F458310

General Info

Members Datasets Scaffolds Average Seq Length
518 272 1036 126

Family's Representative Sequence

Representative Sequence 3300046664|Ga0495659_0023677|Ga0495659_0023677_1583_2056
Length 157
Sequence VRFDDGHQTEGYRGPAGSEGRAAHCVMKEVTMPKHVPDLPGIEPGPYPFSPVVEANGFVFLAGQVGDAPGSHGAVPGGIEAETRAMLDNVGRLLKAAGLTYADVVKATVYLRDFGDFAAMNQVYREYFPTNPPTRTTVGVTALAADYRIEIEVMAAR

Samples

Sample ID Description Type Environment
1 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
164 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
178 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
179 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
180 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
181 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
182 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
183 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
184 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
185 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
186 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
187 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
216 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
217 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
235 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
236 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
237 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
238 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
239 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
240 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
241 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
242 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
245 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
246 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
249 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
270 2842733646 Variovorax sp. R-72446 Isolate Unclassified
271 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
272 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.23
Metatranscriptomes 0.19
Isolates 0.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.97
Nodule 0.39
Rhizoplane 4.63
Rhizosphere 93.05
Stem 0
Stem Tuber 0
Unclassified 14.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495659_0023677 3300046664 Bacteria 2088
2 rootH1_10083934 3300003323 Bacteria 1557
3 Ga0070683_100423294 3300005329 Bacteria 1270
4 Ga0070683_100843288 3300005329 Bacteria 879
5 Ga0070683_102211462 3300005329 Unclassified 528
6 Ga0068869_100326825 3300005334 Unclassified 1245
7 Ga0068869_100739833 3300005334 Bacteria 841
8 Ga0070680_100037068 3300005336 Bacteria 3940
9 Ga0070680_100320387 3300005336 Bacteria 1316
10 Ga0070680_100342977 3300005336 Bacteria 1269
11 Ga0068868_100254197 3300005338 Bacteria 1480
12 Ga0070660_100600098 3300005339 Unclassified 920
13 Ga0070660_101128929 3300005339 Bacteria 664
14 Ga0070689_100010649 3300005340 Bacteria 6558
15 Ga0070691_10189562 3300005341 Bacteria 1075
16 Ga0070691_10902750 3300005341 Bacteria 545
17 Ga0070661_100873341 3300005344 Bacteria 741
18 Ga0070661_101703099 3300005344 Bacteria 534
19 Ga0070692_10041478 3300005345 Bacteria 2358
20 Ga0070692_11069051 3300005345 Bacteria 568
21 Ga0070668_100583638 3300005347 Unclassified 976
22 Ga0070669_101680148 3300005353 Unclassified 553
23 Ga0070675_100007156 3300005354 Bacteria 8597
24 Ga0070675_101128533 3300005354 Unclassified 721
25 Ga0070674_100011355 3300005356 Bacteria 5422
26 Ga0070674_100018383 3300005356 Bacteria 4419
27 Ga0070673_100025306 3300005364 Bacteria 4367
28 Ga0070673_101034012 3300005364 Bacteria 766
29 Ga0070688_100000947 3300005365 Bacteria 14540
30 Ga0070688_100994059 3300005365 Unclassified 666
31 Ga0070659_100004179 3300005366 Bacteria 10298
32 Ga0070667_100232806 3300005367 Unclassified 1643
33 Ga0070709_10067151 3300005434 Bacteria 2302
34 Ga0070714_100105917 3300005435 Bacteria 2483
35 Ga0070701_10010351 3300005438 Bacteria 4120
36 Ga0070711_100109862 3300005439 Bacteria 2022
37 Ga0070705_100093680 3300005440 Bacteria 1879
38 Ga0070705_100947625 3300005440 Bacteria 695
39 Ga0070700_100078549 3300005441 Bacteria 2125
40 Ga0070700_100234859 3300005441 Bacteria 1307
41 Ga0070694_100058157 3300005444 Bacteria 2630
42 Ga0070694_100250490 3300005444 Unclassified 1339
43 Ga0070694_101283257 3300005444 Bacteria 615
44 Ga0070708_100012980 3300005445 Bacteria 6806
45 Ga0070663_100002509 3300005455 Bacteria 10354
46 Ga0070663_101703118 3300005455 Bacteria 564
47 Ga0070678_100002081 3300005456 Bacteria 10853
48 Ga0070678_100516465 3300005456 Bacteria 1056
49 Ga0070662_100067631 3300005457 Bacteria 2624
50 Ga0070662_100131202 3300005457 Bacteria 1932
51 Ga0070662_101712777 3300005457 Bacteria 543
52 Ga0070681_10011715 3300005458 Bacteria 8688
53 Ga0070681_10297261 3300005458 Unclassified 1524
54 Ga0070681_10376151 3300005458 Bacteria 1331
55 Ga0068867_100018726 3300005459 Bacteria 4923
56 Ga0068867_100915086 3300005459 Bacteria 790
57 Ga0068867_100969616 3300005459 Bacteria 769
58 Ga0070685_10018475 3300005466 Bacteria 3749
59 Ga0070706_100065720 3300005467 Bacteria 3355
