F458234

General Info

Members Datasets Scaffolds Average Seq Length
518 218 1034 135

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100127570|Ga0075431_1001275704
Length 145
Sequence MRRPGVYNVGAMDMTRLVVGAGLAVAMSLPVSAHHSFAAEFDANKPVTLKGSVTKVEWQNPHIWVYLDVKDEQGRVQPWQCEGGAPNTLTRNGWSKDTLKFGEQVTIDGALAKDGSKTCNMRVVKLPDGRTVFAGSSGGDAPPKQ

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
76 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
188 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
192 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
193 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
197 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 2.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.97
Rhizosphere 98.07
Stem 0
Stem Tuber 0
Unclassified 30.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100127570 3300006847 Unclassified 2625
2 JGI24746J21847_1001312 3300001977 Unclassified 3968
3 JGI24746J21847_1002613 3300001977 Unclassified 2854
4 Ga0058858_1005683 3300004785 Unclassified 1107
5 Ga0058859_10048081 3300004798 Bacteria 1849
6 Ga0058859_10149588 3300004798 Bacteria 700
7 Ga0058863_11585132 3300004799 Bacteria 553
8 Ga0058861_11571377 3300004800 Bacteria 545
9 Ga0058860_10022220 3300004801 Unclassified 1347
10 Ga0058860_10053229 3300004801 Unclassified 2521
11 Ga0058862_12453398 3300004803 Bacteria 1594
12 Ga0065714_10220421 3300005288 Bacteria 842
13 Ga0065704_10016305 3300005289 Bacteria 1650
14 Ga0065712_10075103 3300005290 Unclassified 3936
15 Ga0065715_10005596 3300005293 Bacteria 3129
16 Ga0065715_10015619 3300005293 Bacteria 1874
17 Ga0065707_10107319 3300005295 Unclassified 2559
18 Ga0070676_10030575 3300005328 Bacteria 3072
19 Ga0070676_10251979 3300005328 Bacteria 1178
20 Ga0070690_100034739 3300005330 Bacteria 3160
21 Ga0070690_100344428 3300005330 Bacteria 1080
22 Ga0070690_100386022 3300005330 Bacteria 1025
23 Ga0070690_100624753 3300005330 Bacteria 820
24 Ga0070670_100027457 3300005331 Bacteria 4896
25 Ga0070670_100524462 3300005331 Bacteria 1055
26 Ga0070677_10002043 3300005333 Bacteria 6421
27 Ga0068869_100022580 3300005334 Bacteria 4337
28 Ga0068869_100581971 3300005334 Unclassified 944
29 Ga0068869_100844820 3300005334 Unclassified 789
30 Ga0070666_10022675 3300005335 Bacteria 4079
31 Ga0070666_10024365 3300005335 Unclassified 3941
32 Ga0070666_10061675 3300005335 Bacteria 2539
33 Ga0070666_10464009 3300005335 Bacteria 916
34 Ga0070680_100185805 3300005336 Bacteria 1751
35 Ga0070682_101593705 3300005337 Unclassified 564
36 Ga0068868_100005008 3300005338 Bacteria 9308
37 Ga0068868_100692090 3300005338 Bacteria 911
38 Ga0068868_100740755 3300005338 Unclassified 882
39 Ga0068868_101367219 3300005338 Bacteria 659
40 Ga0070660_100092732 3300005339 Bacteria 2384
41 Ga0070689_100011003 3300005340 Bacteria 6467
42 Ga0070689_100223079 3300005340 Bacteria 1547
43 Ga0070689_101409300 3300005340 Unclassified 630
44 Ga0070691_10056615 3300005341 Bacteria 1879
45 Ga0070687_100069810 3300005343 Unclassified 1883
46 Ga0070687_100517974 3300005343 Bacteria 806
47 Ga0070661_100447155 3300005344 Bacteria 1028
48 Ga0070692_10217560 3300005345 Bacteria 1127
49 Ga0070668_100021463 3300005347 Bacteria 4879
50 Ga0070668_100136423 3300005347 Unclassified 1974
51 Ga0070668_100267029 3300005347 Bacteria 1425
52 Ga0070668_100281075 3300005347 Bacteria 1390
53 Ga0070669_100014191 3300005353 Bacteria 5669
54 Ga0070669_100034057 3300005353 Bacteria 3687
55 Ga0070669_100066128 3300005353 Bacteria 2664
56 Ga0070669_100505832 3300005353 Bacteria 1003
57 Ga0070669_100531192 3300005353 Bacteria 979
58 Ga0070675_100103252 3300005354 Unclassified 2403
59 Ga0070675_100106234 3300005354 Bacteria 2370
60 Ga0070675_100546990 3300005354 Bacteria 1047
61 Ga0070675_100810511 3300005354 Unclassified 856
62 Ga0070675_101263429 3300005354 Unclassified 680
63 Ga0070671_100043604 3300005355 Unclassified 3728
64 Ga0070671_100236615 3300005355 Bacteria 1550
65 Ga0070671_100297880 3300005355 Bacteria 1373
66 Ga0070674_100000340 3300005356 Bacteria 23159
67 Ga0070674_100005172 3300005356 Bacteria 7498
68 Ga0070674_100028790 3300005356 Bacteria 3650
69 Ga0070674_100160749 3300005356 Unclassified 1704
70 Ga0070674_100251126 3300005356 Unclassified 1389
71 Ga0070674_100260449 3300005356 Bacteria 1366
72 Ga0070674_100833626 3300005356 Unclassified 799
73 Ga0070673_100004440 3300005364 Bacteria 8873
74 Ga0070673_100033322 3300005364 Bacteria 3888
75 Ga0070673_100212588 3300005364 Unclassified 1671
76 Ga0070673_100282895 3300005364 Unclassified 1455
77 Ga0070673_100839785 3300005364 Unclassified 850
78 Ga0070673_101324464 3300005364 Unclassified 677
79 Ga0070688_100030176 3300005365 Bacteria 3252
80 Ga0070688_100069592 3300005365 Bacteria 2247
81 Ga0070688_100581882 3300005365 Bacteria 855
82 Ga0070688_100945130 3300005365 Bacteria 682
83 Ga0070659_100020998 3300005366 Bacteria 4966
84 Ga0070659_100270540 3300005366 Bacteria 1412
85 Ga0070667_101492398 3300005367 Unclassified 635
