F458522

General Info

Members Datasets Scaffolds Average Seq Length
520 236 1040 279

Family's Representative Sequence

Representative Sequence 3300006048|Ga0075363_100084075|Ga0075363_1000840752
Length 329
Sequence MLRLLFLGDIIGEPGRRAVAEMLPGLKEAWEIDFVVVNGENSAAGRGITGKISIDLLRAGVAVITTGDHIWDQKELMGYIDTEPRLLRPINYPPETPGRGSIVLETAKGKIGVINVQGRTFMQPSLENPFLTIDEEVRRMRDETRMIFVDVHAETTSEKIAMGRFLEGRVSAVAGTHTHVQTADEQIFPGGTAFICDVGMCGPTESVLGREIQPIVQRFLTSMPVNFPVAKGEVKLHGLLVDIDEITGKALAVRRVAEPHVVVTEVVPATHPVDTGRTNNGEESPTDDSPQGCDENGPSARRAFLNLDTHASKSPNLHLFQRQRTDSSG

Samples

Sample ID Description Type Environment
1 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
105 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
160 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
206 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
216 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
217 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
218 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
219 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
220 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
221 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
222 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
235 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
236 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.73
Nodule 0
Rhizoplane 6.35
Rhizosphere 89.23
Stem 0
Stem Tuber 0
Unclassified 15.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075363_100084075 3300006048 Bacteria 1744
2 SwRhRL3b_contig_4380819 2162886006 Bacteria 1937
3 SwRhRL2b_contig_2151885 2162886007 Bacteria 1715
4 JGI24035J26624_1003117 3300002126 Bacteria 1552
5 JGI24035J26624_1003841 3300002126 Bacteria 1423
6 JGI25406J46586_10019826 3300003203 Bacteria 2732
7 rootH2_10235358 3300003320 Bacteria 1455
8 Ga0065712_10068408 3300005290 Bacteria 10865
9 Ga0065715_10012001 3300005293 Bacteria 2492
10 Ga0065715_10089033 3300005293 Bacteria 16097
11 Ga0065715_10090541 3300005293 Bacteria 6844
12 Ga0065715_10104106 3300005293 Bacteria 2951
13 Ga0070676_10022662 3300005328 Bacteria 3524
14 Ga0070676_10090780 3300005328 Bacteria 1871
15 Ga0070676_10204616 3300005328 Bacteria 1296
16 Ga0070676_10248508 3300005328 Unclassified 1186
17 Ga0070683_100013177 3300005329 Bacteria 7200
18 Ga0070683_100069616 3300005329 Bacteria 3281
19 Ga0070683_100319148 3300005329 Bacteria 1478
20 Ga0070690_100114820 3300005330 Bacteria 1801
21 Ga0070670_100028784 3300005331 Unclassified 4783
22 Ga0070670_100054332 3300005331 Unclassified 3438
23 Ga0068869_100188639 3300005334 Bacteria 1620
24 Ga0070666_10111900 3300005335 Bacteria 1888
25 Ga0070682_100109433 3300005337 Bacteria 1839
26 Ga0068868_100113358 3300005338 Bacteria 2205
27 Ga0068868_100163589 3300005338 Bacteria 1839
28 Ga0070660_100340563 3300005339 Bacteria 1234
29 Ga0070689_100123988 3300005340 Bacteria 2066
30 Ga0070689_100360973 3300005340 Bacteria 1221
31 Ga0070687_100053932 3300005343 Bacteria 2093
32 Ga0070661_100375641 3300005344 Bacteria 1120
33 Ga0070668_100113119 3300005347 Bacteria 2162
34 Ga0070668_100354465 3300005347 Bacteria 1243
35 Ga0070669_100107187 3300005353 Bacteria 2116
36 Ga0070669_100301077 3300005353 Bacteria 1290
37 Ga0070669_100334613 3300005353 Unclassified 1225
38 Ga0070675_100020188 3300005354 Bacteria 5317
39 Ga0070675_100021369 3300005354 Bacteria 5172
40 Ga0070675_100079034 3300005354 Unclassified 2740
41 Ga0070675_100139759 3300005354 Bacteria 2069
42 Ga0070675_100160978 3300005354 Bacteria 1930
43 Ga0070675_100283623 3300005354 Bacteria 1456
44 Ga0070671_100004271 3300005355 Bacteria 11305
45 Ga0070671_100016653 3300005355 Bacteria 5943
46 Ga0070671_100039549 3300005355 Bacteria 3914
47 Ga0070671_100041937 3300005355 Bacteria 3804
48 Ga0070671_100115666 3300005355 Bacteria 2255
49 Ga0070671_100196415 3300005355 Bacteria 1710
50 Ga0070674_100004495 3300005356 Bacteria 7958
51 Ga0070674_100021814 3300005356 Bacteria 4120
52 Ga0070674_100068365 3300005356 Bacteria 2502
53 Ga0070674_100083832 3300005356 Bacteria 2284
54 Ga0070673_100015043 3300005364 Bacteria 5416
55 Ga0070673_100033078 3300005364 Bacteria 3899
56 Ga0070688_100011468 3300005365 Bacteria 4925
57 Ga0070688_100030422 3300005365 Unclassified 3241
58 Ga0070659_100020105 3300005366 Bacteria 5070
59 Ga0070667_100020154 3300005367 Bacteria 5537
60 Ga0070667_100044438 3300005367 Bacteria 3731
61 Ga0070709_10010076 3300005434 Bacteria 5224
62 Ga0070714_100038493 3300005435 Bacteria 4020
63 Ga0070711_100008424 3300005439 Bacteria 6316
64 Ga0070711_100053720 3300005439 Bacteria 2777
65 Ga0070711_100069022 3300005439 Bacteria 2486
66 Ga0070705_100003907 3300005440 Bacteria 7287
67 Ga0070700_100072626 3300005441 Bacteria 2200
68 Ga0070694_100193699 3300005444 Bacteria 1511
69 Ga0070708_100021566 3300005445 Bacteria 5450
70 Ga0070708_100030326 3300005445 Bacteria 4674
71 Ga0070708_100126700 3300005445 Bacteria 2361
72 Ga0070708_100166940 3300005445 Unclassified 2053
73 Ga0070708_100298257 3300005445 Unclassified 1517
74 Ga0070663_100032562 3300005455 Bacteria 3594
75 Ga0070663_100086055 3300005455 Bacteria 2321
76 Ga0070678_100172131 3300005456 Bacteria 1765
77 Ga0070678_100236148 3300005456 Bacteria 1526
78 Ga0070678_100237335 3300005456 Unclassified 1523
79 Ga0070662_100085547 3300005457 Bacteria 2357
80 Ga0070681_10231693 3300005458 Bacteria 1761
81 Ga0068867_100074230 3300005459 Unclassified 2549
82 Ga0068867_100488592 3300005459 Bacteria 1056
83 Ga0070685_10088439 3300005466 Bacteria 1871
84 Ga0070706_100000035 3300005467 Bacteria 152107
85 Ga0070706_100002580 3300005467 Bacteria 18211
86 Ga0070706_100004157 3300005467 Bacteria 14075
87 Ga0070706_100032094 3300005467 Bacteria 4844
88 Ga0070706_100055603 3300005467 Bacteria 3653
89 Ga0070706_100090542 3300005467 Bacteria 2837
90 Ga0070706_100102866 3300005467 Bacteria 2656
91 Ga0070707_100001740 3300005468 Bacteria 20969
92 Ga0070707_100007728 3300005468 Bacteria 9989
93 Ga0070707_100015818 3300005468 Bacteria 7083
94 Ga0070707_100049512 3300005468 Unclassified 4028
95 Ga0070707_100078309 3300005468 Unclassified 3189
96 Ga0070707_100169356 3300005468 Bacteria 2129
97 Ga0070707_100221608 3300005468 Bacteria 1842
98 Ga0070707_100296713 3300005468 Unclassified 1570
99 Ga0070707_100312668 3300005468 Bacteria 1527
100 Ga0070707_100402026 3300005468 Bacteria 1330
101 Ga0070698_100000732 3300005471 Bacteria 35269
102 Ga0070698_100010668 3300005471 Bacteria 9788
103 Ga0070698_100049206 3300005471 Bacteria 4304
104 Ga0070698_100070521 3300005471 Bacteria 3506
105 Ga0070699_100042178 3300005518 Bacteria 3948
106 Ga0070699_100052031 3300005518 Bacteria 3546
107 Ga0070699_100057013 3300005518 Bacteria 3383
108 Ga0070699_100158089 3300005518 Unclassified 2005
109 Ga0070699_100158858 3300005518 Bacteria 2000
110 Ga0070699_100239810 3300005518 Bacteria 1618
111 Ga0070679_100069537 3300005530 Bacteria 3511
112 Ga0070684_100026781 3300005535 Bacteria 4860
113 Ga0070697_100005705 3300005536 Bacteria 9588
114 Ga0070697_100012378 3300005536 Bacteria 6684
115 Ga0070697_100022754 3300005536 Bacteria 4980
116 Ga0070697_100057036 3300005536 Bacteria 3178
117 Ga0070697_100183997 3300005536 Bacteria 1772
118 Ga0070697_100216250 3300005536 Bacteria 1632
119 Ga0070697_100224732 3300005536 Unclassified 1600
120 Ga0070697_100417512 3300005536 Unclassified 1166
121 Ga0070697_100568435 3300005536 Bacteria 995
122 Ga0068853_100000012 3300005539 Bacteria 228770
123 Ga0070672_100019475 3300005543 Bacteria 4926
124 Ga0070686_100069155 3300005544 Bacteria 2305
125 Ga0070695_100184367 3300005545 Bacteria 1481
126 Ga0070695_100290075 3300005545 Bacteria 1206
127 Ga0070693_100406627 3300005547 Unclassified 945
128 Ga0070665_100025077 3300005548 Bacteria 6010
129 Ga0070665_100298580 3300005548 Bacteria 1613
130 Ga0070704_100007443 3300005549 Bacteria 6523
131 Ga0070664_100060943 3300005564 Bacteria 3214
132 Ga0070664_100271492 3300005564 Bacteria 1528
133 Ga0070664_100348881 3300005564 Bacteria 1346
134 Ga0068856_100077503 3300005614 Bacteria 3293
135 Ga0070702_100045738 3300005615 Bacteria 2478
136 Ga0068852_100113197 3300005616 Bacteria 2471
137 Ga0068864_100061025 3300005618 Bacteria 3265
138 Ga0068866_10135681 3300005718 Unclassified 1406
139 Ga0068861_100377991 3300005719 Bacteria 1251
140 Ga0068863_100007852 3300005841 Bacteria 10434
141 Ga0068863_100344513 3300005841 Bacteria 1450
142 Ga0068858_100035942 3300005842 Bacteria 4594
143 Ga0068858_100232883 3300005842 Bacteria 1746
144 Ga0068860_100002169 3300005843 Bacteria 20676
145 Ga0068860_100052268 3300005843 Bacteria 3887
146 Ga0068860_100089425 3300005843 Bacteria 2932
147 Ga0068860_100833972 3300005843 Unclassified 936
148 Ga0068862_100155480 3300005844 Bacteria 2038
149 Ga0081455_10004605 3300005937 Bacteria 15400
150 Ga0081455_10023501 3300005937 Bacteria 5733
151 Ga0081455_10024366 3300005937 Bacteria 5605
152 Ga0081455_10055884 3300005937 Bacteria 3355
153 Ga0081455_10088244 3300005937 Bacteria 2521
154 Ga0081540_1000018 3300005983 Bacteria 164931
155 Ga0081539_10000052 3300005985 Bacteria 268240
156 Ga0081539_10075450 3300005985 Unclassified 1791
157 Ga0081539_10075579 3300005985 Bacteria 1789
158 Ga0070717_10015256 3300006028 Bacteria 5929
159 Ga0070717_10017681 3300006028 Bacteria 5552
160 Ga0070717_10024883 3300006028 Bacteria 4756
161 Ga0070717_10030036 3300006028 Bacteria 4365
162 Ga0070717_10118280 3300006028 Bacteria 2268
163 Ga0070717_10214465 3300006028 Unclassified 1690
164 Ga0070717_10285178 3300006028 Bacteria 1465
165 Ga0070715_10046629 3300006163 Bacteria 1843
166 Ga0070716_100076952 3300006173 Bacteria 1979
167 Ga0070712_100110243 3300006175 Bacteria 2052
168 Ga0070712_100279235 3300006175 Bacteria 1345
169 Ga0070712_100338327 3300006175 Unclassified 1228
170 Ga0075362_10004823 3300006177 Bacteria 4868
171 Ga0075366_10086151 3300006195 Bacteria 1879
172 Ga0097621_100086966 3300006237 Bacteria 2609
173 Ga0097621_100317713 3300006237 Bacteria 1379
174 Ga0097621_100486109 3300006237 Unclassified 1116
175 Ga0068871_100007276 3300006358 Bacteria 7896
176 Ga0068871_100010040 3300006358 Bacteria 6885
177 Ga0075428_100116523 3300006844 Bacteria 2910
178 Ga0075433_10642319 3300006852 Bacteria 931
179 Ga0075434_100273078 3300006871 Bacteria 1710
180 Ga0075436_100011369 3300006914 Bacteria 6111
181 Ga0075436_100303866 3300006914 Bacteria 1144
182 Ga0075435_100145178 3300007076 Bacteria 1993
183 Ga0105240_10000043 3300009093 Bacteria 254256
184 Ga0105240_10316844 3300009093 Bacteria 1779
185 Ga0111539_10448962 3300009094 Bacteria 1501
186 Ga0111539_10537689 3300009094 Bacteria 1361
187 Ga0105245_10043951 3300009098 Unclassified 3986
188 Ga0105247_10166882 3300009101 Bacteria 1461
189 Ga0114129_10010037 3300009147 Bacteria 13498
190 Ga0105249_10142545 3300009553 Bacteria 2299
191 Ga0099796_10011641 3300010159 Bacteria 2460
192 Ga0099796_10015935 3300010159 Unclassified 2209
193 Ga0099796_10033131 3300010159 Bacteria 1698
194 Ga0105239_10059125 3300010375 Bacteria 4207
195 Ga0105239_10169758 3300010375 Bacteria 2439
196 Ga0105239_10217306 3300010375 Bacteria 2143
197 Ga0105239_10513195 3300010375 Bacteria 1363
198 Ga0157371_10037492 3300013102 Bacteria 3469
199 Ga0157371_10077218 3300013102 Bacteria 2358
200 Ga0157369_10022226 3300013105 Bacteria 7084
201 Ga0157374_10000059 3300013296 Bacteria 116409
202 Ga0157374_10005835 3300013296 Bacteria 10404
203 Ga0157374_10079502 3300013296 Bacteria 3108
204 Ga0157374_10080215 3300013296 Unclassified 3094
205 Ga0157374_10220913 3300013296 Bacteria 1859
206 Ga0157374_10271104 3300013296 Bacteria 1673
207 Ga0157374_10275658 3300013296 Bacteria 1659
208 Ga0157374_10285377 3300013296 Unclassified 1630
209 Ga0157378_10008025 3300013297 Bacteria 9216
210 Ga0157378_10013750 3300013297 Bacteria 7079
211 Ga0157378_10045474 3300013297 Unclassified 3901
212 Ga0157378_10055922 3300013297 Bacteria 3516
213 Ga0157378_10079190 3300013297 Unclassified 2966
214 Ga0157378_10084520 3300013297 Bacteria 2874
215 Ga0157378_10095219 3300013297 Unclassified 2712
216 Ga0157378_10219401 3300013297 Bacteria 1807
217 Ga0157378_10896050 3300013297 Unclassified 917
218 Ga0163162_10009133 3300013306 Bacteria 9642
219 Ga0163162_10014878 3300013306 Bacteria 7598
220 Ga0163162_10020371 3300013306 Bacteria 6516
221 Ga0163162_10063861 3300013306 Unclassified 3726
222 Ga0163162_10066505 3300013306 Bacteria 3653
223 Ga0163162_10339843 3300013306 Bacteria 1634
224 Ga0157372_10039614 3300013307 Bacteria 5201
225 Ga0157372_10566100 3300013307 Bacteria 1325
226 Ga0157375_10022497 3300013308 Bacteria 5802
227 Ga0157375_10078089 3300013308 Bacteria 3342
228 Ga0157375_10141809 3300013308 Unclassified 2530
229 Ga0157375_10152262 3300013308 Bacteria 2449
230 Ga0157375_10249996 3300013308 Bacteria 1934
231 Ga0163163_10068453 3300014325 Bacteria 3532
232 Ga0163163_10088694 3300014325 Bacteria 3104
233 Ga0163163_10136167 3300014325 Bacteria 2497
234 Ga0163163_10231246 3300014325 Bacteria 1898
235 Ga0163163_10315513 3300014325 Unclassified 1617
236 Ga0163163_10382053 3300014325 Bacteria 1466
237 Ga0157379_10073005 3300014968 Bacteria 3071
238 Ga0157376_10052631 3300014969 Bacteria 3386
239 Ga0157376_10089775 3300014969 Bacteria 2658
240 Ga0157376_10096074 3300014969 Unclassified 2578
241 Ga0157376_10194858 3300014969 Bacteria 1860
242 Ga0182005_1024284 3300015265 Bacteria 1656
243 Ga0213872_10038979 3300021361 Bacteria 2169
244 Ga0213872_10106244 3300021361 Bacteria 1249
245 Ga0213872_10107496 3300021361 Bacteria 1240
246 Ga0213874_10038824 3300021377 Unclassified 1415
247 Ga0213876_10024479 3300021384 Bacteria 3187
248 Ga0213876_10036263 3300021384 Bacteria 2601
249 Ga0213871_10025265 3300021441 Bacteria 1511
250 Ga0213871_10038566 3300021441 Bacteria 1276
251 Ga0207666_1001009 3300025271 Bacteria 3343
252 Ga0207673_1000545 3300025290 Bacteria 4006
253 Ga0207673_1000692 3300025290 Bacteria 3595
254 Ga0207697_10000337 3300025315 Bacteria 26165
255 Ga0207697_10003599 3300025315 Bacteria 7605
256 Ga0207697_10003976 3300025315 Bacteria 7171
257 Ga0207697_10011356 3300025315 Bacteria 3768
258 Ga0207697_10011641 3300025315 Unclassified 3714
259 Ga0207697_10017738 3300025315 Bacteria 2925
260 Ga0207697_10021911 3300025315 Bacteria 2618
261 Ga0207697_10028587 3300025315 Bacteria 2280
262 Ga0207653_10013151 3300025885 Bacteria 2590
263 Ga0207653_10021869 3300025885 Bacteria 2030
264 Ga0207682_10036200 3300025893 Unclassified 1997
265 Ga0207692_10023160 3300025898 Bacteria 2868
266 Ga0207642_10082072 3300025899 Bacteria 1569
267 Ga0207688_10003691 3300025901 Bacteria 8366
268 Ga0207680_10071164 3300025903 Bacteria 2155
269 Ga0207647_10022346 3300025904 Bacteria 4202
270 Ga0207647_10140147 3300025904 Bacteria 1417
271 Ga0207699_10044441 3300025906 Bacteria 2586
272 Ga0207645_10008167 3300025907 Bacteria 7330
273 Ga0207645_10013361 3300025907 Bacteria 5536
274 Ga0207645_10089461 3300025907 Unclassified 1980
275 Ga0207645_10230628 3300025907 Bacteria 1222
276 Ga0207705_10010182 3300025909 Bacteria 6840
277 Ga0207705_10080818 3300025909 Bacteria 2369
278 Ga0207684_10000043 3300025910 Bacteria 259939
279 Ga0207684_10005045 3300025910 Bacteria 12304
280 Ga0207684_10027326 3300025910 Bacteria 4863
281 Ga0207684_10027522 3300025910 Bacteria 4843
282 Ga0207684_10032316 3300025910 Bacteria 4451
283 Ga0207684_10057695 3300025910 Unclassified 3294
284 Ga0207684_10084218 3300025910 Bacteria 2708
285 Ga0207684_10086934 3300025910 Bacteria 2663
286 Ga0207684_10105672 3300025910 Bacteria 2408
287 Ga0207684_10132505 3300025910 Bacteria 2139
288 Ga0207684_10153928 3300025910 Unclassified 1979
289 Ga0207684_10465094 3300025910 Unclassified 1085
290 Ga0207695_10000181 3300025913 Bacteria 185042
291 Ga0207693_10002399 3300025915 Bacteria 16263
292 Ga0207693_10007118 3300025915 Bacteria 9227
293 Ga0207693_10062793 3300025915 Bacteria 2910
294 Ga0207693_10099152 3300025915 Bacteria 2284
295 Ga0207693_10394230 3300025915 Unclassified 1082
296 Ga0207663_10090453 3300025916 Bacteria 2029
297 Ga0207662_10080305 3300025918 Bacteria 1989
298 Ga0207649_10137512 3300025920 Bacteria 1668
299 Ga0207646_10001979 3300025922 Bacteria 24592
300 Ga0207646_10002145 3300025922 Bacteria 23583
301 Ga0207646_10027642 3300025922 Bacteria 5171
302 Ga0207646_10041019 3300025922 Bacteria 4162
303 Ga0207646_10050265 3300025922 Bacteria 3731
304 Ga0207646_10107610 3300025922 Bacteria 2501
305 Ga0207646_10110803 3300025922 Unclassified 2463
306 Ga0207646_10121273 3300025922 Bacteria 2349
307 Ga0207646_10149476 3300025922 Bacteria 2106
308 Ga0207646_10177735 3300025922 Bacteria 1922
309 Ga0207646_10184180 3300025922 Unclassified 1886
310 Ga0207646_10235484 3300025922 Unclassified 1654
311 Ga0207681_10024067 3300025923 Bacteria 3904
312 Ga0207681_10506057 3300025923 Unclassified 989
313 Ga0207650_10105416 3300025925 Unclassified 2176
314 Ga0207659_10061951 3300025926 Bacteria 2698
315 Ga0207659_10125675 3300025926 Bacteria 1972
316 Ga0207659_10145509 3300025926 Bacteria 1845
317 Ga0207700_10094542 3300025928 Bacteria 2369
318 Ga0207700_10137832 3300025928 Bacteria 2001
319 Ga0207700_10166638 3300025928 Unclassified 1834
320 Ga0207644_10021116 3300025931 Unclassified 4433
321 Ga0207644_10112877 3300025931 Bacteria 2057
322 Ga0207644_10115976 3300025931 Bacteria 2032
323 Ga0207644_10133823 3300025931 Unclassified 1901
324 Ga0207644_10201534 3300025931 Bacteria 1570
325 Ga0207690_10033086 3300025932 Bacteria 3322
326 Ga0207706_10026724 3300025933 Bacteria 5167
327 Ga0207706_10075167 3300025933 Bacteria 2971
328 Ga0207706_10098803 3300025933 Bacteria 2568
329 Ga0207670_10012113 3300025936 Bacteria 5032
330 Ga0207670_10038569 3300025936 Unclassified 3121
331 Ga0207670_10080154 3300025936 Bacteria 2281
332 Ga0207669_10030578 3300025937 Bacteria 2994
333 Ga0207669_10072268 3300025937 Unclassified 2171
334 Ga0207704_10192023 3300025938 Unclassified 1486
335 Ga0207704_10234403 3300025938 Bacteria 1367
336 Ga0207665_10008481 3300025939 Bacteria 6768
337 Ga0207665_10028236 3300025939 Bacteria 3706
338 Ga0207665_10074216 3300025939 Bacteria 2328
339 Ga0207665_10151278 3300025939 Bacteria 1662
340 Ga0207691_10002283 3300025940 Bacteria 18765
341 Ga0207691_10007180 3300025940 Bacteria 10747
342 Ga0207691_10012683 3300025940 Bacteria 8073
343 Ga0207691_10059318 3300025940 Bacteria 3480
344 Ga0207661_10031734 3300025944 Bacteria 4085
345 Ga0207661_10046233 3300025944 Bacteria 3451
346 Ga0207679_10254232 3300025945 Bacteria 1495
347 Ga0207679_10318347 3300025945 Bacteria 1346
348 Ga0207651_10003656 3300025960 Bacteria 7590
349 Ga0207651_10006112 3300025960 Bacteria 6258
350 Ga0207651_10060214 3300025960 Bacteria 2635
351 Ga0207651_10095081 3300025960 Bacteria 2193
352 Ga0207651_10214791 3300025960 Bacteria 1551
353 Ga0207712_10027858 3300025961 Bacteria 3775
354 Ga0207668_10119343 3300025972 Bacteria 1994
355 Ga0207640_10158611 3300025981 Bacteria 1671
356 Ga0207658_10010884 3300025986 Bacteria 6191
357 Ga0207658_10098842 3300025986 Unclassified 2281
358 Ga0207658_10102454 3300025986 Bacteria 2245
359 Ga0207658_10193009 3300025986 Bacteria 1695
360 Ga0207677_10352843 3300026023 Unclassified 1233
361 Ga0207677_10376060 3300026023 Bacteria 1198
362 Ga0207703_10051997 3300026035 Bacteria 3324
363 Ga0207703_10112041 3300026035 Bacteria 2330
364 Ga0207639_10000017 3300026041 Bacteria 256177
365 Ga0207678_10018450 3300026067 Bacteria 6127
366 Ga0207708_10003672 3300026075 Bacteria 11335
367 Ga0207641_10024418 3300026088 Bacteria 4983
368 Ga0207641_10093197 3300026088 Bacteria 2640
369 Ga0207648_10229849 3300026089 Unclassified 1650
370 Ga0207676_10171951 3300026095 Bacteria 1889
371 Ga0207675_100430796 3300026118 Bacteria 1304
372 Ga0207683_10015360 3300026121 Bacteria 6520
373 Ga0207683_10017265 3300026121 Bacteria 6147
374 Ga0207683_10026147 3300026121 Bacteria 5038
375 Ga0207683_10039292 3300026121 Bacteria 4128
376 Ga0207683_10049808 3300026121 Bacteria 3668
377 Ga0207683_10111185 3300026121 Bacteria 2453
378 Ga0268266_10016163 3300028379 Bacteria 6382
379 Ga0268266_10016468 3300028379 Bacteria 6319
380 Ga0268266_10018759 3300028379 Bacteria 5893
381 Ga0268266_10064412 3300028379 Unclassified 3166
382 Ga0268266_10079067 3300028379 Bacteria 2863
383 Ga0268266_10210714 3300028379 Bacteria 1782
384 Ga0268265_10093360 3300028380 Bacteria 2411
385 Ga0268264_10001609 3300028381 Bacteria 20890
386 Ga0268264_10578817 3300028381 Bacteria 1104
387 Ga0265328_10006742 3300031239 Bacteria 4833
388 Ga0265316_10134739 3300031344 Bacteria 1859
389 Ga0265314_10000020 3300031711 Bacteria 307052
390 Ga0373943_0032552 3300035170 Bacteria 2479
391 Ga0373943_0067536 3300035170 Bacteria 1803
392 Ga0373943_0153251 3300035170 Bacteria 1250
393 Ga0373946_0088892 3300035171 Bacteria 1366
394 Ga0373955_0161269 3300035172 Unclassified 1324
395 Ga0373955_0273616 3300035172 Bacteria 1015
396 Ga0373931_0091597 3300035691 Unclassified 1695
397 Ga0373931_0093386 3300035691 Bacteria 1680
398 Ga0373931_0167891 3300035691 Bacteria 1291
399 Ga0373935_0188621 3300035692 Bacteria 1419
400 Ga0373927_0107215 3300035695 Bacteria 1820
401 Ga0373927_0263303 3300035695 Bacteria 1134
402 Ga0373927_0342463 3300035695 Bacteria 985
403 Ga0373947_0114711 3300035725 Bacteria 1706
404 Ga0373937_0287381 3300036401 Bacteria 1553
405 Ga0373937_0373219 3300036401 Unclassified 1352
406 Ga0373925_0094942 3300037068 Bacteria 2284
407 Ga0373925_0105469 3300037068 Unclassified 2172
408 Ga0373925_0185087 3300037068 Bacteria 1651
409 Ga0395900_0110389 3300037418 Unclassified 2825
410 Ga0395898_0006727 3300037466 Bacteria 12258
411 Ga0395898_0097481 3300037466 Unclassified 2824
412 Ga0395905_0112347 3300037471 Bacteria 2559
413 Ga0395905_0236071 3300037471 Unclassified 1709
414 Ga0395905_0540875 3300037471 Unclassified 1066
415 Ga0436364_0001908 3300037853 Bacteria 3522
416 Ga0436364_0784346 3300037853 Bacteria 2536
417 Ga0436364_1317185 3300037853 Bacteria 2273
418 Ga0395901_0009988 3300038443 Bacteria 9619
419 Ga0395901_0179629 3300038443 Unclassified 2219
420 Ga0395901_0243737 3300038443 Bacteria 1874
421 Ga0436365_0274631 3300039437 Bacteria 71187
422 Ga0436365_0292643 3300039437 Bacteria 6395
423 Ga0436365_0511548 3300039437 Unclassified 1260
424 Ga0436365_0774305 3300039437 Bacteria 92788
425 Ga0436365_1153529 3300039437 Bacteria 6997
426 Ga0436360_0064177 3300039438 Bacteria 2548
427 Ga0436360_0181157 3300039438 Bacteria 999
428 Ga0436360_0890065 3300039438 Bacteria 1495
429 Ga0436360_0999617 3300039438 Bacteria 4105
430 Ga0436361_0219401 3300039447 Bacteria 3049
431 Ga0436361_0444714 3300039447 Bacteria 20038
432 Ga0436361_0536230 3300039447 Bacteria 2142
433 Ga0436361_0654100 3300039447 Bacteria 6430
434 Ga0436361_0809872 3300039447 Bacteria 2053
435 Ga0436361_0874588 3300039447 Bacteria 2848
436 Ga0436361_0971942 3300039447 Bacteria 1225
437 Ga0436363_0064540 3300039450 Bacteria 9122
438 Ga0436363_0329569 3300039450 Bacteria 6490
439 Ga0436362_0603905 3300039453 Bacteria 5971
440 Ga0439455_0015001 3300042012 Bacteria 1777
441 Ga0451576_0507658 3300045051 Bacteria 1267
442 Ga0495629_0096243 3300046459 Bacteria 2065
443 Ga0495651_0272146 3300046462 Unclassified 1148
444 Ga0495580_0210503 3300046472 Unclassified 1338
445 Ga0495582_0231902 3300046473 Unclassified 1057
446 Ga0495664_0257143 3300046477 Bacteria 1056
447 Ga0495628_0227629 3300046516 Bacteria 1398
448 Ga0495630_0140410 3300046517 Unclassified 1837
449 Ga0495630_0182057 3300046517 Bacteria 1602
450 Ga0495644_0049052 3300046523 Bacteria 1586
451 Ga0495642_0032015 3300046528 Bacteria 2109
452 Ga0495652_0077079 3300046529 Bacteria 2764
453 Ga0495652_0214261 3300046529 Bacteria 1451
454 Ga0495640_0262508 3300046533 Unclassified 1079
455 Ga0495586_0113849 3300046535 Bacteria 1507
456 Ga0495587_0073323 3300046536 Unclassified 1989
457 Ga0495587_0211389 3300046536 Bacteria 1095
458 Ga0495645_0170602 3300046543 Unclassified 1498
459 Ga0495634_0034465 3300046642 Bacteria 3474
460 Ga0495659_0007145 3300046664 Bacteria 3535
461 Ga0495661_0089556 3300046665 Bacteria 1754
462 Ga0495623_0011180 3300046679 Bacteria 5807
463 Ga0495658_0013423 3300046683 Bacteria 4170
464 Ga0495658_0154816 3300046683 Bacteria 1410
465 Ga0495669_0004171 3300046684 Bacteria 5944
466 Ga0495669_0095637 3300046684 Bacteria 1376
467 Ga0495613_0068710 3300046689 Bacteria 2584
468 Ga0495674_0376771 3300047319 Unclassified 1149
469 Ga0495676_0033751 3300047321 Bacteria 4303
470 Ga0495680_0349844 3300047322 Bacteria 1029
471 Ga0495675_0073979 3300047444 Bacteria 2148
472 Ga0495602_0214849 3300048088 Bacteria 1456
473 Ga0496100_0105732 3300048903 Unclassified 1947
474 Ga0496100_0270407 3300048903 Bacteria 1263
475 Ga0496100_0428128 3300048903 Bacteria 1012
476 Ga0496100_0458561 3300048903 Bacteria 978
477 Ga0496101_0017167 3300048904 Bacteria 4905
478 Ga0496102_0099378 3300048905 Bacteria 2701
479 Ga0496102_0208232 3300048905 Bacteria 1844
480 Ga0496102_0428965 3300048905 Bacteria 1241
481 Ga0496102_0626484 3300048905 Unclassified 999
482 Ga0496104_0234103 3300048907 Unclassified 1749
483 Ga0496105_0077918 3300048908 Bacteria 2737
484 Ga0496106_0088840 3300048909 Bacteria 2383
485 Ga0496107_0067905 3300048910 Bacteria 2587
486 Ga0496108_0133259 3300048911 Bacteria 2136
487 Ga0496108_0358870 3300048911 Bacteria 1272
488 Ga0496109_0070848 3300048912 Bacteria 3200
489 Ga0496109_0286023 3300048912 Bacteria 1554
490 Ga0496109_0308522 3300048912 Bacteria 1493
491 Ga0496109_0335444 3300048912 Bacteria 1428
492 Ga0496109_0357789 3300048912 Bacteria 1379
493 Ga0496110_0063577 3300048913 Bacteria 3261
494 Ga0496110_0232728 3300048913 Bacteria 1676
495 Ga0496111_0092571 3300048914 Bacteria 2216
496 Ga0496111_0199750 3300048914 Bacteria 1487
497 Ga0496112_0019051 3300048915 Bacteria 6469
498 Ga0496112_0044863 3300048915 Bacteria 4332
499 Ga0496112_0049274 3300048915 Bacteria 4129
500 Ga0496112_0158997 3300048915 Unclassified 2226
501 Ga0496112_0307877 3300048915 Bacteria 1529
502 Ga0496113_0284786 3300048916 Bacteria 1322
503 Ga0496114_0035734 3300048917 Bacteria 4104
504 Ga0496114_0233145 3300048917 Bacteria 1618
505 Ga0496115_0003467 3300048918 Bacteria 11336
506 Ga0501073_0240786 3300049589 Bacteria 1249
507 nmdc:mga03683_429_c1 3300050489 Bacteria 12155
508 nmdc:mga0k408_27225_c1 3300050493 Bacteria 3246
509 nmdc:mga05p37_185653_c1 3300050507 Unclassified 2528
510 nmdc:mga05p37_27974_c1 3300050507 Bacteria 6868
511 nmdc:mga0n895_83349_c1 3300050512 Unclassified 3188
512 nmdc:mga0rr50_150778_c1 3300050513 Bacteria 1878
513 nmdc:mga08x19_10573_c1 3300050514 Bacteria 5546
514 nmdc:mga08x19_221388_c1 3300050514 Bacteria 1300
515 nmdc:mga0a205_259270_c1 3300050515 Bacteria 1616
516 Ga0495612_0025091 3300053078 Bacteria 2394
517 Ga0500555_000080 3300053103 Bacteria 46241
518 Ga0500556_0000010 3300053104 Bacteria 258288
519 Ga0500642_0039326 3300053130 Bacteria 2033
520 Ga0500616_0001795 3300053153 Bacteria 19545
521 Ga0075363_100084075
522 SwRhRL3b_contig_4380819
523 SwRhRL2b_contig_2151885
524 JGI24035J26624_1003117
525 JGI24035J26624_1003841
526 JGI25406J46586_10019826
527 rootH2_10235358
528 Ga0065712_10068408
529 Ga0065715_10012001
530 Ga0065715_10089033
531 Ga0065715_10090541
532 Ga0065715_10104106
533 Ga0070676_10022662
534 Ga0070676_10090780
535 Ga0070676_10204616
536 Ga0070676_10248508
537 Ga0070683_100013177
538 Ga0070683_100069616
539 Ga0070683_100319148
540 Ga0070690_100114820
541 Ga0070670_100028784
542 Ga0070670_100054332
543 Ga0068869_100188639
544 Ga0070666_10111900
545 Ga0070682_100109433
546 Ga0068868_100113358
547 Ga0068868_100163589
548 Ga0070660_100340563
549 Ga0070689_100123988
550 Ga0070689_100360973
551 Ga0070687_100053932
552 Ga0070661_100375641
553 Ga0070668_100113119
554 Ga0070668_100354465
555 Ga0070669_100107187
556 Ga0070669_100301077
557 Ga0070669_100334613
558 Ga0070675_100020188
559 Ga0070675_100021369
560 Ga0070675_100079034
561 Ga0070675_100139759
562 Ga0070675_100160978
563 Ga0070675_100283623
564 Ga0070671_100004271
565 Ga0070671_100016653
566 Ga0070671_100039549
567 Ga0070671_100041937
568 Ga0070671_100115666
569 Ga0070671_100196415
570 Ga0070674_100004495
571 Ga0070674_100021814
572 Ga0070674_100068365
573 Ga0070674_100083832
574 Ga0070673_100015043
575 Ga0070673_100033078
576 Ga0070688_100011468
577 Ga0070688_100030422
578 Ga0070659_100020105
579 Ga0070667_100020154
580 Ga0070667_100044438
581 Ga0070709_10010076
582 Ga0070714_100038493
583 Ga0070711_100008424
584 Ga0070711_100053720
585 Ga0070711_100069022
586 Ga0070705_100003907
587 Ga0070700_100072626
588 Ga0070694_100193699
589 Ga0070708_100021566
590 Ga0070708_100030326
591 Ga0070708_100126700
592 Ga0070708_100166940
593 Ga0070708_100298257
594 Ga0070663_100032562
595 Ga0070663_100086055
596 Ga0070678_100172131
597 Ga0070678_100236148
598 Ga0070678_100237335
599 Ga0070662_100085547
600 Ga0070681_10231693
601 Ga0068867_100074230
602 Ga0068867_100488592
603 Ga0070685_10088439
604 Ga0070706_100000035
605 Ga0070706_100002580
606 Ga0070706_100004157
607 Ga0070706_100032094
608 Ga0070706_100055603
609 Ga0070706_100090542
610 Ga0070706_100102866
611 Ga0070707_100001740
612 Ga0070707_100007728
613 Ga0070707_100015818
614 Ga0070707_100049512
615 Ga0070707_100078309
616 Ga0070707_100169356
617 Ga0070707_100221608
618 Ga0070707_100296713
619 Ga0070707_100312668
620 Ga0070707_100402026
621 Ga0070698_100000732
622 Ga0070698_100010668
623 Ga0070698_100049206
624 Ga0070698_100070521
625 Ga0070699_100042178
626 Ga0070699_100052031
627 Ga0070699_100057013
628 Ga0070699_100158089
629 Ga0070699_100158858
630 Ga0070699_100239810
631 Ga0070679_100069537
632 Ga0070684_100026781
633 Ga0070697_100005705
634 Ga0070697_100012378
635 Ga0070697_100022754
636 Ga0070697_100057036
637 Ga0070697_100183997
638 Ga0070697_100216250
639 Ga0070697_100224732
640 Ga0070697_100417512
641 Ga0070697_100568435
642 Ga0068853_100000012
643 Ga0070672_100019475
644 Ga0070686_100069155
645 Ga0070695_100184367
646 Ga0070695_100290075
647 Ga0070693_100406627
648 Ga0070665_100025077
649 Ga0070665_100298580
650 Ga0070704_100007443
651 Ga0070664_100060943
652 Ga0070664_100271492
653 Ga0070664_100348881
654 Ga0068856_100077503
655 Ga0070702_100045738
656 Ga0068852_100113197
657 Ga0068864_100061025
658 Ga0068866_10135681
659 Ga0068861_100377991
660 Ga0068863_100007852
661 Ga0068863_100344513
662 Ga0068858_100035942
663 Ga0068858_100232883
664 Ga0068860_100002169
665 Ga0068860_100052268
666 Ga0068860_100089425
667 Ga0068860_100833972
668 Ga0068862_100155480
669 Ga0081455_10004605
670 Ga0081455_10023501
671 Ga0081455_10024366
672 Ga0081455_10055884
673 Ga0081455_10088244
674 Ga0081540_1000018
675 Ga0081539_10000052
676 Ga0081539_10075450
677 Ga0081539_10075579
678 Ga0070717_10015256
679 Ga0070717_10017681
680 Ga0070717_10024883
681 Ga0070717_10030036
682 Ga0070717_10118280
683 Ga0070717_10214465
684 Ga0070717_10285178
685 Ga0070715_10046629
686 Ga0070716_100076952
687 Ga0070712_100110243
688 Ga0070712_100279235
689 Ga0070712_100338327
690 Ga0075362_10004823
691 Ga0075366_10086151
692 Ga0097621_100086966
693 Ga0097621_100317713
694 Ga0097621_100486109
695 Ga0068871_100007276
696 Ga0068871_100010040
697 Ga0075428_100116523
698 Ga0075433_10642319
699 Ga0075434_100273078
700 Ga0075436_100011369
701 Ga0075436_100303866
702 Ga0075435_100145178
703 Ga0105240_10000043
704 Ga0105240_10316844
705 Ga0111539_10448962
706 Ga0111539_10537689
707 Ga0105245_10043951
708 Ga0105247_10166882
709 Ga0114129_10010037
710 Ga0105249_10142545
711 Ga0099796_10011641
712 Ga0099796_10015935
713 Ga0099796_10033131
714 Ga0105239_10059125
715 Ga0105239_10169758
716 Ga0105239_10217306
717 Ga0105239_10513195
718 Ga0157371_10037492
719 Ga0157371_10077218
720 Ga0157369_10022226
721 Ga0157374_10000059
722 Ga0157374_10005835
723 Ga0157374_10079502
724 Ga0157374_10080215
725 Ga0157374_10220913
726 Ga0157374_10271104
727 Ga0157374_10275658
728 Ga0157374_10285377
729 Ga0157378_10008025
730 Ga0157378_10013750
731 Ga0157378_10045474
732 Ga0157378_10055922
733 Ga0157378_10079190
734 Ga0157378_10084520
735 Ga0157378_10095219
736 Ga0157378_10219401
737 Ga0157378_10896050
738 Ga0163162_10009133
739 Ga0163162_10014878
740 Ga0163162_10020371
741 Ga0163162_10063861
742 Ga0163162_10066505
743 Ga0163162_10339843
744 Ga0157372_10039614
745 Ga0157372_10566100
746 Ga0157375_10022497
747 Ga0157375_10078089
748 Ga0157375_10141809
749 Ga0157375_10152262
750 Ga0157375_10249996
751 Ga0163163_10068453
752 Ga0163163_10088694
753 Ga0163163_10136167
754 Ga0163163_10231246
755 Ga0163163_10315513
756 Ga0163163_10382053
757 Ga0157379_10073005
758 Ga0157376_10052631
759 Ga0157376_10089775
760 Ga0157376_10096074
761 Ga0157376_10194858
762 Ga0182005_1024284
763 Ga0213872_10038979
764 Ga0213872_10106244
765 Ga0213872_10107496
766 Ga0213874_10038824
767 Ga0213876_10024479
768 Ga0213876_10036263
769 Ga0213871_10025265
770 Ga0213871_10038566
771 Ga0207666_1001009
772 Ga0207673_1000545
773 Ga0207673_1000692
774 Ga0207697_10000337
775 Ga0207697_10003599
776 Ga0207697_10003976
777 Ga0207697_10011356
778 Ga0207697_10011641
779 Ga0207697_10017738
780 Ga0207697_10021911
781 Ga0207697_10028587
782 Ga0207653_10013151
783 Ga0207653_10021869
784 Ga0207682_10036200
785 Ga0207692_10023160
786 Ga0207642_10082072
787 Ga0207688_10003691
788 Ga0207680_10071164
789 Ga0207647_10022346
790 Ga0207647_10140147
791 Ga0207699_10044441
792 Ga0207645_10008167
793 Ga0207645_10013361
794 Ga0207645_10089461
795 Ga0207645_10230628
796 Ga0207705_10010182
797 Ga0207705_10080818
798 Ga0207684_10000043
799 Ga0207684_10005045
800 Ga0207684_10027326
801 Ga0207684_10027522
802 Ga0207684_10032316
803 Ga0207684_10057695
804 Ga0207684_10084218
805 Ga0207684_10086934
806 Ga0207684_10105672
807 Ga0207684_10132505
808 Ga0207684_10153928
809 Ga0207684_10465094
810 Ga0207695_10000181
811 Ga0207693_10002399
812 Ga0207693_10007118
813 Ga0207693_10062793
814 Ga0207693_10099152
815 Ga0207693_10394230
816 Ga0207663_10090453
817 Ga0207662_10080305
818 Ga0207649_10137512
819 Ga0207646_10001979
820 Ga0207646_10002145
821 Ga0207646_10027642
822 Ga0207646_10041019
823 Ga0207646_10050265
824 Ga0207646_10107610
825 Ga0207646_10110803
826 Ga0207646_10121273
827 Ga0207646_10149476
828 Ga0207646_10177735
829 Ga0207646_10184180
830 Ga0207646_10235484
831 Ga0207681_10024067
832 Ga0207681_10506057
833 Ga0207650_10105416
834 Ga0207659_10061951
835 Ga0207659_10125675
836 Ga0207659_10145509
837 Ga0207700_10094542
838 Ga0207700_10137832
839 Ga0207700_10166638
840 Ga0207644_10021116
841 Ga0207644_10112877
842 Ga0207644_10115976
843 Ga0207644_10133823
844 Ga0207644_10201534
845 Ga0207690_10033086
846 Ga0207706_10026724
847 Ga0207706_10075167
848 Ga0207706_10098803
849 Ga0207670_10012113
850 Ga0207670_10038569
851 Ga0207670_10080154
852 Ga0207669_10030578
853 Ga0207669_10072268
854 Ga0207704_10192023
855 Ga0207704_10234403
856 Ga0207665_10008481
857 Ga0207665_10028236
858 Ga0207665_10074216
859 Ga0207665_10151278
860 Ga0207691_10002283
861 Ga0207691_10007180
862 Ga0207691_10012683
863 Ga0207691_10059318
864 Ga0207661_10031734
865 Ga0207661_10046233
866 Ga0207679_10254232
867 Ga0207679_10318347
868 Ga0207651_10003656
869 Ga0207651_10006112
870 Ga0207651_10060214
871 Ga0207651_10095081
872 Ga0207651_10214791
873 Ga0207712_10027858
874 Ga0207668_10119343
875 Ga0207640_10158611
876 Ga0207658_10010884
877 Ga0207658_10098842
878 Ga0207658_10102454
879 Ga0207658_10193009
880 Ga0207677_10352843
881 Ga0207677_10376060
882 Ga0207703_10051997
883 Ga0207703_10112041
884 Ga0207639_10000017
885 Ga0207678_10018450
886 Ga0207708_10003672
887 Ga0207641_10024418
888 Ga0207641_10093197
889 Ga0207648_10229849
890 Ga0207676_10171951
891 Ga0207675_100430796
892 Ga0207683_10015360
893 Ga0207683_10017265
894 Ga0207683_10026147
895 Ga0207683_10039292
896 Ga0207683_10049808
897 Ga0207683_10111185
898 Ga0268266_10016163
899 Ga0268266_10016468
900 Ga0268266_10018759
901 Ga0268266_10064412
902 Ga0268266_10079067
903 Ga0268266_10210714
904 Ga0268265_10093360
905 Ga0268264_10001609
906 Ga0268264_10578817
907 Ga0265328_10006742
908 Ga0265316_10134739
909 Ga0265314_10000020
910 Ga0373943_0032552
911 Ga0373943_0067536
912 Ga0373943_0153251
913 Ga0373946_0088892
914 Ga0373955_0161269
915 Ga0373955_0273616
916 Ga0373931_0091597
917 Ga0373931_0093386
918 Ga0373931_0167891
919 Ga0373935_0188621
920 Ga0373927_0107215
921 Ga0373927_0263303
922 Ga0373927_0342463
923 Ga0373947_0114711
924 Ga0373937_0287381
925 Ga0373937_0373219
926 Ga0373925_0094942
927 Ga0373925_0105469
928 Ga0373925_0185087
929 Ga0395900_0110389
930 Ga0395898_0006727
931 Ga0395898_0097481
932 Ga0395905_0112347
933 Ga0395905_0236071
934 Ga0395905_0540875
935 Ga0436364_0001908
936 Ga0436364_0784346
937 Ga0436364_1317185
938 Ga0395901_0009988
939 Ga0395901_0179629
940 Ga0395901_0243737
941 Ga0436365_0274631
942 Ga0436365_0292643
943 Ga0436365_0511548
944 Ga0436365_0774305
945 Ga0436365_1153529
946 Ga0436360_0064177
947 Ga0436360_0181157
948 Ga0436360_0890065
949 Ga0436360_0999617
950 Ga0436361_0219401
951 Ga0436361_0444714
952 Ga0436361_0536230
953 Ga0436361_0654100
954 Ga0436361_0809872
955 Ga0436361_0874588
956 Ga0436361_0971942
957 Ga0436363_0064540
958 Ga0436363_0329569
959 Ga0436362_0603905
960 Ga0439455_0015001
961 Ga0451576_0507658
962 Ga0495629_0096243
963 Ga0495651_0272146
964 Ga0495580_0210503
965 Ga0495582_0231902
966 Ga0495664_0257143
967 Ga0495628_0227629
968 Ga0495630_0140410
969 Ga0495630_0182057
970 Ga0495644_0049052
971 Ga0495642_0032015
972 Ga0495652_0077079
973 Ga0495652_0214261
974 Ga0495640_0262508
975 Ga0495586_0113849
976 Ga0495587_0073323
977 Ga0495587_0211389
978 Ga0495645_0170602
979 Ga0495634_0034465
980 Ga0495659_0007145
981 Ga0495661_0089556
982 Ga0495623_0011180
983 Ga0495658_0013423
984 Ga0495658_0154816
985 Ga0495669_0004171
986 Ga0495669_0095637
987 Ga0495613_0068710
988 Ga0495674_0376771
989 Ga0495676_0033751
990 Ga0495680_0349844
991 Ga0495675_0073979
992 Ga0495602_0214849
993 Ga0496100_0105732
994 Ga0496100_0270407
995 Ga0496100_0428128
996 Ga0496100_0458561
997 Ga0496101_0017167
998 Ga0496102_0099378
999 Ga0496102_0208232
1000 Ga0496102_0428965
1001 Ga0496102_0626484
1002 Ga0496104_0234103
1003 Ga0496105_0077918
1004 Ga0496106_0088840
1005 Ga0496107_0067905
1006 Ga0496108_0133259
1007 Ga0496108_0358870
1008 Ga0496109_0070848
1009 Ga0496109_0286023
1010 Ga0496109_0308522
1011 Ga0496109_0335444
1012 Ga0496109_0357789
1013 Ga0496110_0063577
1014 Ga0496110_0232728
1015 Ga0496111_0092571
1016 Ga0496111_0199750
1017 Ga0496112_0019051
1018 Ga0496112_0044863
1019 Ga0496112_0049274
1020 Ga0496112_0158997
1021 Ga0496112_0307877
1022 Ga0496113_0284786
1023 Ga0496114_0035734
1024 Ga0496114_0233145
1025 Ga0496115_0003467
1026 Ga0501073_0240786
1027 nmdc:mga03683_429_c1
1028 nmdc:mga0k408_27225_c1
1029 nmdc:mga05p37_185653_c1
1030 nmdc:mga05p37_27974_c1
1031 nmdc:mga0n895_83349_c1
1032 nmdc:mga0rr50_150778_c1
1033 nmdc:mga08x19_10573_c1
1034 nmdc:mga08x19_221388_c1
1035 nmdc:mga0a205_259270_c1
1036 Ga0495612_0025091
1037 Ga0500555_000080
1038 Ga0500556_0000010
1039 Ga0500642_0039326
1040 Ga0500616_0001795

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13277

YmdB

YmdB-like protein

5

256

0.99

PF00149

Metallophos

Calcineurin-like phosphoesterase

2

181

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9535 2 259
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9364 2 259
2cv9-assembly1.cif.gz_A crystal structure of a hypothetical protein from thermus thermophilus hb8 0.9347 2 259
1t70-assembly3.cif.gz_E crystal structure of a novel phosphatase from deinococcus radiodurans 0.9258 2 259
4b2o-assembly1.cif.gz_D crystal structure of bacillus subtilis ymdb, a global regulator of late adaptive responses. 0.9255 2 259
ID Description Score Start End Superfamily
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9535 2 259 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9328 2 259 3.60.21.10
4b2oD00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9255 2 259 3.60.21.10
2z06B00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9222 2 259 3.60.21.10
1t71A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.9134 2 259 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V5KJ99-F1-model_v4 TIGR00282 family metallophosphoesterase 0.9651 1 249 GO:0004113
GO:0046872
AF-A0A2V6DJC4-F1-model_v4 TIGR00282 family metallophosphoesterase 0.9642 1 220 GO:0004113
GO:0046872
AF-A0A2V6URC7-F1-model_v4 TIGR00282 family metallophosphoesterase 0.964 2 259 GO:0004113
GO:0046872
AF-A0A2V6UC29-F1-model_v4 Metallophosphoesterase 0.9632 134 259 GO:0004113
AF-A0A4Y8PHY8-F1-model_v4 Metallophosphoesterase 0.9631 2 259 GO:0004113
GO:0046872

Map