ga0207651_10160136 | Ga0207651_101601363 | 211 |
| 465 | 3300025972 | Ga0207668_10286224 | Ga0207668_102862243 | 211 |
| 466 | 3300025981 | Ga0207640_10179242 | Ga0207640_101792422 | 211 |
| 467 | 3300025981 | Ga0207640_10713191 | Ga0207640_107131911 | 211 |
| 468 | 3300025986 | Ga0207658_10033791 | Ga0207658_100337916 | 211 |
| 469 | 3300025986 | Ga0207658_10156901 | Ga0207658_101569012 | 211 |
| 470 | 3300026023 | Ga0207677_10018096 | Ga0207677_100180963 | 211 |
| 471 | 3300026023 | Ga0207677_10117830 | Ga0207677_101178304 | 211 |
| 472 | 3300026023 | Ga0207677_10409135 | Ga0207677_104091352 | 211 |
| 473 | 3300026035 | Ga0207703_10069607 | Ga0207703_100696072 | 211 |
| 474 | 3300026035 | Ga0207703_10337034 | Ga0207703_103370341 | 211 |
| 475 | 3300026041 | Ga0207639_10158071 | Ga0207639_101580713 | 211 |
| 476 | 3300026067 | Ga0207678_10004245 | Ga0207678_100042457 | 211 |
| 477 | 3300026067 | Ga0207678_10060651 | Ga0207678_100606514 | 211 |
| 478 | 3300026089 | Ga0207648_10000889 | Ga0207648_1000088916 | 211 |
| 479 | 3300026089 | Ga0207648_10009239 | Ga0207648_100092395 | 211 |
| 480 | 3300026095 | Ga0207676_10143031 | Ga0207676_101430312 | 211 |
| 481 | 3300026116 | Ga0207674_10350189 | Ga0207674_103501891 | 211 |
| 482 | 3300026121 | Ga0207683_10001943 | Ga0207683_1000194317 | 211 |
| 483 | 3300026121 | Ga0207683_10002694 | Ga0207683_100026942 | 211 |
| 484 | 3300026142 | Ga0207698_10005796 | Ga0207698_100057963 | 211 |
| 485 | 3300028381 | Ga0268264_10124925 | Ga0268264_101249253 | 211 |
| 486 | 3300037312 | Ga0395899_0000103 | Ga0395899_0000103_117290_118000 | 211 |
| 487 | 3300037312 | Ga0395899_0031413 | Ga0395899_0031413_2123_2788 | 211 |
| 488 | 3300037418 | Ga0395900_0002384 | Ga0395900_0002384_5513_6223 | 211 |
| 489 | 3300037418 | Ga0395900_0289330 | Ga0395900_0289330_233_949 | 211 |
| 490 | 3300037466 | Ga0395898_0000053 | Ga0395898_0000053_171891_172601 | 211 |
| 491 | 3300037466 | Ga0395898_0055086 | Ga0395898_0055086_2011_2676 | 211 |
| 492 | 3300037471 | Ga0395905_0000031 | Ga0395905_0000031_114157_114867 | 211 |
| 493 | 3300038443 | Ga0395901_0000163 | Ga0395901_0000163_74973_75683 | 211 |
| 494 | 3300038443 | Ga0395901_0172036 | Ga0395901_0172036_589_1254 | 211 |
| 495 | 3300044694 | Ga0466963_0003565 | Ga0466963_0003565_5532_6197 | 211 |
| 496 | 3300044719 | Ga0466971_0001977 | Ga0466971_0001977_2464_3129 | 211 |
| 497 | 3300044842 | Ga0466957_0026243 | Ga0466957_0026243_386_1051 | 211 |
| 498 | 3300044901 | Ga0466960_0261844 | Ga0466960_0261844_160_861 | 211 |
| 499 | 3300045836 | Ga0466958_0003049 | Ga0466958_0003049_2113_2778 | 211 |
| 500 | 3300045976 | Ga0466967_0053129 | Ga0466967_0053129_200_865 | 211 |
| 501 | 3300048903 | Ga0496100_0005386 | Ga0496100_0005386_5568_6233 | 211 |
| 502 | 3300048904 | Ga0496101_0006613 | Ga0496101_0006613_4112_4777 | 211 |
| 503 | 3300048905 | Ga0496102_0046197 | Ga0496102_0046197_1226_1891 | 211 |
| 504 | 3300048905 | Ga0496102_0403847 | Ga0496102_0403847_436_1101 | 211 |
| 505 | 3300048906 | Ga0496103_0010493 | Ga0496103_0010493_2473_3138 | 211 |
| 506 | 3300048907 | Ga0496104_0034086 | Ga0496104_0034086_643_1308 | 211 |
| 507 | 3300048908 | Ga0496105_0097795 | Ga0496105_0097795_1117_1782 | 211 |