86 Ga0070701_10028383 3300005438 Bacteria 2751
87 Ga0070705_100139289 3300005440 Bacteria 1594
88 Ga0070705_101220641 3300005440 Unclassified 620
89 Ga0070700_100025700 3300005441 Bacteria 3469
90 Ga0070700_100046806 3300005441 Bacteria 2674
91 Ga0070700_100382011 3300005441 Bacteria 1054
92 Ga0070700_100925463 3300005441 Bacteria 711
93 Ga0070694_100008069 3300005444 Bacteria 6430
94 Ga0070694_100059878 3300005444 Bacteria 2595
95 Ga0070694_100568315 3300005444 Bacteria 910
96 Ga0070678_100118169 3300005456 Unclassified 2086
97 Ga0070678_100140738 3300005456 Bacteria 1930
98 Ga0070678_100387452 3300005456 Bacteria 1211
99 Ga0070678_101042794 3300005456 Bacteria 753
100 Ga0070662_100015764 3300005457 Bacteria 5067
101 Ga0070662_100033661 3300005457 Bacteria 3610
102 Ga0070662_100174242 3300005457 Bacteria 1691
103 Ga0068867_100033380 3300005459 Bacteria 3726
104 Ga0068867_100041530 3300005459 Bacteria 3361
105 Ga0068867_100329902 3300005459 Bacteria 1267
106 Ga0068867_100713090 3300005459 Unclassified 886
107 Ga0068867_100748108 3300005459 Unclassified 867
108 Ga0068867_101039409 3300005459 Unclassified 745
109 Ga0068867_101113372 3300005459 Unclassified 721
110 Ga0068867_101326798 3300005459 Bacteria 665
111 Ga0070685_10009649 3300005466 Bacteria 4996
112 Ga0070685_11490782 3300005466 Unclassified 521
113 Ga0070707_100474158 3300005468 Unclassified 1213
114 Ga0070707_101199032 3300005468 Unclassified 725
115 Ga0070698_100064413 3300005471 Bacteria 3693
116 Ga0070698_100343059 3300005471 Bacteria 1425
117 Ga0070698_100938117 3300005471 Unclassified 812
118 Ga0070697_100143961 3300005536 Bacteria 2006
119 Ga0068853_100128017 3300005539 Bacteria 2270
120 Ga0070672_100011676 3300005543 Bacteria 6132
121 Ga0070672_100156408 3300005543 Bacteria 1888
122 Ga0070672_100302813 3300005543 Unclassified 1355
123 Ga0070672_100306144 3300005543 Bacteria 1348
124 Ga0070672_101222405 3300005543 Bacteria 670
125 Ga0070686_100002629 3300005544 Bacteria 9904
126 Ga0070686_100035340 3300005544 Bacteria 3086
127 Ga0070686_100370663 3300005544 Bacteria 1081
128 Ga0070695_100004722 3300005545 Bacteria 8016
129 Ga0070695_100077708 3300005545 Bacteria 2188
130 Ga0070695_100680717 3300005545 Bacteria 815
131 Ga0070696_100082340 3300005546 Unclassified 2281
132 Ga0070696_100089082 3300005546 Bacteria 2194
133 Ga0070696_101287884 3300005546 Unclassified 620
134 Ga0070665_100004399 3300005548 Bacteria 14816
135 Ga0070665_100329403 3300005548 Unclassified 1531
136 Ga0070704_100006011 3300005549 Bacteria 7117
137 Ga0070704_100008424 3300005549 Bacteria 6183
138 Ga0070704_100030680 3300005549 Bacteria 3605
139 Ga0070704_100530656 3300005549 Bacteria 1026
140 Ga0068855_100089469 3300005563 Bacteria 3554
141 Ga0070664_100005370 3300005564 Bacteria 10288
142 Ga0070664_101009527 3300005564 Bacteria 782
143 Ga0068857_100945582 3300005577 Bacteria 828
144 Ga0068854_100154708 3300005578 Bacteria 1771
145 Ga0068854_101362966 3300005578 Unclassified 640
146 Ga0068856_100023416 3300005614 Bacteria 6004
147 Ga0068856_101467189 3300005614 Unclassified 696
148 Ga0070702_100022187 3300005615 Bacteria 3352
149 Ga0070702_100545500 3300005615 Unclassified 860
150 Ga0068852_100607772 3300005616 Unclassified 1098
151 Ga0068852_100988392 3300005616 Bacteria 860
152 Ga0068859_100054697 3300005617 Bacteria 4015
153 Ga0068859_100102690 3300005617 Bacteria 2917
154 Ga0068859_100344096 3300005617 Bacteria 1585
155 Ga0068859_101017937 3300005617 Unclassified 910
156 Ga0068864_101046898 3300005618 Bacteria 810
157 Ga0068864_101076909 3300005618 Unclassified 799
158 Ga0068864_102087027 3300005618 Unclassified 573
159 Ga0068866_10025373 3300005718 Bacteria 2786
160 Ga0068866_10245084 3300005718 Bacteria 1093
161 Ga0068866_10255504 3300005718 Bacteria 1074
162 Ga0068861_100041305 3300005719 Unclassified 3454
163 Ga0068861_100044561 3300005719 Bacteria 3336
164 Ga0068861_100051474 3300005719 Bacteria 3126
165 Ga0068861_100113667 3300005719 Bacteria 2172
166 Ga0068861_100254293 3300005719 Unclassified 1501
167 Ga0068851_10273477 3300005834 Bacteria 964
168 Ga0068870_10010727 3300005840 Bacteria 4219
169 Ga0068870_10059173 3300005840 Unclassified 2053
170 Ga0068870_10679956 3300005840 Unclassified 708
171 Ga0068863_100031429 3300005841 Bacteria 5065
172 Ga0068863_100184208 3300005841 Bacteria 2005
173 Ga0068863_100807471 3300005841 Bacteria 936
174 Ga0068858_100021954 3300005842 Bacteria 5961
175 Ga0068858_100542184 3300005842 Bacteria 1126
176 Ga0068860_100071370 3300005843 Bacteria 3300
177 Ga0068860_100618046 3300005843 Bacteria 1090
178 Ga0068860_101025584 3300005843 Bacteria 843
179 Ga0068862_100001025 3300005844 Bacteria 26893
180 Ga0068862_100092746 3300005844 Bacteria 2633
181 Ga0068862_100663820 3300005844 Bacteria 1007
182 Ga0075432_10041431 3300006058 Bacteria 1609
183 Ga0097621_100140778 3300006237 Bacteria 2061
184 Ga0097621_100219352 3300006237 Bacteria 1657
185 Ga0068871_100003652 3300006358 Bacteria 10572
186 Ga0068871_100164605 3300006358 Bacteria 1898
187 Ga0068871_100321035 3300006358 Bacteria 1364
188 Ga0075428_100002841 3300006844 Bacteria 18885
189 Ga0075428_100482149 3300006844 Bacteria 1327
190 Ga0075430_100008036 3300006846 Bacteria 8916
191 Ga0075430_100743289 3300006846 Bacteria 809
192 Ga0075430_101736434 3300006846 Unclassified 512
193 Ga0075431_100015089 3300006847 Bacteria 7823
194 Ga0075431_100024715 3300006847 Bacteria 6160
195 Ga0075433_10000251 3300006852 Bacteria 31061
196 Ga0075433_10110597 3300006852 Bacteria 2438
197 Ga0075434_101053730 3300006871 Bacteria 827
198 Ga0075429_100002679 3300006880 Bacteria 14985
199 Ga0075429_100095158 3300006880 Bacteria 2597
200 Ga0075429_100793854 3300006880 Bacteria 829
201 Ga0068865_100017265 3300006881 Bacteria 4638
202 Ga0068865_100128294 3300006881 Bacteria 1897
203 Ga0068865_100205093 3300006881 Bacteria 1533
204 Ga0068865_100328685 3300006881 Bacteria 1232
205 Ga0068865_100444472 3300006881 Bacteria 1071
206 Ga0068865_101080579 3300006881 Unclassified 706
207 Ga0068865_101098838 3300006881 Bacteria 700
208 Ga0097620_100054698 3300006931 Bacteria 4015
209 Ga0097620_100102699 3300006931 Bacteria 2917
210 Ga0097620_100344122 3300006931 Bacteria 1585
211 Ga0075435_100005384 3300007076 Bacteria 8927
212 Ga0105244_10313640 3300009036 Unclassified 725
213 Ga0111539_10007388 3300009094 Bacteria 14075
214 Ga0111539_10029221 3300009094 Bacteria 6718
215 Ga0111539_10252422 3300009094 Unclassified 2054
216 Ga0111539_10452835 3300009094 Bacteria 1494
217 Ga0111539_12687518 3300009094 Unclassified 577
218 Ga0105245_10062744 3300009098 Bacteria 3353
219 Ga0105245_10450959 3300009098 Bacteria 1295
220 Ga0105245_10456654 3300009098 Bacteria 1287
221 Ga0105245_11143049 3300009098 Bacteria 826
222 Ga0105245_11491490 3300009098 Unclassified 727
223 Ga0114129_10045968 3300009147 Bacteria 6136
224 Ga0114129_10144569 3300009147 Unclassified 3258
225 Ga0114129_10261631 3300009147 Bacteria 2318
226 Ga0105243_10009369 3300009148 Bacteria 7462
227 Ga0105243_10013525 3300009148 Bacteria 6173
228 Ga0105243_10217373 3300009148 Bacteria 1687
229 Ga0105241_10088815 3300009174 Bacteria 2434
230 Ga0105241_10692365 3300009174 Unclassified 930
231 Ga0105241_11592929 3300009174 Bacteria 631
232 Ga0105241_11607918 3300009174 Unclassified 629
233 Ga0105242_10014788 3300009176 Bacteria 6043
234 Ga0105242_10193348 3300009176 Bacteria 1803
235 Ga0105242_10390836 3300009176 Bacteria 1295
236 Ga0105242_10873550 3300009176 Unclassified 897
237 Ga0105242_11767464 3300009176 Unclassified 656
238 Ga0105242_11992969 3300009176 Unclassified 623
239 Ga0105248_10025687 3300009177 Bacteria 6551
240 Ga0105248_10052335 3300009177 Bacteria 4581
241 Ga0105248_10429393 3300009177 Bacteria 1488
242 Ga0105248_10777208 3300009177 Unclassified 1081
243 Ga0105248_11009221 3300009177 Bacteria 940
244 Ga0105237_10458440 3300009545 Unclassified 1281
245 Ga0105238_10001003 3300009551 Bacteria 28821
246 Ga0105238_10023405 3300009551 Bacteria 6296
247 Ga0105238_10027537 3300009551 Bacteria 5793
248 Ga0105238_10285325 3300009551 Bacteria 1633
249 Ga0105249_10019650 3300009553 Bacteria 6029
250 Ga0105249_10678212 3300009553 Bacteria 1090
251 Ga0105249_11129831 3300009553 Unclassified 854
252 Ga0105239_10036243 3300010375 Bacteria 5417
253 Ga0105246_10401554 3300011119 Bacteria 1138
254 Ga0105246_10526675 3300011119 Bacteria 1008
255 Ga0157345_1023981 3300012498 Unclassified 642
256 Ga0157371_10278883 3300013102 Bacteria 1207
257 Ga0157370_10189485 3300013104 Unclassified 1909
258 Ga0157374_10071768 3300013296 Bacteria 3266
259 Ga0163162_10011337 3300013306 Bacteria 8692
260 Ga0163162_10019939 3300013306 Bacteria 6586
261 Ga0157372_11382143 3300013307 Unclassified 812
262 Ga0157375_10206991 3300013308 Bacteria 2118
263 Ga0157375_10345954 3300013308 Bacteria 1652
264 Ga0157375_10563765 3300013308 Bacteria 1300
265 Ga0157375_10699598 3300013308 Unclassified 1167
266 Ga0157375_12941659 3300013308 Unclassified 569
267 Ga0163163_10113299 3300014325 Unclassified 2742
268 Ga0163163_10218742 3300014325 Bacteria 1953
269 Ga0163163_10735689 3300014325 Bacteria 1050
270 Ga0157380_10035582 3300014326 Bacteria 3847
271 Ga0157380_10044593 3300014326 Bacteria 3476
272 Ga0157380_10109531 3300014326 Bacteria 2318
273 Ga0157380_10204655 3300014326 Bacteria 1754
274 Ga0157380_10890068 3300014326 Bacteria 915
275 Ga0157380_11228390 3300014326 Unclassified 794
276 Ga0157377_10020704 3300014745 Bacteria 3450
277 Ga0157377_10068383 3300014745 Bacteria 2047
278 Ga0157379_10086884 3300014968 Bacteria 2804
279 Ga0157376_10071990 3300014969 Bacteria 2939
280 Ga0157376_10119935 3300014969 Bacteria 2329
281 Ga0163161_10038785 3300017792 Bacteria 3418
282 Ga0163161_10111626 3300017792 Bacteria 2044
283 Ga0197907_10576538 3300020069 Bacteria 668
284 Ga0206356_11497013 3300020070 Bacteria 1253
285 Ga0206351_10087305 3300020077 Bacteria 713
286 Ga0206354_10385089 3300020081 Bacteria 682
287 Ga0206353_10802145 3300020082 Unclassified 507
288 Ga0207697_10000815 3300025315 Bacteria 17655
289 Ga0207697_10025804 3300025315 Bacteria 2402
290 Ga0207697_10107159 3300025315 Bacteria 1195
291 Ga0207682_10001377 3300025893 Bacteria 11222
292 Ga0207682_10196315 3300025893 Bacteria 927
293 Ga0207682_10566438 3300025893 Unclassified 536
294 Ga0207642_10019618 3300025899 Bacteria 2621
295 Ga0207642_10031176 3300025899 Bacteria 2230
296 Ga0207688_10039666 3300025901 Unclassified 2615
297 Ga0207680_10459886 3300025903 Bacteria 904
298 Ga0207647_10092929 3300025904 Bacteria 1798
299 Ga0207645_10002151 3300025907 Bacteria 15755
300 Ga0207645_10027858 3300025907 Bacteria 3648
301 Ga0207645_10128275 3300025907 Bacteria 1650
302 Ga0207645_10183890 3300025907 Bacteria 1372
303 Ga0207645_10201849 3300025907 Bacteria 1308
304 Ga0207645_10638755 3300025907 Unclassified 723
305 Ga0207643_10000847 3300025908 Bacteria 18546
306 Ga0207643_10050557 3300025908 Bacteria 2357
307 Ga0207654_10049026 3300025911 Bacteria 2420
308 Ga0207695_10074839 3300025913 Bacteria 3447
309 Ga0207695_10250337 3300025913 Bacteria 1671
310 Ga0207671_10178396 3300025914 Bacteria 1652
311 Ga0207662_10108653 3300025918 Bacteria 1727
312 Ga0207646_10223387 3300025922 Bacteria 1702
313 Ga0207646_10601100 3300025922 Unclassified 987
314 Ga0207681_10014985 3300025923 Bacteria 4831
315 Ga0207681_10021666 3300025923 Bacteria 4089
316 Ga0207681_10156615 3300025923 Bacteria 1712
317 Ga0207681_11020677 3300025923 Unclassified 694
318 Ga0207681_11433359 3300025923 Unclassified 579
319 Ga0207694_10154197 3300025924 Bacteria 1852
320 Ga0207694_10365440 3300025924 Unclassified 1196
321 Ga0207650_10287977 3300025925 Bacteria 1339
322 Ga0207659_10013636 3300025926 Bacteria 5213
323 Ga0207659_10027447 3300025926 Bacteria 3855
324 Ga0207659_10046685 3300025926 Unclassified 3060
325 Ga0207659_10245530 3300025926 Bacteria 1450
326 Ga0207659_10265466 3300025926 Bacteria 1398
327 Ga0207687_10061633 3300025927 Bacteria 2649
328 Ga0207644_10059518 3300025931 Bacteria 2763
329 Ga0207644_10182674 3300025931 Bacteria 1645
330 Ga0207690_10248329 3300025932 Bacteria 1373
331 Ga0207706_10016778 3300025933 Bacteria 6609
332 Ga0207706_10113135 3300025933 Bacteria 2387
333 Ga0207706_10139232 3300025933 Bacteria 2135
334 Ga0207686_10218583 3300025934 Bacteria 1374
335 Ga0207686_10485065 3300025934 Unclassified 956
336 Ga0207686_10601928 3300025934 Unclassified 865
337 Ga0207686_10825006 3300025934 Unclassified 745
338 Ga0207686_10987462 3300025934 Unclassified 683
339 Ga0207709_10026175 3300025935 Bacteria 3348
340 Ga0207709_10030002 3300025935 Bacteria 3160
341 Ga0207709_10227474 3300025935 Bacteria 1349
342 Ga0207670_10813962 3300025936 Bacteria 779
343 Ga0207670_11328196 3300025936 Unclassified 610
344 Ga0207669_10000948 3300025937 Bacteria 12283
345 Ga0207669_10203087 3300025937 Bacteria 1440
346 Ga0207669_10664801 3300025937 Unclassified 853
347 Ga0207669_11621699 3300025937 Unclassified 552
348 Ga0207704_10034365 3300025938 Bacteria 2892
349 Ga0207704_10228646 3300025938 Bacteria 1382
350 Ga0207704_10540084 3300025938 Bacteria 946
351 Ga0207704_10710071 3300025938 Unclassified 833
352 Ga0207704_10905846 3300025938 Bacteria 742
353 Ga0207691_10003859 3300025940 Bacteria 14545
354 Ga0207691_10010942 3300025940 Bacteria 8708
355 Ga0207691_10046338 3300025940 Bacteria 3996
356 Ga0207691_10241358 3300025940 Unclassified 1562
357 Ga0207691_10659736 3300025940 Bacteria 883
358 Ga0207711_10301811 3300025941 Bacteria 1477
359 Ga0207711_10429249 3300025941 Bacteria 1229
360 Ga0207711_10549836 3300025941 Unclassified 1077
361 Ga0207711_10808399 3300025941 Bacteria 873
362 Ga0207711_10836037 3300025941 Bacteria 857
363 Ga0207689_10003934 3300025942 Bacteria 13528
364 Ga0207689_10069180 3300025942 Bacteria 2900
365 Ga0207689_10539658 3300025942 Unclassified 979
366 Ga0207679_10003089 3300025945 Bacteria 10307
367 Ga0207679_10593911 3300025945 Unclassified 997
368 Ga0207679_10908079 3300025945 Bacteria 806
369 Ga0207667_10201869 3300025949 Unclassified 2040
370 Ga0207651_10037684 3300025960 Bacteria 3169
371 Ga0207651_10048279 3300025960 Unclassified 2876
372 Ga0207651_10238017 3300025960 Unclassified 1482
373 Ga0207651_10533286 3300025960 Bacteria 1019
374 Ga0207651_10564192 3300025960 Bacteria 991
375 Ga0207651_10990265 3300025960 Bacteria 751
376 Ga0207712_10012851 3300025961 Bacteria 5356
377 Ga0207712_10517109 3300025961 Bacteria 1022
378 Ga0207712_10751646 3300025961 Unclassified 854
379 Ga0207668_10085313 3300025972 Bacteria 2304
380 Ga0207668_10256621 3300025972 Unclassified 1423
381 Ga0207668_10452241 3300025972 Bacteria 1096
382 Ga0207668_10664365 3300025972 Bacteria 913
383 Ga0207668_11465865 3300025972 Unclassified 616
384 Ga0207640_10164533 3300025981 Unclassified 1646
385 Ga0207640_10308653 3300025981 Bacteria 1255
386 Ga0207640_11266736 3300025981 Unclassified 657
387 Ga0207640_11322983 3300025981 Unclassified 644
388 Ga0207658_10028472 3300025986 Bacteria 3934
389 Ga0207658_10132444 3300025986 Bacteria 2005
390 Ga0207658_10565340 3300025986 Bacteria 1019
391 Ga0207677_10008110 3300026023 Bacteria 5847
392 Ga0207677_10137810 3300026023 Unclassified 1863
393 Ga0207703_10137831 3300026035 Bacteria 2114
394 Ga0207703_10499730 3300026035 Bacteria 1141
395 Ga0207639_10343492 3300026041 Bacteria 1331
396 Ga0207678_10106708 3300026067 Bacteria 2389
397 Ga0207708_10012732 3300026075 Bacteria 6273
398 Ga0207708_10018498 3300026075 Bacteria 5248
399 Ga0207708_10900615 3300026075 Unclassified 766
400 Ga0207708_10968082 3300026075 Bacteria 738
401 Ga0207641_10128683 3300026088 Bacteria 2271
402 Ga0207648_10041970 3300026089 Bacteria 4017
403 Ga0207648_10043431 3300026089 Bacteria 3946
404 Ga0207648_10120916 3300026089 Bacteria 2303
405 Ga0207648_10188792 3300026089 Bacteria 1826
406 Ga0207648_10323121 3300026089 Bacteria 1387
407 Ga0207648_10348447 3300026089 Bacteria 1335
408 Ga0207648_10694171 3300026089 Bacteria 943
409 Ga0207676_10049559 3300026095 Bacteria 3268
410 Ga0207676_10925221 3300026095 Unclassified 856
411 Ga0207674_10212995 3300026116 Unclassified 1881
412 Ga0207674_10354459 3300026116 Bacteria 1418
413 Ga0207674_11000330 3300026116 Unclassified 805
414 Ga0207675_100017515 3300026118 Bacteria 6686
415 Ga0207675_100033139 3300026118 Bacteria 4813
416 Ga0207675_100041704 3300026118 Bacteria 4285
417 Ga0207675_100133970 3300026118 Bacteria 2350
418 Ga0207675_100271002 3300026118 Unclassified 1647
419 Ga0207683_10015294 3300026121 Bacteria 6532
420 Ga0207683_10046772 3300026121 Bacteria 3788
421 Ga0207683_10060332 3300026121 Bacteria 3334
422 Ga0207683_10095263 3300026121 Bacteria 2654
423 Ga0207683_10102560 3300026121 Bacteria 2555
424 Ga0207683_10782008 3300026121 Bacteria 886
425 Ga0207698_10407949 3300026142 Bacteria 1300
426 Ga0207698_10477326 3300026142 Unclassified 1209
427 Ga0209998_10044324 3300027717 Bacteria 1016
428 Ga0207428_10000756 3300027907 Bacteria 36837
429 Ga0207428_10011871 3300027907 Bacteria 7677
430 Ga0268266_10016068 3300028379 Bacteria 6398
431 Ga0268265_10028682 3300028380 Bacteria 3988
432 Ga0268265_10225239 3300028380 Bacteria 1644
433 Ga0268265_10703603 3300028380 Unclassified 976
434 Ga0268264_10102491 3300028381 Unclassified 2490
435 Ga0268264_10515679 3300028381 Bacteria 1168
436 Ga0268264_11825879 3300028381 Bacteria 618
437 Ga0307408_101437538 3300031548 Unclassified 650
438 Ga0307405_10085171 3300031731 Unclassified 2077
439 Ga0307412_10795605 3300031911 Archaea 820
440 Ga0307416_101281429 3300032002 Unclassified 839
441 Ga0307411_11810243 3300032005 Unclassified 567
442 Ga0373951_0225979 3300035091 Unclassified 554
443 Ga0373945_0355411 3300035116 Bacteria 636
444 Ga0373957_0177684 3300035120 Unclassified 881
445 Ga0373955_1056159 3300035172 Unclassified 500
446 Ga0373962_0020002 3300035242 Bacteria 1755
447 Ga0373931_0260452 3300035691 Unclassified 1058
448 Ga0373933_0220427 3300035724 Unclassified 1217
449 Ga0373937_0181885 3300036401 Unclassified 1974
450 Ga0373937_0465443 3300036401 Unclassified 1201
451 Ga0373937_0851367 3300036401 Bacteria 860
452 Ga0451576_0101959 3300045051 Bacteria 2985
453 Ga0451576_0180265 3300045051 Unclassified 2205
454 Ga0495629_0180574 3300046459 Bacteria 1463
455 Ga0495629_1007598 3300046459 Unclassified 542
456 Ga0495651_0153228 3300046462 Unclassified 1659
457 Ga0495582_0386053 3300046473 Unclassified 807
458 Ga0495639_0477564 3300046475 Unclassified 635
459 Ga0495662_0501354 3300046476 Unclassified 595
460 Ga0495608_0398501 3300046511 Unclassified 842
461 Ga0495630_0731758 3300046517 Unclassified 756
462 Ga0495640_0169600 3300046533 Bacteria 1395
463 Ga0495586_0222899 3300046535 Bacteria 1072
464 Ga0495598_0184340 3300046537 Unclassified 746
465 Ga0495598_0192607 3300046537 Unclassified 733
466 Ga0495621_0097546 3300046539 Unclassified 1115
467 Ga0495645_0001657 3300046543 Bacteria 15125
468 Ga0495645_0619090 3300046543 Bacteria 664
469 Ga0495667_0295183 3300046559 Bacteria 1027
470 Ga0495635_0582796 3300046663 Unclassified 731
471 Ga0495657_0263138 3300046675 Bacteria 1036
472 Ga0495623_0258955 3300046679 Bacteria 975
473 Ga0495658_0075145 3300046683 Unclassified 1971
474 Ga0495658_0567963 3300046683 Unclassified 726
475 Ga0495613_0097567 3300046689 Bacteria 2124
476 Ga0495600_0209489 3300046809 Bacteria 1250
477 Ga0495600_0253228 3300046809 Unclassified 1120
478 Ga0495600_0753034 3300046809 Unclassified 583
479 Ga0495684_0418349 3300047471 Unclassified 937
480 Ga0495602_0125615 3300048088 Unclassified 2056
481 Ga0495602_0611648 3300048088 Bacteria 748
482 Ga0496102_0636343 3300048905 Bacteria 990
483 Ga0496106_0278152 3300048909 Bacteria 1341
484 Ga0496112_0794872 3300048915 Bacteria 871
485 Ga0496113_1151721 3300048916 Unclassified 607
486 Ga0496114_0125267 3300048917 Bacteria 2214
487 Ga0501039_0650455 3300049575 Unclassified 825
488 Ga0501039_1348709 3300049575 Unclassified 550
489 nmdc:mga05p37_117687_c1 3300050507 Bacteria 3265
490 nmdc:mga05p37_190049_c1 3300050507 Unclassified 2494
491 nmdc:mga05p37_320406_c1 3300050507 Bacteria 1835
492 nmdc:mga05p37_321689_c1 3300050507 Bacteria 1831
493 nmdc:mga05p37_496987_c1 3300050507 Bacteria 1401
494 nmdc:mga05p37_66516_c1 3300050507 Unclassified 4433
495 nmdc:mga09592_419396_c1 3300050508 Bacteria 1156
496 nmdc:mga09592_846_c1 3300050508 Bacteria 23790
497 nmdc:mga09592_97533_c1 3300050508 Bacteria 2515
498 nmdc:mga0qj67_137991_c1 3300050509 Bacteria 1976
499 nmdc:mga0qj67_874522_c1 3300050509 Unclassified 709
500 nmdc:mga0qj67_9598_c1 3300050509 Bacteria 7213
501 nmdc:mga06r32_1713672_c1 3300050510 Unclassified 565
502 nmdc:mga06r32_2905_c1 3300050510 Bacteria 15383
503 nmdc:mga06r32_487920_c1 3300050510 Bacteria 1210
504 nmdc:mga06r32_60325_c1 3300050510 Unclassified 3650
505 nmdc:mga08y16_1645831_c1 3300050511 Unclassified 599
506 nmdc:mga08y16_40972_c1 3300050511 Bacteria 4852
507 nmdc:mga08y16_546476_c1 3300050511 Unclassified 1173
508 nmdc:mga08y16_639765_c1 3300050511 Unclassified 1069
509 nmdc:mga0rr50_4311_c1 3300050513 Bacteria 8333
510 nmdc:mga0a205_557267_c1 3300050515 Unclassified 1001
511 nmdc:mga0a205_699435_c1 3300050515 Unclassified 863
512 nmdc:mga0a205_9233_c1 3300050515 Bacteria 9004
513 Ga0495601_0081501 3300053077 Bacteria 2077
514 Ga0495601_0828149 3300053077 Unclassified 587
515 Ga0495619_0476769 3300053085 Unclassified 859
516 Ga0495619_0620804 3300053085 Bacteria 739
517 Ga0530510_0356123 3300061734 Unclassified 1099
518 Ga0075431_100127570
519 JGI24746J21847_1001312
520 JGI24746J21847_1002613
521 Ga0058858_1005683
522 Ga0058859_10048081
523 Ga0058859_10149588
524 Ga0058863_11585132
525 Ga0058861_11571377
526 Ga0058860_10022220
527 Ga0058860_10053229
528 Ga0058862_12453398
529 Ga0065714_10220421
530 Ga0065704_10016305
531 Ga0065712_10075103
532 Ga0065715_10005596
533 Ga0065715_10015619
534 Ga0065707_10107319
535 Ga0070676_10030575
536 Ga0070676_10251979
537 Ga0070690_100034739
538 Ga0070690_100344428
539 Ga0070690_100386022
540 Ga0070690_100624753
541 Ga0070670_100027457
542 Ga0070670_100524462
543 Ga0070677_10002043
544 Ga0068869_100022580
545 Ga0068869_100581971
546 Ga0068869_100844820
547 Ga0070666_10022675
548 Ga0070666_10024365
549 Ga0070666_10061675
550 Ga0070666_10464009
551 Ga0070680_100185805
552 Ga0070682_101593705
553 Ga0068868_100005008
554 Ga0068868_100692090
555 Ga0068868_100740755
556 Ga0068868_101367219
557 Ga0070660_100092732
558 Ga0070689_100011003
559 Ga0070689_100223079
560 Ga0070689_101409300
561 Ga0070691_10056615
562 Ga0070687_100069810
563 Ga0070687_100517974
564 Ga0070661_100447155
565 Ga0070692_10217560
566 Ga0070668_100021463
567 Ga0070668_100136423
568 Ga0070668_100267029
569 Ga0070668_100281075
570 Ga0070669_100014191
571 Ga0070669_100034057
572 Ga0070669_100066128
573 Ga0070669_100505832
574 Ga0070669_100531192
575 Ga0070675_100103252
576 Ga0070675_100106234
577 Ga0070675_100546990
578 Ga0070675_100810511
579 Ga0070675_101263429
580 Ga0070671_100043604
581 Ga0070671_100236615
582 Ga0070671_100297880
583 Ga0070674_100000340
584 Ga0070674_100005172
585 Ga0070674_100028790
586 Ga0070674_100160749
587 Ga0070674_100251126
588 Ga0070674_100260449
589 Ga0070674_100833626
590 Ga0070673_100004440
591 Ga0070673_100033322
592 Ga0070673_100212588
593 Ga0070673_100282895
594 Ga0070673_100839785
595 Ga0070673_101324464
596 Ga0070688_100030176
597 Ga0070688_100069592
598 Ga0070688_100581882
599 Ga0070688_100945130
600 Ga0070659_100020998
601 Ga0070659_100270540
602 Ga0070667_101492398
603 Ga0070701_10028383
604 Ga0070705_100139289
605 Ga0070705_101220641
606 Ga0070700_100025700
607 Ga0070700_100046806
608 Ga0070700_100382011
609 Ga0070700_100925463
610 Ga0070694_100008069
611 Ga0070694_100059878
612 Ga0070694_100568315
613 Ga0070678_100118169
614 Ga0070678_100140738
615 Ga0070678_100387452
616 Ga0070678_101042794
617 Ga0070662_100015764
618 Ga0070662_100033661
619 Ga0070662_100174242
620 Ga0068867_100033380
621 Ga0068867_100041530
622 Ga0068867_100329902
623 Ga0068867_100713090
624 Ga0068867_100748108
625 Ga0068867_101039409
626 Ga0068867_101113372
627 Ga0068867_101326798
628 Ga0070685_10009649
629 Ga0070685_11490782
630 Ga0070707_100474158
631 Ga0070707_101199032
632 Ga0070698_100064413
633 Ga0070698_100343059
634 Ga0070698_100938117
635 Ga0070697_100143961
636 Ga0068853_100128017
637 Ga0070672_100011676
638 Ga0070672_100156408
639 Ga0070672_100302813
640 Ga0070672_100306144
641 Ga0070672_101222405
642 Ga0070686_100002629
643 Ga0070686_100035340
644 Ga0070686_100370663
645 Ga0070695_100004722
646 Ga0070695_100077708
647 Ga0070695_100680717
648 Ga0070696_100082340
649 Ga0070696_100089082
650 Ga0070696_101287884
651 Ga0070665_100004399
652 Ga0070665_100329403
653 Ga0070704_100006011
654 Ga0070704_100008424
655 Ga0070704_100030680
656 Ga0070704_100530656
657 Ga0068855_100089469
658 Ga0070664_100005370
659 Ga0070664_101009527
660 Ga0068857_100945582
661 Ga0068854_100154708
662 Ga0068854_101362966
663 Ga0068856_100023416
664 Ga0068856_101467189
665 Ga0070702_100022187
666 Ga0070702_100545500
667 Ga0068852_100607772
668 Ga0068852_100988392
669 Ga0068859_100054697
670 Ga0068859_100102690
671 Ga0068859_100344096
672 Ga0068859_101017937
673 Ga0068864_101046898
674 Ga0068864_101076909
675 Ga0068864_102087027
676 Ga0068866_10025373
677 Ga0068866_10245084
678 Ga0068866_10255504
679 Ga0068861_100041305
680 Ga0068861_100044561
681 Ga0068861_100051474
682 Ga0068861_100113667
683 Ga0068861_100254293
684 Ga0068851_10273477
685 Ga0068870_10010727
686 Ga0068870_10059173
687 Ga0068870_10679956
688 Ga0068863_100031429
689 Ga0068863_100184208
690 Ga0068863_100807471
691 Ga0068858_100021954
692 Ga0068858_100542184
693 Ga0068860_100071370
694 Ga0068860_100618046
695 Ga0068860_101025584
696 Ga0068862_100001025
697 Ga0068862_100092746
698 Ga0068862_100663820
699 Ga0075432_10041431
700 Ga0097621_100140778
701 Ga0097621_100219352
702 Ga0068871_100003652
703 Ga0068871_100164605
704 Ga0068871_100321035
705 Ga0075428_100002841
706 Ga0075428_100482149
707 Ga0075430_100008036
708 Ga0075430_100743289
709 Ga0075430_101736434
710 Ga0075431_100015089
711 Ga0075431_100024715
712 Ga0075433_10000251
713 Ga0075433_10110597
714 Ga0075434_101053730
715 Ga0075429_100002679
716 Ga0075429_100095158
717 Ga0075429_100793854
718 Ga0068865_100017265
719 Ga0068865_100128294
720 Ga0068865_100205093
721 Ga0068865_100328685
722 Ga0068865_100444472
723 Ga0068865_101080579
724 Ga0068865_101098838
725 Ga0097620_100054698
726 Ga0097620_100102699
727 Ga0097620_100344122
728 Ga0075435_100005384
729 Ga0105244_10313640
730 Ga0111539_10007388
731 Ga0111539_10029221
732 Ga0111539_10252422
733 Ga0111539_10452835
734 Ga0111539_12687518
735 Ga0105245_10062744
736 Ga0105245_10450959
737 Ga0105245_10456654
738 Ga0105245_11143049
739 Ga0105245_11491490
740 Ga0114129_10045968
741 Ga0114129_10144569
742 Ga0114129_10261631
743 Ga0105243_10009369
744 Ga0105243_10013525
745 Ga0105243_10217373
746 Ga0105241_10088815
747 Ga0105241_10692365
748 Ga0105241_11592929
749 Ga0105241_11607918
750 Ga0105242_10014788
751 Ga0105242_10193348
752 Ga0105242_10390836
753 Ga0105242_10873550
754 Ga0105242_11767464
755 Ga0105242_11992969
756 Ga0105248_10025687
757 Ga0105248_10052335
758 Ga0105248_10429393
759 Ga0105248_10777208
760 Ga0105248_11009221
761 Ga0105237_10458440
762 Ga0105238_10001003
763 Ga0105238_10023405
764 Ga0105238_10027537
765 Ga0105238_10285325
766 Ga0105249_10019650
767 Ga0105249_10678212
768 Ga0105249_11129831
769 Ga0105239_10036243
770 Ga0105246_10401554
771 Ga0105246_10526675
772 Ga0157345_1023981
773 Ga0157371_10278883
774 Ga0157370_10189485
775 Ga0157374_10071768
776 Ga0163162_10011337
777 Ga0163162_10019939
778 Ga0157372_11382143
779 Ga0157375_10206991
780 Ga0157375_10345954
781 Ga0157375_10563765
782 Ga0157375_10699598
783 Ga0157375_12941659
784 Ga0163163_10113299
785 Ga0163163_10218742
786 Ga0163163_10735689
787 Ga0157380_10035582
788 Ga0157380_10044593
789 Ga0157380_10109531
790 Ga0157380_10204655
791 Ga0157380_10890068
792 Ga0157380_11228390
793 Ga0157377_10020704
794 Ga0157377_10068383
795 Ga0157379_10086884
796 Ga0157376_10071990
797 Ga0157376_10119935
798 Ga0163161_10038785
799 Ga0163161_10111626
800 Ga0197907_10576538
801 Ga0206356_11497013
802 Ga0206351_10087305
803 Ga0206354_10385089
804 Ga0206353_10802145
805 Ga0207697_10000815
806 Ga0207697_10025804
807 Ga0207697_10107159
808 Ga0207682_10001377
809 Ga0207682_10196315
810 Ga0207682_10566438
811 Ga0207642_10019618
812 Ga0207642_10031176
813 Ga0207688_10039666
814 Ga0207680_10459886
815 Ga0207647_10092929
816 Ga0207645_10002151
817 Ga0207645_10027858
818 Ga0207645_10128275
819 Ga0207645_10183890
820 Ga0207645_10201849
821 Ga0207645_10638755
822 Ga0207643_10000847
823 Ga0207643_10050557
824 Ga0207654_10049026
825 Ga0207695_10074839
826 Ga0207695_10250337
827 Ga0207671_10178396
828 Ga0207662_10108653
829 Ga0207646_10223387
830 Ga0207646_10601100
831 Ga0207681_10014985
832 Ga0207681_10021666
833 Ga0207681_10156615
834 Ga0207681_11020677
835 Ga0207681_11433359
836 Ga0207694_10154197
837 Ga0207694_10365440
838 Ga0207650_10287977
839 Ga0207659_10013636
840 Ga0207659_10027447
841 Ga0207659_10046685
842 Ga0207659_10245530
843 Ga0207659_10265466
844 Ga0207687_10061633
845 Ga0207644_10059518
846 Ga0207644_10182674
847 Ga0207690_10248329
848 Ga0207706_10016778
849 Ga0207706_10113135
850 Ga0207706_10139232
851 Ga0207686_10218583
852 Ga0207686_10485065
853 Ga0207686_10601928
854 Ga0207686_10825006
855 Ga0207686_10987462
856 Ga0207709_10026175
857 Ga0207709_10030002
858 Ga0207709_10227474
859 Ga0207670_10813962
860 Ga0207670_11328196
861 Ga0207669_10000948
862 Ga0207669_10203087
863 Ga0207669_10664801
864 Ga0207669_11621699
865 Ga0207704_10034365
866 Ga0207704_10228646
867 Ga0207704_10540084
868 Ga0207704_10710071
869 Ga0207704_10905846
870 Ga0207691_10003859
871 Ga0207691_10010942
872 Ga0207691_10046338
873 Ga0207691_10241358
874 Ga0207691_10659736
875 Ga0207711_10301811
876 Ga0207711_10429249
877 Ga0207711_10549836
878 Ga0207711_10808399
879 Ga0207711_10836037
880 Ga0207689_10003934
881 Ga0207689_10069180
882 Ga0207689_10539658
883 Ga0207679_10003089
884 Ga0207679_10593911
885 Ga0207679_10908079
886 Ga0207667_10201869
887 Ga0207651_10037684
888 Ga0207651_10048279
889 Ga0207651_10238017
890 Ga0207651_10533286
891 Ga0207651_10564192
892 Ga0207651_10990265
893 Ga0207712_10012851
894 Ga0207712_10517109
895 Ga0207712_10751646
896 Ga0207668_10085313
897 Ga0207668_10256621
898 Ga0207668_10452241
899 Ga0207668_10664365
900 Ga0207668_11465865
901 Ga0207640_10164533
902 Ga0207640_10308653
903 Ga0207640_11266736
904 Ga0207640_11322983
905 Ga0207658_10028472
906 Ga0207658_10132444
907 Ga0207658_10565340
908 Ga0207677_10008110
909 Ga0207677_10137810
910 Ga0207703_10137831
911 Ga0207703_10499730
912 Ga0207639_10343492
913 Ga0207678_10106708
914 Ga0207708_10012732
915 Ga0207708_10018498
916 Ga0207708_10900615
917 Ga0207708_10968082
918 Ga0207641_10128683
919 Ga0207648_10041970
920 Ga0207648_10043431
921 Ga0207648_10120916
922 Ga0207648_10188792
923 Ga0207648_10323121
924 Ga0207648_10348447
925 Ga0207648_10694171
926 Ga0207676_10049559
927 Ga0207676_10925221
928 Ga0207674_10212995
929 Ga0207674_10354459
930 Ga0207674_11000330
931 Ga0207675_100017515
932 Ga0207675_100033139
933 Ga0207675_100041704
934 Ga0207675_100133970
935 Ga0207675_100271002
936 Ga0207683_10015294
937 Ga0207683_10046772
938 Ga0207683_10060332
939 Ga0207683_10095263
940 Ga0207683_10102560
941 Ga0207683_10782008
942 Ga0207698_10407949
943 Ga0207698_10477326
944 Ga0209998_10044324
945 Ga0207428_10000756
946 Ga0207428_10011871
947 Ga0268266_10016068
948 Ga0268265_10028682
949 Ga0268265_10225239
950 Ga0268265_10703603
951 Ga0268264_10102491
952 Ga0268264_10515679
953 Ga0268264_11825879
954 Ga0307408_101437538
955 Ga0307405_10085171
956 Ga0307412_10795605
957 Ga0307416_101281429
958 Ga0307411_11810243
959 Ga0373951_0225979
960 Ga0373945_0355411
961 Ga0373957_0177684
962 Ga0373955_1056159
963 Ga0373962_0020002
964 Ga0373931_0260452
965 Ga0373933_0220427
966 Ga0373937_0181885
967 Ga0373937_0465443
968 Ga0373937_0851367
969 Ga0451576_0101959
970 Ga0451576_0180265
971 Ga0495629_0180574
972 Ga0495629_1007598
973 Ga0495651_0153228
974 Ga0495582_0386053
975 Ga0495639_0477564
976 Ga0495662_0501354
977 Ga0495608_0398501
978 Ga0495630_0731758
979 Ga0495640_0169600
980 Ga0495586_0222899
981 Ga0495598_0184340
982 Ga0495598_0192607
983 Ga0495621_0097546
984 Ga0495645_0001657
985 Ga0495645_0619090
986 Ga0495667_0295183
987 Ga0495635_0582796
988 Ga0495657_0263138
989 Ga0495623_0258955
990 Ga0495658_0075145
991 Ga0495658_0567963
992 Ga0495613_0097567
993 Ga0495600_0209489
994 Ga0495600_0253228
995 Ga0495600_0753034
996 Ga0495684_0418349
997 Ga0495602_0125615
998 Ga0495602_0611648
999 Ga0496102_0636343
1000 Ga0496106_0278152
1001 Ga0496112_0794872
1002 Ga0496113_1151721
1003 Ga0496114_0125267
1004 Ga0501039_0650455
1005 Ga0501039_1348709
1006 nmdc:mga05p37_117687_c1
1007 nmdc:mga05p37_190049_c1
1008 nmdc:mga05p37_320406_c1
1009 nmdc:mga05p37_321689_c1
1010 nmdc:mga05p37_496987_c1
1011 nmdc:mga05p37_66516_c1
1012 nmdc:mga09592_419396_c1
1013 nmdc:mga09592_846_c1
1014 nmdc:mga09592_97533_c1
1015 nmdc:mga0qj67_137991_c1
1016 nmdc:mga0qj67_874522_c1
1017 nmdc:mga0qj67_9598_c1
1018 nmdc:mga06r32_1713672_c1
1019 nmdc:mga06r32_2905_c1
1020 nmdc:mga06r32_487920_c1
1021 nmdc:mga06r32_60325_c1
1022 nmdc:mga08y16_1645831_c1
1023 nmdc:mga08y16_40972_c1
1024 nmdc:mga08y16_546476_c1
1025 nmdc:mga08y16_639765_c1
1026 nmdc:mga0rr50_4311_c1
1027 nmdc:mga0a205_557267_c1
1028 nmdc:mga0a205_699435_c1
1029 nmdc:mga0a205_9233_c1
1030 Ga0495601_0081501
1031 Ga0495601_0828149
1032 Ga0495619_0476769
1033 Ga0495619_0620804
1034 Ga0530510_0356123

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

22

121

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.7884 39 73
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.7734 38 73
8foe-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex bound to a template dna 0.7725 38 73
4fvm-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha 0.7725 38 73
3i36-assembly1.cif.gz_A crystal structure of rat protein tyrosine phosphatase eta catalytic domain 0.7658 43 76
ID Description Score Start End Superfamily
af_Q64512_2131_2444_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.809 43 76 3.90.190.10
af_A0A286YB50_546_838_3.90.190.10 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8049 43 73 3.90.190.10
af_F4I201_85_164_3.10.450.10 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7776 37 75 3.10.450.10
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7615 36 120 2.40.50.140
3amuA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7591 31 118 2.40.50.1010
ID Description Score Start End GO Terms
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9848 31 128
AF-A0A2E2HBI4-F1-model_v4 Uncharacterized protein 0.9666 31 117
AF-A0A4Q6B4C5-F1-model_v4 Uncharacterized protein 0.9633 31 130
AF-A0A2W4Q999-F1-model_v4 DUF5666 domain-containing protein 0.9597 31 129
AF-A0A2V8DL04-F1-model_v4 DUF5666 domain-containing protein 0.9587 37 137

Map