60 Ga0070706_100732377 3300005467 Bacteria 916
61 Ga0070707_101874651 3300005468 Bacteria 567
62 Ga0070698_100007577 3300005471 Bacteria 11742
63 Ga0070698_100059867 3300005471 Bacteria 3845
64 Ga0070698_100433611 3300005471 Bacteria 1249
65 Ga0070699_100185689 3300005518 Bacteria 1846
66 Ga0070699_100335410 3300005518 Bacteria 1360
67 Ga0070699_100364660 3300005518 Bacteria 1303
68 Ga0070699_100415129 3300005518 Bacteria 1218
69 Ga0070699_100656506 3300005518 Bacteria 958
70 Ga0070679_100039946 3300005530 Bacteria 4665
71 Ga0070679_100155544 3300005530 Bacteria 2261
72 Ga0070679_100670997 3300005530 Bacteria 979
73 Ga0070679_101244055 3300005530 Unclassified 690
74 Ga0070679_101311239 3300005530 Bacteria 670
75 Ga0070684_100052583 3300005535 Bacteria 3543
76 Ga0070684_101437087 3300005535 Bacteria 650
77 Ga0070684_102059280 3300005535 Bacteria 539
78 Ga0070697_100041243 3300005536 Bacteria 3735
79 Ga0070697_100206151 3300005536 Bacteria 1672
80 Ga0068853_100215142 3300005539 Bacteria 1753
81 Ga0070672_100540391 3300005543 Unclassified 1011
82 Ga0070672_100601064 3300005543 Bacteria 958
83 Ga0070686_100006194 3300005544 Bacteria 6641
84 Ga0070686_100171680 3300005544 Bacteria 1534
85 Ga0070695_100059323 3300005545 Bacteria 2477
86 Ga0070695_100106435 3300005545 Unclassified 1896
87 Ga0070695_101586859 3300005545 Bacteria 546
88 Ga0070696_100003234 3300005546 Bacteria 10849
89 Ga0070696_100052320 3300005546 Bacteria 2841
90 Ga0070693_100134019 3300005547 Unclassified 1552
91 Ga0070693_100265223 3300005547 Bacteria 1144
92 Ga0070665_101310103 3300005548 Bacteria 734
93 Ga0070665_101991857 3300005548 Bacteria 586
94 Ga0070704_100049998 3300005549 Bacteria 2936
95 Ga0070704_100127372 3300005549 Bacteria 1967
96 Ga0070704_101705857 3300005549 Bacteria 582
97 Ga0068855_101532992 3300005563 Bacteria 683
98 Ga0068855_102497275 3300005563 Unclassified 514
99 Ga0070664_100050046 3300005564 Bacteria 3535
100 Ga0068857_100912251 3300005577 Bacteria 843
101 Ga0068854_100071089 3300005578 Bacteria 2545
102 Ga0070702_100013860 3300005615 Bacteria 4080
103 Ga0068859_100020677 3300005617 Bacteria 6605
104 Ga0068859_100653953 3300005617 Bacteria 1143
105 Ga0068859_100800947 3300005617 Bacteria 1030
106 Ga0068864_100604976 3300005618 Unclassified 1064
107 Ga0068864_100923993 3300005618 Bacteria 862
108 Ga0068866_10352148 3300005718 Bacteria 936
109 Ga0068861_100194173 3300005719 Bacteria 1699
110 Ga0068861_100642768 3300005719 Bacteria 979
111 Ga0068870_10001676 3300005840 Bacteria 9051
112 Ga0068870_10239889 3300005840 Bacteria 1119
113 Ga0068863_100466371 3300005841 Bacteria 1241
114 Ga0068858_100515921 3300005842 Bacteria 1155
115 Ga0068860_100070586 3300005843 Bacteria 3321
116 Ga0068860_100950039 3300005843 Bacteria 877
117 Ga0068862_100310020 3300005844 Unclassified 1454
118 Ga0068862_100863159 3300005844 Bacteria 888
119 Ga0081455_10127570 3300005937 Bacteria 1994
120 Ga0081539_10010700 3300005985 Bacteria 7397
121 Ga0081539_10022656 3300005985 Bacteria 4145
122 Ga0075365_10011487 3300006038 Bacteria 5210
123 Ga0070716_101489588 3300006173 Unclassified 553
124 Ga0097621_100752987 3300006237 Unclassified 900
125 Ga0075428_100268862 3300006844 Bacteria 1834
126 Ga0075428_101702670 3300006844 Bacteria 658
127 Ga0075430_100156294 3300006846 Bacteria 1898
128 Ga0075431_100036449 3300006847 Bacteria 5066
129 Ga0075434_100047169 3300006871 Bacteria 4276
130 Ga0075434_100123069 3300006871 Bacteria 2610
131 Ga0075434_100249935 3300006871 Bacteria 1792
132 Ga0075434_100463431 3300006871 Bacteria 1288
133 Ga0068865_100238801 3300006881 Bacteria 1429
134 Ga0068865_100482789 3300006881 Bacteria 1030
135 Ga0075436_100042558 3300006914 Bacteria 3133
136 Ga0097620_100020679 3300006931 Bacteria 6605
137 Ga0097620_100653947 3300006931 Bacteria 1143
138 Ga0097620_100800860 3300006931 Bacteria 1030
139 Ga0075435_100756760 3300007076 Bacteria 845
140 Ga0075435_100882455 3300007076 Unclassified 780
141 Ga0105244_10087931 3300009036 Bacteria 1531
142 Ga0105240_12666410 3300009093 Unclassified 516
143 Ga0111539_10049400 3300009094 Bacteria 5017
144 Ga0111539_10078062 3300009094 Bacteria 3896
145 Ga0111539_10932482 3300009094 Bacteria 1010
146 Ga0111539_12738639 3300009094 Bacteria 571
147 Ga0105245_10010634 3300009098 Bacteria 8006
148 Ga0105245_10090377 3300009098 Bacteria 2816
149 Ga0105245_10704883 3300009098 Bacteria 1043
150 Ga0114129_10129085 3300009147 Bacteria 3474
151 Ga0114129_10288535 3300009147 Bacteria 2190
152 Ga0114129_10442200 3300009147 Bacteria 1707
153 Ga0114129_10795914 3300009147 Bacteria 1206
154 Ga0114129_10807166 3300009147 Bacteria 1196
155 Ga0114129_11047083 3300009147 Bacteria 1025
156 Ga0105243_10017516 3300009148 Bacteria 5416
157 Ga0105243_10605410 3300009148 Archaea 1055
158 Ga0105243_11815825 3300009148 Bacteria 641
159 Ga0105243_12107073 3300009148 Bacteria 600
160 Ga0105241_10190084 3300009174 Bacteria 1709
161 Ga0105241_11419678 3300009174 Bacteria 665
162 Ga0105242_10029489 3300009176 Bacteria 4377
163 Ga0105242_10784473 3300009176 Unclassified 941
164 Ga0105248_10202563 3300009177 Bacteria 2236
165 Ga0105238_12238103 3300009551 Bacteria 581
166 Ga0105249_10054516 3300009553 Bacteria 3657
167 Ga0105239_12478029 3300010375 Bacteria 604
168 Ga0105246_10369228 3300011119 Unclassified 1182
169 Ga0105246_11071470 3300011119 Bacteria 734
170 Ga0157326_1000052 3300012513 Bacteria 10757
171 Ga0157371_10939507 3300013102 Bacteria 657
172 Ga0157369_12084829 3300013105 Bacteria 575
173 Ga0157374_12878165 3300013296 Unclassified 509
174 Ga0157378_10012452 3300013297 Bacteria 7447
175 Ga0157378_11260401 3300013297 Unclassified 780
176 Ga0157378_12269243 3300013297 Unclassified 594
177 Ga0163162_10034816 3300013306 Bacteria 5013
178 Ga0163162_11996697 3300013306 Archaea 665
179 Ga0163162_12180663 3300013306 Bacteria 636
180 Ga0163162_12725596 3300013306 Bacteria 569
181 Ga0157375_10191750 3300013308 Bacteria 2198
182 Ga0157375_11466174 3300013308 Unclassified 805
183 Ga0163163_10549651 3300014325 Bacteria 1217
184 Ga0157380_10023792 3300014326 Bacteria 4626
185 Ga0157380_10065072 3300014326 Bacteria 2929
186 Ga0157380_11560056 3300014326 Bacteria 715
187 Ga0182008_10464838 3300014497 Bacteria 690
188 Ga0157377_10017227 3300014745 Bacteria 3733
189 Ga0157377_10123174 3300014745 Bacteria 1574
190 Ga0157377_10467585 3300014745 Unclassified 874
191 Ga0157379_10143058 3300014968 Bacteria 2156
192 Ga0157379_10848406 3300014968 Bacteria 864
193 Ga0182006_1181528 3300015261 Bacteria 702
194 Ga0163161_10102116 3300017792 Bacteria 2135
195 Ga0206353_12042751 3300020082 Bacteria 713
196 Ga0213871_10027869 3300021441 Bacteria 1454
197 Ga0207642_10526382 3300025899 Bacteria 727
198 Ga0207688_10003643 3300025901 Bacteria 8412
199 Ga0207688_10043307 3300025901 Bacteria 2506
200 Ga0207688_10621982 3300025901 Bacteria 681
201 Ga0207688_11031846 3300025901 Unclassified 519
202 Ga0207699_10185946 3300025906 Bacteria 1399
203 Ga0207643_10002829 3300025908 Bacteria 9366
204 Ga0207643_10130037 3300025908 Bacteria 1498
205 Ga0207684_10307492 3300025910 Bacteria 1366
206 Ga0207654_10558734 3300025911 Bacteria 813
207 Ga0207707_10003517 3300025912 Bacteria 13869
208 Ga0207707_10362267 3300025912 Unclassified 1248
209 Ga0207707_10475982 3300025912 Bacteria 1067
210 Ga0207707_11171614 3300025912 Bacteria 623
211 Ga0207663_10337883 3300025916 Unclassified 1137
212 Ga0207660_10256373 3300025917 Bacteria 1382
213 Ga0207660_10668803 3300025917 Bacteria 847
214 Ga0207662_10002116 3300025918 Bacteria 9867
215 Ga0207662_10106719 3300025918 Bacteria 1742
216 Ga0207657_10066325 3300025919 Bacteria 3073
217 Ga0207657_10074031 3300025919 Bacteria 2877
218 Ga0207649_10116957 3300025920 Bacteria 1791
219 Ga0207652_10051664 3300025921 Bacteria 3525
220 Ga0207652_10801893 3300025921 Bacteria 836
221 Ga0207646_10512048 3300025922 Bacteria 1081
222 Ga0207646_11518408 3300025922 Unclassified 580
223 Ga0207681_10231351 3300025923 Bacteria 1435
224 Ga0207681_10498303 3300025923 Bacteria 997
225 Ga0207694_11453519 3300025924 Unclassified 579
226 Ga0207687_10105528 3300025927 Bacteria 2082
227 Ga0207687_10161664 3300025927 Bacteria 1719
228 Ga0207690_10059157 3300025932 Bacteria 2595
229 Ga0207706_10027497 3300025933 Bacteria 5085
230 Ga0207706_10863553 3300025933 Bacteria 766
231 Ga0207709_10025761 3300025935 Bacteria 3370
232 Ga0207709_10378061 3300025935 Bacteria 1077
233 Ga0207709_11245958 3300025935 Bacteria 614
234 Ga0207670_10919849 3300025936 Bacteria 733
235 Ga0207669_10109344 3300025937 Bacteria 1848
236 Ga0207669_10173562 3300025937 Unclassified 1537
237 Ga0207704_10205266 3300025938 Bacteria 1446
238 Ga0207704_10650402 3300025938 Bacteria 868
239 Ga0207665_10296708 3300025939 Bacteria 1207
240 Ga0207691_10153925 3300025940 Bacteria 2020
241 Ga0207691_10656101 3300025940 Unclassified 886
242 Ga0207711_10102480 3300025941 Bacteria 2533
243 Ga0207711_10274597 3300025941 Unclassified 1551
244 Ga0207711_10962243 3300025941 Unclassified 793
245 Ga0207689_10026852 3300025942 Bacteria 4820
246 Ga0207689_10271779 3300025942 Bacteria 1403
247 Ga0207689_11055648 3300025942 Unclassified 685
248 Ga0207661_12038843 3300025944 Bacteria 520
249 Ga0207661_12048818 3300025944 Unclassified 518
250 Ga0207679_10150691 3300025945 Bacteria 1892
251 Ga0207651_10269035 3300025960 Bacteria 1403
252 Ga0207712_10021987 3300025961 Bacteria 4194
253 Ga0207712_10034729 3300025961 Bacteria 3419
254 Ga0207712_10568774 3300025961 Bacteria 977
255 Ga0207712_11601880 3300025961 Unclassified 584
256 Ga0207668_10757031 3300025972 Bacteria 857
257 Ga0207658_10828579 3300025986 Unclassified 841
258 Ga0207677_10591781 3300026023 Bacteria 972
259 Ga0207703_10184448 3300026035 Unclassified 1843
260 Ga0207703_10271461 3300026035 Bacteria 1536
261 Ga0207703_10375206 3300026035 Bacteria 1314
262 Ga0207639_10183470 3300026041 Bacteria 1782
263 Ga0207678_10007640 3300026067 Bacteria 9551
264 Ga0207708_10000838 3300026075 Bacteria 23148
265 Ga0207708_10153365 3300026075 Bacteria 1816
266 Ga0207708_10170139 3300026075 Unclassified 1725
267 Ga0207641_11279885 3300026088 Unclassified 734
268 Ga0207648_10000916 3300026089 Bacteria 33221
269 Ga0207676_11258736 3300026095 Unclassified 734
270 Ga0207674_10006012 3300026116 Bacteria 14354
271 Ga0207674_11936312 3300026116 Unclassified 555
272 Ga0207675_100292402 3300026118 Bacteria 1585
273 Ga0207675_100400399 3300026118 Unclassified 1353
274 Ga0207683_10003470 3300026121 Bacteria 13757
275 Ga0207683_10527167 3300026121 Bacteria 1092
276 Ga0207683_10883674 3300026121 Bacteria 830
277 Ga0207698_10768906 3300026142 Bacteria 963
278 Ga0209999_1051354 3300027543 Bacteria 779
279 Ga0209998_10012850 3300027717 Bacteria 1740
280 Ga0209998_10046322 3300027717 Bacteria 998
281 Ga0209974_10028204 3300027876 Bacteria 1859
282 Ga0209974_10147587 3300027876 Bacteria 847
283 Ga0207428_10092283 3300027907 Bacteria 2350
284 Ga0207428_10225427 3300027907 Bacteria 1404
285 Ga0207428_10717339 3300027907 Bacteria 714
286 Ga0268266_11411067 3300028379 Bacteria 672
287 Ga0268265_10764074 3300028380 Bacteria 939
288 Ga0268265_12018421 3300028380 Bacteria 584
289 Ga0268264_10077892 3300028381 Bacteria 2825
290 Ga0307405_10272719 3300031731 Bacteria 1269
291 Ga0307412_10419148 3300031911 Bacteria 1095
292 Ga0307409_100057767 3300031995 Bacteria 3009
293 Ga0307409_100077729 3300031995 Bacteria 2667
294 Ga0307416_100001109 3300032002 Bacteria 14457
295 Ga0307411_10556917 3300032005 Bacteria 979
296 Ga0307415_100005086 3300032126 Bacteria 6927
297 Ga0373930_0012005 3300034816 Bacteria 1573
298 Ga0373930_0167883 3300034816 Bacteria 558
299 Ga0373938_0062986 3300034957 Bacteria 871
300 Ga0373928_0126574 3300035084 Bacteria 689
301 Ga0373951_0012329 3300035091 Bacteria 1922
302 Ga0373951_0073345 3300035091 Bacteria 875
303 Ga0373960_0043289 3300035121 Bacteria 1311
304 Ga0373942_0136162 3300035207 Bacteria 778
305 Ga0373931_0014212 3300035691 Bacteria 3888
306 Ga0373931_0364640 3300035691 Bacteria 907
307 Ga0373933_0951582 3300035724 Bacteria 566
308 Ga0395900_0587480 3300037418 Bacteria 1055
309 Ga0395898_0114191 3300037466 Bacteria 2588
310 Ga0395905_0691440 3300037471 Bacteria 922
311 Ga0436364_0863046 3300037853 Bacteria 662
312 Ga0395901_1114105 3300038443 Bacteria 759
313 Ga0436365_1681945 3300039437 Unclassified 791
314 Ga0436360_0420685 3300039438 Bacteria 6448
315 Ga0439438_053640 3300041405 Bacteria 1020
316 Ga0439461_0005430 3300041410 Bacteria 2171
317 Ga0439466_0017328 3300041411 Bacteria 2596
318 Ga0439465_0159641 3300041413 Unclassified 808
319 Ga0450920_068223 3300042122 Bacteria 722
320 Ga0450903_065438 3300042138 Bacteria 526
321 Ga0450910_040539 3300042147 Bacteria 751
322 Ga0439459_0078840 3300042438 Bacteria 774
323 Ga0466965_0033326 3300044683 Bacteria 2517
324 Ga0466960_0192820 3300044901 Bacteria 1110
325 Ga0451576_0803143 3300045051 Bacteria 988
326 Ga0495641_0162862 3300046461 Unclassified 998
327 Ga0495651_0055334 3300046462 Bacteria 3049
328 Ga0495651_0282072 3300046462 Bacteria 1122
329 Ga0495653_0153099 3300046463 Bacteria 1609
330 Ga0495664_0209457 3300046477 Bacteria 1181
331 Ga0495618_0428291 3300046514 Bacteria 806
332 Ga0495630_0813708 3300046517 Bacteria 713
333 Ga0495642_0359208 3300046528 Unclassified 641
334 Ga0495640_0776979 3300046533 Bacteria 572
335 Ga0495667_0720430 3300046559 Bacteria 618
336 Ga0495656_0104089 3300046615 Bacteria 1317
337 Ga0495657_0432729 3300046675 Bacteria 772
338 Ga0495623_0307215 3300046679 Unclassified 875
339 Ga0495658_0801300 3300046683 Bacteria 603
340 Ga0495671_0276162 3300046692 Unclassified 810
341 Ga0495680_0122455 3300047322 Bacteria 1919
342 Ga0495683_0405439 3300047323 Unclassified 566
343 Ga0495675_0268678 3300047444 Unclassified 1020
344 Ga0496101_0126881 3300048904 Bacteria 1934
345 Ga0496102_0027538 3300048905 Bacteria 5076
346 Ga0496102_0352849 3300048905 Bacteria 1385
347 Ga0496102_0501612 3300048905 Bacteria 1136
348 Ga0496102_1562426 3300048905 Bacteria 578
349 Ga0496103_0334878 3300048906 Bacteria 973
350 Ga0496104_0852312 3300048907 Bacteria 817
351 Ga0496106_0028863 3300048909 Bacteria 4134
352 Ga0496108_0103643 3300048911 Bacteria 2427
353 Ga0496109_0011260 3300048912 Bacteria 7682
354 Ga0496109_0413499 3300048912 Unclassified 1274
355 Ga0496109_0828082 3300048912 Bacteria 863
356 Ga0496110_0012161 3300048913 Bacteria 7071
357 Ga0496110_0041573 3300048913 Bacteria 4012
358 Ga0496111_0061339 3300048914 Bacteria 2726
359 Ga0496112_0311845 3300048915 Unclassified 1518
360 Ga0496112_0382338 3300048915 Bacteria 1349
361 Ga0496112_0678955 3300048915 Bacteria 959
362 Ga0496112_1037124 3300048915 Unclassified 739
363 Ga0496113_0018231 3300048916 Unclassified 4888
364 Ga0496113_0106662 3300048916 Bacteria 2176
365 Ga0496114_0076991 3300048917 Bacteria 2812
366 Ga0496114_0290998 3300048917 Bacteria 1441
367 Ga0496114_0742284 3300048917 Bacteria 859
368 Ga0496126_0443962 3300048929 Unclassified 1045
369 Ga0501031_0029250 3300049568 Bacteria 3594
370 Ga0501031_1045913 3300049568 Unclassified 521
371 Ga0501032_0106606 3300049569 Bacteria 1856
372 Ga0501032_0331905 3300049569 Bacteria 981
373 Ga0501032_0408242 3300049569 Bacteria 872
374 Ga0501032_0695144 3300049569 Bacteria 645
375 Ga0501033_0189586 3300049570 Bacteria 1472
376 Ga0501033_0850183 3300049570 Unclassified 615
377 Ga0501034_0062040 3300049571 Bacteria 3753
378 Ga0501036_0057636 3300049572 Bacteria 3291
379 Ga0501036_0129935 3300049572 Bacteria 2127
380 Ga0501036_0142773 3300049572 Bacteria 2020
381 Ga0501036_0926806 3300049572 Bacteria 714
382 Ga0501036_1120538 3300049572 Bacteria 643
383 Ga0501037_0243223 3300049573 Bacteria 1261
384 Ga0501038_0082941 3300049574 Unclassified 2699
385 Ga0501038_0239669 3300049574 Bacteria 1440
386 Ga0501039_0031401 3300049575 Bacteria 4095
387 Ga0501039_0059165 3300049575 Bacteria 2968
388 Ga0501039_0875615 3300049575 Bacteria 699
389 Ga0501040_0018052 3300049576 Bacteria 4685
390 Ga0501040_0022864 3300049576 Bacteria 4188
391 Ga0501040_0258900 3300049576 Bacteria 1242
392 Ga0501041_0028557 3300049577 Bacteria 3365
393 Ga0501041_0069113 3300049577 Unclassified 2166
394 Ga0501041_0197049 3300049577 Bacteria 1262
395 Ga0501042_0114861 3300049578 Bacteria 1938
396 Ga0501042_0176961 3300049578 Bacteria 1539
397 Ga0501043_0391277 3300049579 Bacteria 1051
398 Ga0501046_0935204 3300049580 Bacteria 604
399 Ga0501047_1361815 3300049581 Bacteria 524
400 Ga0501048_0053730 3300049582 Bacteria 2863
401 Ga0501048_0136211 3300049582 Bacteria 1735
402 Ga0501048_0402911 3300049582 Bacteria 978
403 Ga0501067_0011400 3300049583 Bacteria 4921
404 Ga0501067_0062896 3300049583 Bacteria 2055
405 Ga0501067_0491824 3300049583 Bacteria 686
406 Ga0501068_0147218 3300049584 Bacteria 1478
407 Ga0501068_0352547 3300049584 Bacteria 946
408 Ga0501068_0403004 3300049584 Bacteria 882
409 Ga0501068_0914719 3300049584 Bacteria 577
410 Ga0501069_0026928 3300049585 Bacteria 3149
411 Ga0501069_0039434 3300049585 Bacteria 2610
412 Ga0501069_0085096 3300049585 Bacteria 1784
413 Ga0501069_0285821 3300049585 Bacteria 966
414 Ga0501069_0350208 3300049585 Bacteria 870
415 Ga0501070_0096214 3300049586 Bacteria 2450
416 Ga0501070_0234679 3300049586 Bacteria 1502
417 Ga0501070_0709978 3300049586 Bacteria 795
418 Ga0501071_0006977 3300049587 Bacteria 7375
419 Ga0501071_0073632 3300049587 Bacteria 2492
420 Ga0501071_0135551 3300049587 Bacteria 1832
421 Ga0501071_0157696 3300049587 Bacteria 1695
422 Ga0501072_0116328 3300049588 Bacteria 2129
423 Ga0501072_0149276 3300049588 Unclassified 1864
424 Ga0501072_0196764 3300049588 Bacteria 1607
425 Ga0501072_0287932 3300049588 Bacteria 1306
426 Ga0501073_0096374 3300049589 Bacteria 2054
427 Ga0501074_0025384 3300049590 Bacteria 4304
428 Ga0501074_0055001 3300049590 Bacteria 2869
429 Ga0501074_0126936 3300049590 Unclassified 1825
430 Ga0501075_0040067 3300049591 Bacteria 3507
431 Ga0501075_0138987 3300049591 Bacteria 1850
432 Ga0501075_0167938 3300049591 Bacteria 1674
433 Ga0501075_0194648 3300049591 Bacteria 1546
434 Ga0501075_0487411 3300049591 Bacteria 940
435 Ga0501075_0717995 3300049591 Bacteria 761
436 Ga0501076_0002696 3300049592 Bacteria 12272
437 Ga0501076_0013446 3300049592 Bacteria 6140
438 Ga0501076_0014331 3300049592 Bacteria 5970
439 Ga0501076_0029540 3300049592 Bacteria 4263
440 Ga0501076_0059233 3300049592 Bacteria 3046
441 Ga0501076_0068588 3300049592 Bacteria 2832
442 Ga0501076_0104287 3300049592 Bacteria 2288
443 Ga0501076_0473294 3300049592 Bacteria 1032
444 Ga0501077_0026779 3300049593 Bacteria 3660
445 Ga0501077_0060583 3300049593 Bacteria 2402
446 Ga0501077_0102371 3300049593 Bacteria 1815
447 Ga0501079_0009319 3300049741 Bacteria 7440
448 Ga0501079_0070691 3300049741 Bacteria 2695
449 Ga0501079_0828598 3300049741 Bacteria 728
450 Ga0501080_0119755 3300049742 Bacteria 2440
451 Ga0501081_0015499 3300049743 Bacteria 5031
452 Ga0501081_0163836 3300049743 Bacteria 1603
453 Ga0501081_0231939 3300049743 Bacteria 1344
454 Ga0501081_0281229 3300049743 Bacteria 1218
455 Ga0501081_0918445 3300049743 Unclassified 660
456 Ga0501081_1265700 3300049743 Bacteria 559
457 Ga0501083_0004226 3300049744 Bacteria 10113
458 Ga0501083_0057368 3300049744 Bacteria 2607
459 Ga0501083_0068900 3300049744 Bacteria 2354
460 Ga0501083_0263192 3300049744 Bacteria 1122
461 Ga0501035_0055399 3300049822 Bacteria 3540
462 Ga0501035_0286861 3300049822 Bacteria 1390
463 Ga0501035_0782166 3300049822 Bacteria 764
464 Ga0501044_0019077 3300049823 Bacteria 7342
465 Ga0501044_0172039 3300049823 Bacteria 2137
466 Ga0501045_0028216 3300049824 Bacteria 4048
467 Ga0501045_0070773 3300049824 Bacteria 2566
468 Ga0501045_0079049 3300049824 Bacteria 2425
469 Ga0501045_0086772 3300049824 Unclassified 2310
470 Ga0501045_0761996 3300049824 Unclassified 713
471 nmdc:mga0k408_900782_c1 3300050493 Bacteria 513
472 nmdc:mga05p37_20877_c1 3300050507 Bacteria 7927
473 nmdc:mga05p37_299426_c1 3300050507 Bacteria 1911
474 nmdc:mga05p37_409912_c1 3300050507 Bacteria 1580
475 nmdc:mga05p37_422770_c1 3300050507 Bacteria 1550
476 nmdc:mga06r32_129474_c1 3300050510 Bacteria 2494
477 nmdc:mga06r32_139371_c1 3300050510 Bacteria 2401
478 nmdc:mga06r32_510440_c1 3300050510 Unclassified 1178
479 nmdc:mga06r32_891534_c1 3300050510 Bacteria 846
480 nmdc:mga08y16_206194_c1 3300050511 Bacteria 2037
481 nmdc:mga08y16_218062_c1 3300050511 Bacteria 1975
482 nmdc:mga08y16_21988_c1 3300050511 Bacteria 6733
483 nmdc:mga08y16_254540_c1 3300050511 Bacteria 1814
484 nmdc:mga0n895_1857384_c1 3300050512 Bacteria 562
485 nmdc:mga0n895_361743_c1 3300050512 Bacteria 1469
486 nmdc:mga0n895_535515_c1 3300050512 Bacteria 1178
487 nmdc:mga0n895_617533_c1 3300050512 Bacteria 1085
488 nmdc:mga0rr50_663702_c1 3300050513 Bacteria 890
489 nmdc:mga08x19_45999_c1 3300050514 Bacteria 2790
490 nmdc:mga0a205_156856_c2 3300050515 Bacteria 582
491 Ga0495601_0010607 3300053077 Bacteria 5490
492 Ga0495601_0632942 3300053077 Bacteria 685
493 Ga0495612_0130765 3300053078 Bacteria 1084
494 Ga0495595_0033641 3300053084 Unclassified 2314
495 Ga0495619_0130088 3300053085 Bacteria 1729
496 Ga0500643_181329 3300053087 Unclassified 565
497 Ga0500616_0004491 3300053153 Bacteria 9918
498 Ga0500616_0143586 3300053153 Bacteria 1112
499 Ga0501084_0027017 3300054114 Bacteria 4795
500 Ga0501084_0137553 3300054114 Bacteria 2056
501 Ga0501084_0238654 3300054114 Bacteria 1534
502 Ga0501084_0321035 3300054114 Unclassified 1308
503 Ga0590071_026539 3300059421 Bacteria 1374
504 Ga0501082_0036287 3300060353 Bacteria 4247
505 Ga0501082_0037265 3300060353 Bacteria 4191
506 Ga0501082_0099415 3300060353 Bacteria 2515
507 Ga0501082_0157518 3300060353 Bacteria 1973
508 Ga0501082_0619056 3300060353 Unclassified 947
509 Ga0530510_0001027 3300061734 Bacteria 18472
510 Ga0530510_0027496 3300061734 Bacteria 4075
511 Ga0530510_0071659 3300061734 Bacteria 2515
512 Ga0530510_0098919 3300061734 Bacteria 2133
513 Ga0530510_0143079 3300061734 Unclassified 1763
514 Ga0530510_0158446 3300061734 Bacteria 1674
515 Ga0530510_0163942 3300061734 Bacteria 1644
516 2842734541 2842733646 Bacteria 5716726
517 2878745937 2878738818 Bacteria 7136951
518 2924784079 2924776078 Bacteria 7492003
519 Ga0495659_0023677
520 rootH1_10083934
521 Ga0070683_100423294
522 Ga0070683_100843288
523 Ga0070683_102211462
524 Ga0068869_100326825
525 Ga0068869_100739833
526 Ga0070680_100037068
527 Ga0070680_100320387
528 Ga0070680_100342977
529 Ga0068868_100254197
530 Ga0070660_100600098
531 Ga0070660_101128929
532 Ga0070689_100010649
533 Ga0070691_10189562
534 Ga0070691_10902750
535 Ga0070661_100873341
536 Ga0070661_101703099
537 Ga0070692_10041478
538 Ga0070692_11069051
539 Ga0070668_100583638
540 Ga0070669_101680148
541 Ga0070675_100007156
542 Ga0070675_101128533
543 Ga0070674_100011355
544 Ga0070674_100018383
545 Ga0070673_100025306
546 Ga0070673_101034012
547 Ga0070688_100000947
548 Ga0070688_100994059
549 Ga0070659_100004179
550 Ga0070667_100232806
551 Ga0070709_10067151
552 Ga0070714_100105917
553 Ga0070701_10010351
554 Ga0070711_100109862
555 Ga0070705_100093680
556 Ga0070705_100947625
557 Ga0070700_100078549
558 Ga0070700_100234859
559 Ga0070694_100058157
560 Ga0070694_100250490
561 Ga0070694_101283257
562 Ga0070708_100012980
563 Ga0070663_100002509
564 Ga0070663_101703118
565 Ga0070678_100002081
566 Ga0070678_100516465
567 Ga0070662_100067631
568 Ga0070662_100131202
569 Ga0070662_101712777
570 Ga0070681_10011715
571 Ga0070681_10297261
572 Ga0070681_10376151
573 Ga0068867_100018726
574 Ga0068867_100915086
575 Ga0068867_100969616
576 Ga0070685_10018475
577 Ga0070706_100065720
578 Ga0070706_100732377
579 Ga0070707_101874651
580 Ga0070698_100007577
581 Ga0070698_100059867
582 Ga0070698_100433611
583 Ga0070699_100185689
584 Ga0070699_100335410
585 Ga0070699_100364660
586 Ga0070699_100415129
587 Ga0070699_100656506
588 Ga0070679_100039946
589 Ga0070679_100155544
590 Ga0070679_100670997
591 Ga0070679_101244055
592 Ga0070679_101311239
593 Ga0070684_100052583
594 Ga0070684_101437087
595 Ga0070684_102059280
596 Ga0070697_100041243
597 Ga0070697_100206151
598 Ga0068853_100215142
599 Ga0070672_100540391
600 Ga0070672_100601064
601 Ga0070686_100006194
602 Ga0070686_100171680
603 Ga0070695_100059323
604 Ga0070695_100106435
605 Ga0070695_101586859
606 Ga0070696_100003234
607 Ga0070696_100052320
608 Ga0070693_100134019
609 Ga0070693_100265223
610 Ga0070665_101310103
611 Ga0070665_101991857
612 Ga0070704_100049998
613 Ga0070704_100127372
614 Ga0070704_101705857
615 Ga0068855_101532992
616 Ga0068855_102497275
617 Ga0070664_100050046
618 Ga0068857_100912251
619 Ga0068854_100071089
620 Ga0070702_100013860
621 Ga0068859_100020677
622 Ga0068859_100653953
623 Ga0068859_100800947
624 Ga0068864_100604976
625 Ga0068864_100923993
626 Ga0068866_10352148
627 Ga0068861_100194173
628 Ga0068861_100642768
629 Ga0068870_10001676
630 Ga0068870_10239889
631 Ga0068863_100466371
632 Ga0068858_100515921
633 Ga0068860_100070586
634 Ga0068860_100950039
635 Ga0068862_100310020
636 Ga0068862_100863159
637 Ga0081455_10127570
638 Ga0081539_10010700
639 Ga0081539_10022656
640 Ga0075365_10011487
641 Ga0070716_101489588
642 Ga0097621_100752987
643 Ga0075428_100268862
644 Ga0075428_101702670
645 Ga0075430_100156294
646 Ga0075431_100036449
647 Ga0075434_100047169
648 Ga0075434_100123069
649 Ga0075434_100249935
650 Ga0075434_100463431
651 Ga0068865_100238801
652 Ga0068865_100482789
653 Ga0075436_100042558
654 Ga0097620_100020679
655 Ga0097620_100653947
656 Ga0097620_100800860
657 Ga0075435_100756760
658 Ga0075435_100882455
659 Ga0105244_10087931
660 Ga0105240_12666410
661 Ga0111539_10049400
662 Ga0111539_10078062
663 Ga0111539_10932482
664 Ga0111539_12738639
665 Ga0105245_10010634
666 Ga0105245_10090377
667 Ga0105245_10704883
668 Ga0114129_10129085
669 Ga0114129_10288535
670 Ga0114129_10442200
671 Ga0114129_10795914
672 Ga0114129_10807166
673 Ga0114129_11047083
674 Ga0105243_10017516
675 Ga0105243_10605410
676 Ga0105243_11815825
677 Ga0105243_12107073
678 Ga0105241_10190084
679 Ga0105241_11419678
680 Ga0105242_10029489
681 Ga0105242_10784473
682 Ga0105248_10202563
683 Ga0105238_12238103
684 Ga0105249_10054516
685 Ga0105239_12478029
686 Ga0105246_10369228
687 Ga0105246_11071470
688 Ga0157326_1000052
689 Ga0157371_10939507
690 Ga0157369_12084829
691 Ga0157374_12878165
692 Ga0157378_10012452
693 Ga0157378_11260401
694 Ga0157378_12269243
695 Ga0163162_10034816
696 Ga0163162_11996697
697 Ga0163162_12180663
698 Ga0163162_12725596
699 Ga0157375_10191750
700 Ga0157375_11466174
701 Ga0163163_10549651
702 Ga0157380_10023792
703 Ga0157380_10065072
704 Ga0157380_11560056
705 Ga0182008_10464838
706 Ga0157377_10017227
707 Ga0157377_10123174
708 Ga0157377_10467585
709 Ga0157379_10143058
710 Ga0157379_10848406
711 Ga0182006_1181528
712 Ga0163161_10102116
713 Ga0206353_12042751
714 Ga0213871_10027869
715 Ga0207642_10526382
716 Ga0207688_10003643
717 Ga0207688_10043307
718 Ga0207688_10621982
719 Ga0207688_11031846
720 Ga0207699_10185946
721 Ga0207643_10002829
722 Ga0207643_10130037
723 Ga0207684_10307492
724 Ga0207654_10558734
725 Ga0207707_10003517
726 Ga0207707_10362267
727 Ga0207707_10475982
728 Ga0207707_11171614
729 Ga0207663_10337883
730 Ga0207660_10256373
731 Ga0207660_10668803
732 Ga0207662_10002116
733 Ga0207662_10106719
734 Ga0207657_10066325
735 Ga0207657_10074031
736 Ga0207649_10116957
737 Ga0207652_10051664
738 Ga0207652_10801893
739 Ga0207646_10512048
740 Ga0207646_11518408
741 Ga0207681_10231351
742 Ga0207681_10498303
743 Ga0207694_11453519
744 Ga0207687_10105528
745 Ga0207687_10161664
746 Ga0207690_10059157
747 Ga0207706_10027497
748 Ga0207706_10863553
749 Ga0207709_10025761
750 Ga0207709_10378061
751 Ga0207709_11245958
752 Ga0207670_10919849
753 Ga0207669_10109344
754 Ga0207669_10173562
755 Ga0207704_10205266
756 Ga0207704_10650402
757 Ga0207665_10296708
758 Ga0207691_10153925
759 Ga0207691_10656101
760 Ga0207711_10102480
761 Ga0207711_10274597
762 Ga0207711_10962243
763 Ga0207689_10026852
764 Ga0207689_10271779
765 Ga0207689_11055648
766 Ga0207661_12038843
767 Ga0207661_12048818
768 Ga0207679_10150691
769 Ga0207651_10269035
770 Ga0207712_10021987
771 Ga0207712_10034729
772 Ga0207712_10568774
773 Ga0207712_11601880
774 Ga0207668_10757031
775 Ga0207658_10828579
776 Ga0207677_10591781
777 Ga0207703_10184448
778 Ga0207703_10271461
779 Ga0207703_10375206
780 Ga0207639_10183470
781 Ga0207678_10007640
782 Ga0207708_10000838
783 Ga0207708_10153365
784 Ga0207708_10170139
785 Ga0207641_11279885
786 Ga0207648_10000916
787 Ga0207676_11258736
788 Ga0207674_10006012
789 Ga0207674_11936312
790 Ga0207675_100292402
791 Ga0207675_100400399
792 Ga0207683_10003470
793 Ga0207683_10527167
794 Ga0207683_10883674
795 Ga0207698_10768906
796 Ga0209999_1051354
797 Ga0209998_10012850
798 Ga0209998_10046322
799 Ga0209974_10028204
800 Ga0209974_10147587
801 Ga0207428_10092283
802 Ga0207428_10225427
803 Ga0207428_10717339
804 Ga0268266_11411067
805 Ga0268265_10764074
806 Ga0268265_12018421
807 Ga0268264_10077892
808 Ga0307405_10272719
809 Ga0307412_10419148
810 Ga0307409_100057767
811 Ga0307409_100077729
812 Ga0307416_100001109
813 Ga0307411_10556917
814 Ga0307415_100005086
815 Ga0373930_0012005
816 Ga0373930_0167883
817 Ga0373938_0062986
818 Ga0373928_0126574
819 Ga0373951_0012329
820 Ga0373951_0073345
821 Ga0373960_0043289
822 Ga0373942_0136162
823 Ga0373931_0014212
824 Ga0373931_0364640
825 Ga0373933_0951582
826 Ga0395900_0587480
827 Ga0395898_0114191
828 Ga0395905_0691440
829 Ga0436364_0863046
830 Ga0395901_1114105
831 Ga0436365_1681945
832 Ga0436360_0420685
833 Ga0439438_053640
834 Ga0439461_0005430
835 Ga0439466_0017328
836 Ga0439465_0159641
837 Ga0450920_068223
838 Ga0450903_065438
839 Ga0450910_040539
840 Ga0439459_0078840
841 Ga0466965_0033326
842 Ga0466960_0192820
843 Ga0451576_0803143
844 Ga0495641_0162862
845 Ga0495651_0055334
846 Ga0495651_0282072
847 Ga0495653_0153099
848 Ga0495664_0209457
849 Ga0495618_0428291
850 Ga0495630_0813708
851 Ga0495642_0359208
852 Ga0495640_0776979
853 Ga0495667_0720430
854 Ga0495656_0104089
855 Ga0495657_0432729
856 Ga0495623_0307215
857 Ga0495658_0801300
858 Ga0495671_0276162
859 Ga0495680_0122455
860 Ga0495683_0405439
861 Ga0495675_0268678
862 Ga0496101_0126881
863 Ga0496102_0027538
864 Ga0496102_0352849
865 Ga0496102_0501612
866 Ga0496102_1562426
867 Ga0496103_0334878
868 Ga0496104_0852312
869 Ga0496106_0028863
870 Ga0496108_0103643
871 Ga0496109_0011260
872 Ga0496109_0413499
873 Ga0496109_0828082
874 Ga0496110_0012161
875 Ga0496110_0041573
876 Ga0496111_0061339
877 Ga0496112_0311845
878 Ga0496112_0382338
879 Ga0496112_0678955
880 Ga0496112_1037124
881 Ga0496113_0018231
882 Ga0496113_0106662
883 Ga0496114_0076991
884 Ga0496114_0290998
885 Ga0496114_0742284
886 Ga0496126_0443962
887 Ga0501031_0029250
888 Ga0501031_1045913
889 Ga0501032_0106606
890 Ga0501032_0331905
891 Ga0501032_0408242
892 Ga0501032_0695144
893 Ga0501033_0189586
894 Ga0501033_0850183
895 Ga0501034_0062040
896 Ga0501036_0057636
897 Ga0501036_0129935
898 Ga0501036_0142773
899 Ga0501036_0926806
900 Ga0501036_1120538
901 Ga0501037_0243223
902 Ga0501038_0082941
903 Ga0501038_0239669
904 Ga0501039_0031401
905 Ga0501039_0059165
906 Ga0501039_0875615
907 Ga0501040_0018052
908 Ga0501040_0022864
909 Ga0501040_0258900
910 Ga0501041_0028557
911 Ga0501041_0069113
912 Ga0501041_0197049
913 Ga0501042_0114861
914 Ga0501042_0176961
915 Ga0501043_0391277
916 Ga0501046_0935204
917 Ga0501047_1361815
918 Ga0501048_0053730
919 Ga0501048_0136211
920 Ga0501048_0402911
921 Ga0501067_0011400
922 Ga0501067_0062896
923 Ga0501067_0491824
924 Ga0501068_0147218
925 Ga0501068_0352547
926 Ga0501068_0403004
927 Ga0501068_0914719
928 Ga0501069_0026928
929 Ga0501069_0039434
930 Ga0501069_0085096
931 Ga0501069_0285821
932 Ga0501069_0350208
933 Ga0501070_0096214
934 Ga0501070_0234679
935 Ga0501070_0709978
936 Ga0501071_0006977
937 Ga0501071_0073632
938 Ga0501071_0135551
939 Ga0501071_0157696
940 Ga0501072_0116328
941 Ga0501072_0149276
942 Ga0501072_0196764
943 Ga0501072_0287932
944 Ga0501073_0096374
945 Ga0501074_0025384
946 Ga0501074_0055001
947 Ga0501074_0126936
948 Ga0501075_0040067
949 Ga0501075_0138987
950 Ga0501075_0167938
951 Ga0501075_0194648
952 Ga0501075_0487411
953 Ga0501075_0717995
954 Ga0501076_0002696
955 Ga0501076_0013446
956 Ga0501076_0014331
957 Ga0501076_0029540
958 Ga0501076_0059233
959 Ga0501076_0068588
960 Ga0501076_0104287
961 Ga0501076_0473294
962 Ga0501077_0026779
963 Ga0501077_0060583
964 Ga0501077_0102371
965 Ga0501079_0009319
966 Ga0501079_0070691
967 Ga0501079_0828598
968 Ga0501080_0119755
969 Ga0501081_0015499
970 Ga0501081_0163836
971 Ga0501081_0231939
972 Ga0501081_0281229
973 Ga0501081_0918445
974 Ga0501081_1265700
975 Ga0501083_0004226
976 Ga0501083_0057368
977 Ga0501083_0068900
978 Ga0501083_0263192
979 Ga0501035_0055399
980 Ga0501035_0286861
981 Ga0501035_0782166
982 Ga0501044_0019077
983 Ga0501044_0172039
984 Ga0501045_0028216
985 Ga0501045_0070773
986 Ga0501045_0079049
987 Ga0501045_0086772
988 Ga0501045_0761996
989 nmdc:mga0k408_900782_c1
990 nmdc:mga05p37_20877_c1
991 nmdc:mga05p37_299426_c1
992 nmdc:mga05p37_409912_c1
993 nmdc:mga05p37_422770_c1
994 nmdc:mga06r32_129474_c1
995 nmdc:mga06r32_139371_c1
996 nmdc:mga06r32_510440_c1
997 nmdc:mga06r32_891534_c1
998 nmdc:mga08y16_206194_c1
999 nmdc:mga08y16_218062_c1
1000 nmdc:mga08y16_21988_c1
1001 nmdc:mga08y16_254540_c1
1002 nmdc:mga0n895_1857384_c1
1003 nmdc:mga0n895_361743_c1
1004 nmdc:mga0n895_535515_c1
1005 nmdc:mga0n895_617533_c1
1006 nmdc:mga0rr50_663702_c1
1007 nmdc:mga08x19_45999_c1
1008 nmdc:mga0a205_156856_c2
1009 Ga0495601_0010607
1010 Ga0495601_0632942
1011 Ga0495612_0130765
1012 Ga0495595_0033641
1013 Ga0495619_0130088
1014 Ga0500643_181329
1015 Ga0500616_0004491
1016 Ga0500616_0143586
1017 Ga0501084_0027017
1018 Ga0501084_0137553
1019 Ga0501084_0238654
1020 Ga0501084_0321035
1021 Ga0590071_026539
1022 Ga0501082_0036287
1023 Ga0501082_0037265
1024 Ga0501082_0099415
1025 Ga0501082_0157518
1026 Ga0501082_0619056
1027 Ga0530510_0001027
1028 Ga0530510_0027496
1029 Ga0530510_0071659
1030 Ga0530510_0098919
1031 Ga0530510_0143079
1032 Ga0530510_0158446
1033 Ga0530510_0163942
1034 2842734541
1035 2878745937
1036 2924784079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

43

157

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v4d-assembly1.cif.gz_A crystal structure of rutc protein a member of the yjgf family from e.coli 0.9804 2 126
3v4d-assembly1.cif.gz_C crystal structure of rutc protein a member of the yjgf family from e.coli 0.9743 1 126
3v4d-assembly2.cif.gz_D crystal structure of rutc protein a member of the yjgf family from e.coli 0.9713 1 126
3v4d-assembly2.cif.gz_B crystal structure of rutc protein a member of the yjgf family from e.coli 0.9705 1 126
3v4d-assembly2.cif.gz_E crystal structure of rutc protein a member of the yjgf family from e.coli 0.9664 1 126
ID Description Score Start End Superfamily
af_P0AFQ5_1_128_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9781 1 125 3.30.1330.40
6izhH00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9711 4 125 3.30.1330.40
af_P0AFQ5_1_128_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9629 1 125 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9576 18 126 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9454 3 125 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A2S6QGQ1-F1-model_v4 Putative aminoacrylate peracid reductase RutC (EC 1.-.-.-) 0.9985 1 126 GO:0005829
GO:0016491
GO:0019239
AF-A0A1F7TAW8-F1-model_v4 Deaminase 0.9913 23 125 GO:0005829
GO:0019239
AF-A0A2S6QGQ1-F1-model_v4 Putative aminoacrylate peracid reductase RutC (EC 1.-.-.-) 0.9906 1 126 GO:0005829
GO:0016491
GO:0019239
AF-A0A6A7YBX0-F1-model_v4 Pyrimidine utilization protein C 0.9873 1 125 GO:0005829
GO:0019239
AF-A0A2N2QGY4-F1-model_v4 deleted 0.9847 18 126

Map