| 508 | 3300048909 | Ga0496106_0003808 | Ga0496106_0003808_8249_8914 | 211 |
| 509 | 3300048909 | Ga0496106_0176142 | Ga0496106_0176142_950_1615 | 211 |
| 510 | 3300048910 | Ga0496107_0009640 | Ga0496107_0009640_2157_2822 | 211 |
| 511 | 3300048910 | Ga0496107_0381868 | Ga0496107_0381868_15_680 | 211 |
| 512 | 3300048911 | Ga0496108_0000396 | Ga0496108_0000396_12702_13367 | 211 |
| 513 | 3300048912 | Ga0496109_0003559 | Ga0496109_0003559_1771_2436 | 211 |
| 514 | 3300048913 | Ga0496110_0002181 | Ga0496110_0002181_4211_4876 | 211 |
| 515 | 3300048914 | Ga0496111_0000917 | Ga0496111_0000917_4879_5544 | 211 |
| 516 | 3300048915 | Ga0496112_0003726 | Ga0496112_0003726_6439_7104 | 211 |
| 517 | 3300048915 | Ga0496112_0165703 | Ga0496112_0165703_1293_1958 | 211 |
| 518 | 3300048916 | Ga0496113_0002217 | Ga0496113_0002217_3006_3671 | 211 |
| 519 | 3300048917 | Ga0496114_0000152 | Ga0496114_0000152_46578_47246 | 211 |
| 520 | 3300061719 | Ga0466962_0003110 | Ga0466962_0003110_2512_3177 | 211 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fem-assembly1.cif.gz_A | mutant r188m of the cytidine monophosphate kinase from e. coli | 0.8909 | 11 | 202 |
| 1cke-assembly1.cif.gz_A | cmp kinase from escherichia coli free enzyme structure | 0.8879 | 11 | 202 |
| 4e22-assembly1.cif.gz_A | structure of cytidine monophosphate kinase from yersinia pseudotuberculosis | 0.8791 | 7 | 202 |
| 3r20-assembly1.cif.gz_A | crystal structure of cytidylate kinase from mycobacterium smegmatis | 0.8378 | 10 | 197 |
| 4e22-assembly1.cif.gz_A | structure of cytidine monophosphate kinase from yersinia pseudotuberculosis | 0.829 | 7 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2femA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8909 | 11 | 202 | 3.40.50.300 |
| 2femA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8226 | 11 | 202 | 3.40.50.300 |
| 2h92C00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7808 | 10 | 200 | 3.40.50.300 |
| 4dieB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7542 | 10 | 200 | 3.40.50.300 |
| 3w90A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7332 | 12 | 196 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A285M6Y7-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.9387 | 7 | 203 |
GO:0005524
GO:0005737 GO:0006220 GO:0036430 GO:0036431 |
| AF-A0A3B0RXE6-F1-model_v4 | 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) | 0.9099 | 7 | 206 |
GO:0003866
GO:0005524 GO:0008652 GO:0009073 GO:0009423 GO:0036430 GO:0036431 |
| AF-A0A2N2UIP7-F1-model_v4 | Multifunctional fusion protein [Includes: 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19) (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS); Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase)] | 0.9001 | 11 | 202 |
GO:0003866
GO:0005524 GO:0005737 GO:0006220 GO:0008652 GO:0009073 GO:0009423 GO:0036430 GO:0036431 |
| AF-A0A389M5X6-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.8987 | 9 | 204 |
GO:0005524
GO:0005737 GO:0006220 GO:0036430 GO:0036431 |
| AF-A0A0H3XH65-F1-model_v4 | Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase) | 0.891 | 11 | 205 |
GO:0005524
GO:0005737 GO:0006220 GO:0036430 GO:0036431 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar