F458197

General Info

Members Datasets Scaffolds Average Seq Length
517 285 1034 195

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2997451912|2997456817
Length 194
Sequence LIVVDVQNDFCEGGSLAVAGGADVAAAITDLVGQAAGGCYRHVVATRDHHVDPGDHFSDRPDYVHSWPPHCVAGTEGSSFHPNFAPAVASGAIDAVFDKGAHTAAYSGFEGRDENGTPLADWLRERDVTEVDVVGIATDHCVRATALDALGSGLRTHVLLDLTAGVAPDTTERALEELRAAGAELTGKPVLVGG

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
6 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
7 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
10 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
11 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
12 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
13 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
17 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
18 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
19 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
20 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
21 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
31 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
35 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
36 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
37 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
38 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
39 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
40 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
41 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
42 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
43 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
44 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
45 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
46 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
47 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
48 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
49 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
50 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
51 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
52 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
53 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
54 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
55 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
56 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
57 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
58 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
61 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
62 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
63 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
64 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
65 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
66 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
67 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
68 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
71 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
72 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
73 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
74 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
75 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
81 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
82 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
83 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
84 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
85 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
86 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
87 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
88 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
89 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
90 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
91 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
92 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
93 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
94 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
100 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
104 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
112 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
113 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
116 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
117 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
118 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
119 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
122 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
123 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
124 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
125 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
126 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
127 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
128 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
133 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
140 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
145 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
146 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
147 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
148 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
149 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
150 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
153 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
183 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
184 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
187 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
188 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
189 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
190 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
191 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
192 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
193 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
194 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
195 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
196 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
198 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
199 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
200 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
201 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
202 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
203 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
204 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
205 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
209 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
210 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
211 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
212 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
213 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
214 2643221548 Streptomyces sp. Root55 Isolate Unclassified
215 2643221578 Streptomyces sp. Root63 Isolate Unclassified
216 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
217 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
218 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
219 2643221647 Streptomyces sp. Root369 Isolate Unclassified
220 2643221670 Streptomyces sp. Root431 Isolate Unclassified
221 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
222 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
223 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
224 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
225 2643221714 Streptomyces sp. Root264 Isolate Unclassified
226 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
227 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
228 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
229 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
230 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
231 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
232 2808606448 Streptomyces sp. 193411 Isolate Unclassified
233 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
234 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
235 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
236 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
237 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
238 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
239 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
240 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
241 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
242 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
243 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
244 2867369537 Streptomyces sp. Z26 Isolate Unclassified
245 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
246 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
247 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
248 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
249 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
250 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
251 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
252 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
253 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
254 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
255 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
256 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
257 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
258 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
259 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
260 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
261 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
262 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
263 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
264 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
265 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
266 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
267 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
268 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
269 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
270 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
271 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
272 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
273 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
274 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
275 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
276 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
277 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
278 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
279 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
280 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
281 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
282 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
283 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
284 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
285 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.14
Metatranscriptomes 0.77
Isolates 15.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.22
Nodule 0
Rhizoplane 1.16
Rhizosphere 79.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10028943 3300003316 Bacteria 7854
2 rootH2_10053788 3300003320 Bacteria 4998
3 Ga0006562J51391_1115016 3300003578 Bacteria 3440
4 Ga0006562J51391_1115018 3300003578 Bacteria 2817
5 Ga0006562J51391_1168946 3300003578 Bacteria 2450
6 Ga0006562J51391_1168947 3300003578 Bacteria 1240
7 Ga0070682_101006389 3300005337 Bacteria 692
8 Ga0070667_100746702 3300005367 Bacteria 907
9 Ga0070681_10272196 3300005458 Bacteria 1605
10 Ga0070693_100294202 3300005547 Bacteria 1092
11 Ga0070665_100855364 3300005548 Bacteria 923
12 Ga0068861_100006980 3300005719 Bacteria 7716
13 Ga0075365_10491956 3300006038 Bacteria 867
14 Ga0075368_10011078 3300006042 Bacteria 3276
15 Ga0075367_10037671 3300006178 Bacteria 2811
16 Ga0105250_10330178 3300009092 Bacteria 664
17 Ga0105245_10864548 3300009098 Bacteria 945
18 Ga0105243_10721868 3300009148 Bacteria 974
19 Ga0105243_11188202 3300009148 Bacteria 775
20 Ga0105248_10416811 3300009177 Bacteria 1512
21 Ga0105246_10004139 3300011119 Bacteria 8808
22 Ga0105246_10619996 3300011119 Bacteria 937
23 Ga0157372_10293802 3300013307 Bacteria 1890
24 Ga0182006_1088540 3300015261 Bacteria 1117
25 Ga0182007_10000422 3300015262 Bacteria 25872
26 Ga0213875_10012115 3300021388 Bacteria 4265
27 Ga0207647_10138724 3300025904 Bacteria 1426
28 Ga0207685_10449786 3300025905 Bacteria 669
29 Ga0207667_11418832 3300025949 Bacteria 667
30 Ga0207678_10711040 3300026067 Bacteria 884
31 Ga0207678_11090333 3300026067 Bacteria 707
32 Ga0207702_10446822 3300026078 Bacteria 1254
33 Ga0207702_10722354 3300026078 Bacteria 982
34 Ga0207674_10626056 3300026116 Bacteria 1039
35 Ga0207675_100071182 3300026118 Bacteria 3251
36 Ga0209371_1010316 3300027312 Bacteria 2887
37 Ga0209813_10027533 3300027866 Bacteria 1651
38 Ga0268266_10128872 3300028379 Bacteria 2261
39 Ga0268265_10031639 3300028380 Bacteria 3823
40 Ga0268264_10168855 3300028381 Bacteria 1977
41 Ga0307517_10007378 3300028786 Bacteria 16037
42 Ga0307517_10020930 3300028786 Bacteria 8299
43 Ga0307515_10002412 3300028794 Bacteria 40757
44 Ga0307515_10162002 3300028794 Bacteria 2276
45 Ga0268256_1007296 3300030500 Bacteria 3965
46 Ga0307511_10001229 3300030521 Bacteria 27154
47 Ga0307512_10003613 3300030522 Bacteria 17685
48 Ga0307513_10038933 3300031456 Bacteria 5275
49 Ga0307513_10144811 3300031456 Bacteria 2296
50 Ga0307509_10025220 3300031507 Bacteria 6644
51 Ga0307508_10006984 3300031616 Bacteria 10526
52 Ga0307508_10035817 3300031616 Bacteria 4471
53 Ga0307508_10161542 3300031616 Bacteria 1843
54 Ga0307508_10198182 3300031616 Bacteria 1609
55 Ga0307514_10006992 3300031649 Bacteria 9749
56 Ga0307514_10052719 3300031649 Bacteria 3143
57 Ga0307514_10118353 3300031649 Bacteria 1856
58 Ga0307516_10005616 3300031730 Bacteria 14931
59 Ga0307516_10027532 3300031730 Bacteria 5764
60 Ga0307516_10070621 3300031730 Bacteria 3355
61 Ga0307516_10193957 3300031730 Bacteria 1755
62 Ga0307413_10361754 3300031824 Bacteria 1124
63 Ga0307518_10150026 3300031838 Bacteria 1614
64 Ga0307518_10172677 3300031838 Bacteria 1471
65 Ga0307412_10370582 3300031911 Bacteria 1156
66 Ga0307416_101266113 3300032002 Bacteria 843
67 Ga0307507_10033782 3300033179 Bacteria 5302
68 Ga0307507_10071410 3300033179 Bacteria 3140
69 Ga0307507_10230652 3300033179 Bacteria 1228
70 Ga0307510_10047137 3300033180 Bacteria 4622
71 Ga0307510_10069166 3300033180 Bacteria 3537
72 Ga0395898_0002383 3300037466 Bacteria 22305
73 Ga0395898_0035107 3300037466 Bacteria 4990
74 Ga0436364_0550711 3300037853 Bacteria 9638
75 Ga0395901_0050250 3300038443 Bacteria 4333
76 Ga0439436_0001068 3300041404 Bacteria 7723
77 Ga0439436_0024823 3300041404 Bacteria 1766
78 Ga0439439_0005769 3300041406 Bacteria 2842
79 Ga0439439_0084063 3300041406 Bacteria 863
80 Ga0451841_0139026 3300041498 Bacteria 1318
81 Ga0451853_0268200 3300041512 Bacteria 894
82 Ga0451853_1315420 3300041512 Bacteria 6766
83 Ga0439433_0035667 3300041999 Bacteria 1147
84 Ga0439448_0007453 3300042005 Bacteria 3174
85 Ga0439449_0001333 3300042007 Bacteria 9666
86 Ga0439449_0040284 3300042007 Bacteria 1736
87 Ga0439457_000094 3300042014 Bacteria 20434
88 Ga0439457_000214 3300042014 Bacteria 15415
89 Ga0439462_0003811 3300042015 Bacteria 3638
90 Ga0450890_004020 3300042127 Bacteria 1934
91 Ga0450894_016355 3300042131 Bacteria 985
92 Ga0450902_026398 3300042137 Bacteria 971
93 Ga0450903_000218 3300042138 Bacteria 12768
94 Ga0450903_041425 3300042138 Bacteria 681
95 Ga0439458_0001942 3300042157 Bacteria 5128
96 Ga0466969_0001841 3300044656 Bacteria 11336
97 Ga0466969_0022167 3300044656 Bacteria 3281
98 Ga0466969_0155527 3300044656 Bacteria 1052
99 Ga0466972_0008629 3300044658 Bacteria 5113
100 Ga0466972_0132349 3300044658 Bacteria 1174
101 Ga0466972_0278828 3300044658 Bacteria 781
102 Ga0466965_0001830 3300044683 Bacteria 8843
103 Ga0466965_0067338 3300044683 Bacteria 1797
104 Ga0466965_0118377 3300044683 Bacteria 1366
105 Ga0466965_0250620 3300044683 Bacteria 950
106 Ga0466965_0547636 3300044683 Bacteria 653
107 Ga0466966_0201421 3300044684 Bacteria 1204
108 Ga0466961_0000293 3300044693 Bacteria 33169
109 Ga0466961_0019122 3300044693 Bacteria 4407
110 Ga0466961_0043032 3300044693 Bacteria 2893
111 Ga0466961_0047485 3300044693 Bacteria 2745
112 Ga0466961_0111583 3300044693 Bacteria 1720
113 Ga0466961_0194189 3300044693 Bacteria 1257
114 Ga0466963_0037374 3300044694 Bacteria 3170
115 Ga0466963_0261344 3300044694 Bacteria 1215
116 Ga0466964_0189472 3300044706 Bacteria 980
117 Ga0466971_0002061 3300044719 Bacteria 8512
118 Ga0466971_0018011 3300044719 Bacteria 3128
119 Ga0466968_0279821 3300044735 Bacteria 798
120 Ga0466970_0000816 3300044765 Bacteria 14971
121 Ga0466970_0006802 3300044765 Bacteria 5724
122 Ga0466970_0159383 3300044765 Bacteria 1248
123 Ga0466957_0033753 3300044842 Bacteria 3070
124 Ga0466960_0002414 3300044901 Bacteria 7044
125 Ga0466959_0011485 3300045049 Bacteria 6366
126 Ga0466959_0039135 3300045049 Bacteria 3504
127 Ga0466959_0054698 3300045049 Bacteria 2915
128 Ga0466967_0247131 3300045976 Bacteria 1703
129 Ga0466967_0275655 3300045976 Bacteria 1613
130 Ga0466967_1661175 3300045976 Bacteria 636
131 Ga0495592_0005623 3300046454 Bacteria 9267
132 Ga0495592_0010408 3300046454 Bacteria 7017
133 Ga0495592_0029979 3300046454 Bacteria 4115
134 Ga0495592_0051735 3300046454 Bacteria 3050
135 Ga0495603_0007810 3300046455 Bacteria 6448
136 Ga0495603_0010747 3300046455 Bacteria 5552
137 Ga0495603_0395106 3300046455 Bacteria 792
138 Ga0495590_0037373 3300046457 Bacteria 1693
139 Ga0495629_0001923 3300046459 Bacteria 16192
140 Ga0495629_0019960 3300046459 Bacteria 4782
141 Ga0495629_0029253 3300046459 Bacteria 3908
142 Ga0495629_0048938 3300046459 Bacteria 2963
143 Ga0495629_0069111 3300046459 Bacteria 2465
144 Ga0495629_0070567 3300046459 Bacteria 2437
145 Ga0495629_0232927 3300046459 Bacteria 1269
146 Ga0495638_0288784 3300046460 Bacteria 888
147 Ga0495638_0392531 3300046460 Bacteria 722
148 Ga0495651_0007543 3300046462 Bacteria 8322
149 Ga0495651_0034069 3300046462 Bacteria 3970
150 Ga0495651_0159324 3300046462 Bacteria 1618
151 Ga0495580_0013658 3300046472 Bacteria 6190
152 Ga0495580_0212871 3300046472 Bacteria 1329
153 Ga0495582_0023793 3300046473 Bacteria 3349
154 Ga0495582_0045277 3300046473 Bacteria 2423
155 Ga0495605_0032583 3300046474 Bacteria 2652
156 Ga0495662_0000170 3300046476 Bacteria 25828
157 Ga0495662_0053961 3300046476 Bacteria 1941
158 Ga0495662_0245256 3300046476 Bacteria 882
159 Ga0495664_0004799 3300046477 Bacteria 7393
160 Ga0495664_0007202 3300046477 Bacteria 6168
161 Ga0495585_0019891 3300046492 Bacteria 3865
162 Ga0495585_0092522 3300046492 Bacteria 1627
163 Ga0495585_0215824 3300046492 Bacteria 970
164 Ga0495594_0014372 3300046499 Bacteria 4146
165 Ga0495594_0027688 3300046499 Bacteria 3055
166 Ga0495594_0079657 3300046499 Bacteria 1829
167 Ga0495594_0176327 3300046499 Bacteria 1216
168 Ga0495594_0448972 3300046499 Bacteria 733
169 Ga0495596_0084089 3300046500 Bacteria 1235
170 Ga0495607_0165118 3300046501 Bacteria 1122
171 Ga0495583_0016901 3300046506 Bacteria 3898
172 Ga0495583_0066041 3300046506 Bacteria 1601
173 Ga0495606_0084904 3300046507 Bacteria 1959
174 Ga0495608_0004583 3300046511 Bacteria 9872
175 Ga0495608_0083017 3300046511 Bacteria 2080
176 Ga0495608_0535449 3300046511 Bacteria 707
177 Ga0495610_0049886 3300046512 Bacteria 2046
178 Ga0495610_0244481 3300046512 Bacteria 714
179 Ga0495618_0027688 3300046514 Bacteria 3529
180 Ga0495620_0016913 3300046515 Bacteria 3647
181 Ga0495620_0157659 3300046515 Bacteria 883
182 Ga0495628_0004035 3300046516 Bacteria 13072
183 Ga0495628_0026327 3300046516 Bacteria 4744
184 Ga0495628_0230851 3300046516 Bacteria 1387
185 Ga0495630_0042993 3300046517 Bacteria 3374
186 Ga0495630_0423687 3300046517 Bacteria 1020
187 Ga0495632_0041529 3300046519 Bacteria 2311
188 Ga0495643_0003342 3300046522 Bacteria 11821
189 Ga0495643_0003993 3300046522 Bacteria 10544
190 Ga0495643_0138112 3300046522 Bacteria 1218
191 Ga0495648_0194809 3300046524 Bacteria 1019
192 Ga0495666_0002747 3300046526 Bacteria 8790
193 Ga0495642_0233704 3300046528 Bacteria 803
194 Ga0495652_0006829 3300046529 Bacteria 10579
195 Ga0495652_0008047 3300046529 Bacteria 9659
196 Ga0495652_0042146 3300046529 Bacteria 3937
197 Ga0495652_0296831 3300046529 Bacteria 1176
198 Ga0495652_0301659 3300046529 Bacteria 1164
199 Ga0495640_0004464 3300046533 Bacteria 11155
200 Ga0495640_0010415 3300046533 Bacteria 7190
201 Ga0495640_0021927 3300046533 Bacteria 4678
202 Ga0495640_0280408 3300046533 Bacteria 1038
203 Ga0495586_0014955 3300046535 Bacteria 4124
204 Ga0495586_0147066 3300046535 Bacteria 1325
205 Ga0495587_0006656 3300046536 Bacteria 7526
206 Ga0495597_0035364 3300046542 Bacteria 2253
207 Ga0495645_0002369 3300046543 Bacteria 12777
208 Ga0495645_0005222 3300046543 Bacteria 8897
209 Ga0495645_0063929 3300046543 Bacteria 2663
210 Ga0495622_0157560 3300046557 Bacteria 1025
211 Ga0495633_0164212 3300046558 Bacteria 1024
212 Ga0495667_0029444 3300046559 Bacteria 3696
213 Ga0495667_0297601 3300046559 Bacteria 1022
214 Ga0495656_0374926 3300046615 Bacteria 741
215 Ga0495668_0109185 3300046616 Bacteria 1513
216 Ga0495634_0000288 3300046642 Bacteria 48179
217 Ga0495634_0014997 3300046642 Bacteria 5572
218 Ga0495634_0029326 3300046642 Bacteria 3809
219 Ga0495634_0097279 3300046642 Bacteria 1905
220 Ga0495611_0110484 3300046648 Bacteria 1279
221 Ga0495611_0210689 3300046648 Bacteria 905
222 Ga0495625_0011417 3300046660 Bacteria 7243
223 Ga0495625_0077444 3300046660 Bacteria 2323
224 Ga0495635_0004117 3300046663 Bacteria 10080
225 Ga0495635_0030521 3300046663 Bacteria 3745
226 Ga0495635_0090165 3300046663 Bacteria 2097
227 Ga0495588_0006621 3300046674 Bacteria 5229
228 Ga0495588_0020284 3300046674 Bacteria 3264
229 Ga0495588_0058996 3300046674 Bacteria 1984
230 Ga0495588_0148059 3300046674 Bacteria 1241
231 Ga0495588_0345726 3300046674 Bacteria 782
232 Ga0495657_0015537 3300046675 Bacteria 5568
233 Ga0495657_0029029 3300046675 Bacteria 3882
234 Ga0495657_0254020 3300046675 Bacteria 1057
235 Ga0495657_0305751 3300046675 Bacteria 947
236 Ga0495599_0423467 3300046678 Bacteria 791
237 Ga0495623_0101513 3300046679 Bacteria 1752
238 Ga0495646_0003726 3300046680 Bacteria 9521
239 Ga0495646_0045161 3300046680 Bacteria 2692
240 Ga0495658_0025744 3300046683 Bacteria 3148
241 Ga0495613_0003894 3300046689 Bacteria 11168
242 Ga0495613_0011607 3300046689 Bacteria 6547
243 Ga0495613_0015831 3300046689 Bacteria 5613
244 Ga0495613_0025823 3300046689 Bacteria 4376
245 Ga0495613_0027678 3300046689 Bacteria 4218
246 Ga0495613_0031222 3300046689 Bacteria 3956
247 Ga0495613_0118434 3300046689 Bacteria 1903
248 Ga0495624_0172705 3300046690 Bacteria 1318
249 Ga0495670_0001680 3300046691 Bacteria 10867
250 Ga0495670_0042810 3300046691 Bacteria 2260
251 Ga0495671_0024312 3300046692 Bacteria 3156
252 Ga0495649_0013187 3300046694 Bacteria 4774
253 Ga0495649_0191921 3300046694 Bacteria 1063
254 Ga0495649_0192549 3300046694 Bacteria 1061
255 Ga0495589_0002931 3300046794 Bacteria 9418
256 Ga0495589_0055846 3300046794 Bacteria 1945
257 Ga0495589_0106936 3300046794 Bacteria 1351
258 Ga0495589_0135801 3300046794 Bacteria 1179
259 Ga0495600_0046633 3300046809 Bacteria 2827
260 Ga0495600_0063702 3300046809 Bacteria 2409
261 Ga0495600_0093760 3300046809 Bacteria 1957
262 Ga0495660_0061583 3300046810 Bacteria 2013
263 Ga0495660_0132581 3300046810 Bacteria 1248
264 Ga0495581_0055016 3300047315 Bacteria 2297
265 Ga0495581_0073712 3300047315 Bacteria 1976
266 Ga0495581_0118757 3300047315 Bacteria 1538
267 Ga0495581_0131515 3300047315 Bacteria 1458
268 Ga0495581_0207999 3300047315 Bacteria 1144
269 Ga0495581_0291862 3300047315 Bacteria 953
270 Ga0495581_0346346 3300047315 Bacteria 867
271 Ga0495604_0000456 3300047317 Bacteria 36393
272 Ga0495604_0007193 3300047317 Bacteria 8817
273 Ga0495604_0020676 3300047317 Bacteria 5255
274 Ga0495604_0083185 3300047317 Bacteria 2392
275 Ga0495604_0158427 3300047317 Bacteria 1601
276 Ga0495636_0006914 3300047318 Bacteria 4461
277 Ga0495636_0011786 3300047318 Bacteria 3463
278 Ga0495636_0236678 3300047318 Bacteria 841
279 Ga0495674_0027752 3300047319 Bacteria 5168
280 Ga0495672_0119044 3300047320 Bacteria 1406
281 Ga0495676_0008200 3300047321 Bacteria 9583
282 Ga0495676_0010371 3300047321 Bacteria 8451
283 Ga0495676_0054311 3300047321 Bacteria 3186
284 Ga0495680_0021153 3300047322 Bacteria 5452
285 Ga0495680_0667826 3300047322 Bacteria 689
286 Ga0495683_0033718 3300047323 Bacteria 2604
287 Ga0495683_0077616 3300047323 Bacteria 1623
288 Ga0495687_000864 3300047443 Bacteria 32105
289 Ga0495687_003599 3300047443 Bacteria 11094
290 Ga0495687_056686 3300047443 Bacteria 1633
291 Ga0495687_103803 3300047443 Bacteria 1060
292 Ga0495675_0003793 3300047444 Bacteria 9143
293 Ga0495675_0042194 3300047444 Bacteria 2906
294 Ga0495675_0161605 3300047444 Bacteria 1379
295 Ga0495675_0187968 3300047444 Bacteria 1262
296 Ga0495677_0049397 3300047445 Bacteria 1546
297 Ga0495685_001714 3300047447 Bacteria 6751
298 Ga0495685_002905 3300047447 Bacteria 5416
299 Ga0495685_008530 3300047447 Bacteria 3406
300 Ga0495685_032598 3300047447 Bacteria 1790
301 Ga0495685_080378 3300047447 Bacteria 1086
302 Ga0495685_102702 3300047447 Bacteria 943
303 Ga0495681_0000117 3300047470 Bacteria 69601
304 Ga0495681_0011094 3300047470 Bacteria 5400
305 Ga0495681_0103635 3300047470 Bacteria 1240
306 Ga0495681_0217162 3300047470 Bacteria 768
307 Ga0495684_0014112 3300047471 Bacteria 6144
308 Ga0495686_0076088 3300047472 Bacteria 2057
309 Ga0495686_0332072 3300047472 Bacteria 831
310 Ga0495593_0010537 3300047673 Bacteria 5334
311 Ga0495593_0013712 3300047673 Bacteria 4616
312 Ga0495593_0051299 3300047673 Bacteria 2183
313 Ga0495593_0081631 3300047673 Bacteria 1671
314 Ga0495602_0054523 3300048088 Bacteria 3528
315 Ga0495602_0286428 3300048088 Bacteria 1211
316 Ga0495614_0007323 3300048089 Bacteria 4914
317 Ga0495614_0008811 3300048089 Bacteria 4478
318 Ga0495614_0062999 3300048089 Bacteria 1593
319 Ga0495614_0140670 3300048089 Bacteria 1072
320 Ga0496104_1126706 3300048907 Bacteria 688
321 Ga0496107_0733378 3300048910 Bacteria 726
322 Ga0496109_0211432 3300048912 Bacteria 1824
323 Ga0496110_0751332 3300048913 Bacteria 878
324 Ga0496113_0232805 3300048916 Bacteria 1469
325 Ga0495678_029246 3300049459 Bacteria 2316
326 Ga0501031_0009312 3300049568 Bacteria 6384
327 Ga0501031_0123944 3300049568 Bacteria 1688
328 Ga0501032_0013697 3300049569 Bacteria 5760
329 Ga0501032_0026029 3300049569 Bacteria 4029
330 Ga0501032_0055459 3300049569 Bacteria 2666
331 Ga0501032_0122595 3300049569 Bacteria 1718
332 Ga0501032_0262890 3300049569 Bacteria 1119
333 Ga0501033_0004404 3300049570 Bacteria 11272
334 Ga0501033_0065099 3300049570 Bacteria 2682
335 Ga0501033_0068684 3300049570 Bacteria 2605
336 Ga0501033_0167617 3300049570 Bacteria 1578
337 Ga0501034_0031914 3300049571 Bacteria 5351
338 Ga0501034_0094618 3300049571 Bacteria 2984
339 Ga0501034_0130704 3300049571 Bacteria 2494
340 Ga0501034_0486238 3300049571 Bacteria 1149
341 Ga0501036_0004390 3300049572 Bacteria 11381
342 Ga0501036_0011678 3300049572 Bacteria 7279
343 Ga0501036_0033865 3300049572 Bacteria 4321
344 Ga0501036_0044683 3300049572 Bacteria 3753
345 Ga0501036_0092692 3300049572 Bacteria 2552
346 Ga0501036_0258642 3300049572 Bacteria 1458
347 Ga0501037_0015350 3300049573 Bacteria 5635
348 Ga0501037_0082999 3300049573 Bacteria 2321
349 Ga0501037_0142832 3300049573 Bacteria 1712
350 Ga0501037_0226401 3300049573 Bacteria 1314
351 Ga0501038_0001931 3300049574 Bacteria 19126
352 Ga0501038_0047153 3300049574 Bacteria 3733
353 Ga0501038_0064995 3300049574 Bacteria 3110
354 Ga0501038_0284651 3300049574 Bacteria 1300
355 Ga0501038_0839423 3300049574 Bacteria 681
356 Ga0501039_0020906 3300049575 Bacteria 5018
357 Ga0501039_0133007 3300049575 Bacteria 1952
358 Ga0501039_0222789 3300049575 Bacteria 1483
359 Ga0501039_0290039 3300049575 Bacteria 1286
360 Ga0501039_0702888 3300049575 Bacteria 790
361 Ga0501042_0041801 3300049578 Bacteria 3261
362 Ga0501042_0092916 3300049578 Bacteria 2166
363 Ga0501043_0028218 3300049579 Bacteria 4405
364 Ga0501043_0037912 3300049579 Bacteria 3791
365 Ga0501043_0042365 3300049579 Bacteria 3578
366 Ga0501043_0300128 3300049579 Bacteria 1227
367 Ga0501043_0330697 3300049579 Bacteria 1160
368 Ga0501043_0418759 3300049579 Bacteria 1010
369 Ga0501046_0005530 3300049580 Bacteria 11284
370 Ga0501046_0072994 3300049580 Bacteria 2664
371 Ga0501046_0311695 3300049580 Bacteria 1148
372 Ga0501046_0858567 3300049580 Bacteria 634
373 Ga0501047_0000327 3300049581 Bacteria 54775
374 Ga0501047_0013875 3300049581 Bacteria 7652
375 Ga0501047_0023850 3300049581 Bacteria 5874
376 Ga0501047_0067274 3300049581 Bacteria 3453
377 Ga0501047_0083851 3300049581 Bacteria 3063
378 Ga0501047_0101352 3300049581 Bacteria 2758
379 Ga0501047_0225907 3300049581 Bacteria 1727
380 Ga0501047_0302886 3300049581 Bacteria 1440
381 Ga0501047_0434897 3300049581 Bacteria 1143
382 Ga0501047_0442487 3300049581 Bacteria 1129
383 Ga0501048_0484005 3300049582 Bacteria 887
384 Ga0501070_0031145 3300049586 Bacteria 4468
385 Ga0501070_0071800 3300049586 Bacteria 2866
386 Ga0501070_0104599 3300049586 Bacteria 2341
387 Ga0501070_0166572 3300049586 Bacteria 1816
388 Ga0501070_0290452 3300049586 Bacteria 1333
389 Ga0501073_0255017 3300049589 Bacteria 1211
390 Ga0501073_0378364 3300049589 Bacteria 978
391 Ga0501074_0039561 3300049590 Bacteria 3415
392 Ga0501080_0126758 3300049742 Bacteria 2364
393 Ga0501083_0215994 3300049744 Bacteria 1250
394 Ga0501035_0025441 3300049822 Bacteria 5427
395 Ga0501035_0035439 3300049822 Bacteria 4529
396 Ga0501035_0067742 3300049822 Bacteria 3166
397 Ga0501035_0076951 3300049822 Bacteria 2949
398 Ga0501035_0098319 3300049822 Bacteria 2569
399 Ga0501035_0119160 3300049822 Bacteria 2309
400 Ga0501035_0189288 3300049822 Bacteria 1769
401 Ga0501035_0607508 3300049822 Bacteria 890
402 Ga0501044_0053494 3300049823 Bacteria 4153
403 Ga0501044_0067385 3300049823 Bacteria 3647
404 Ga0501044_0113517 3300049823 Bacteria 2716
405 Ga0501044_0126240 3300049823 Bacteria 2556
406 Ga0501044_0142637 3300049823 Bacteria 2383
407 Ga0501044_0767612 3300049823 Bacteria 845
408 nmdc:mga03n38_55598_c1 3300050490 Bacteria 1783
409 nmdc:mga06z11_4807_c1 3300050494 Bacteria 5344
410 nmdc:mga04h51_2243_c1 3300050495 Bacteria 4554
411 Ga0495601_0090046 3300053077 Bacteria 1973
412 Ga0495612_0077160 3300053078 Bacteria 1396
413 Ga0495612_0121876 3300053078 Bacteria 1122
414 Ga0495655_0097093 3300053083 Bacteria 867
415 Ga0495595_0395748 3300053084 Bacteria 700
416 Ga0500578_0108068 3300053086 Bacteria 1755
417 Ga0500583_0368267 3300053092 Bacteria 694
418 Ga0500566_0031495 3300053094 Bacteria 3093
419 Ga0500566_0257242 3300053094 Bacteria 845
420 Ga0500654_150906 3300053099 Bacteria 817
421 Ga0500560_009328 3300053107 Bacteria 2407
422 Ga0500560_064602 3300053107 Bacteria 1198
423 Ga0500572_022216 3300053111 Bacteria 1690
424 Ga0500594_0044738 3300053118 Bacteria 1226
425 Ga0500621_046276 3300053126 Bacteria 1760
426 Ga0500658_0022763 3300053134 Bacteria 2386
427 Ga0500561_0002732 3300053137 Bacteria 2996
428 Ga0500573_0322839 3300053140 Bacteria 761
429 Ga0500573_0396802 3300053140 Bacteria 654
430 Ga0500588_0014588 3300053146 Bacteria 1995
431 Ga0500600_0063456 3300053149 Bacteria 2050
432 Ga0500633_0054539 3300053160 Bacteria 1389
433 Ga0500634_0003958 3300053161 Bacteria 6730
434 Ga0500636_0266426 3300053177 Bacteria 864
435 Ga0500656_002958 3300053732 Bacteria 1565
436 Ga0501084_0702102 3300054114 Bacteria 853
437 Ga0466962_0000604 3300061719 Bacteria 15903
438 Ga0466962_0011742 3300061719 Bacteria 4218
439 Ga0466962_0022385 3300061719 Bacteria 3037
440 2997456817 2997451912 Bacteria 8492419
441 2547407135 2547132111 Bacteria 8013147
442 2554258306 2554235005 Bacteria 6457341
443 2585299046 2582581312 Bacteria 7308206
444 2616697479 2616644814 Bacteria 11555299
445 2616900394 2616644941 Bacteria 8510691
446 2643765435 2643221548 Bacteria 8053412
447 2643898220 2643221578 Bacteria 9213798
448 2643944413 2643221587 Bacteria 7586415
449 2644013513 2643221601 Bacteria 7493239
450 2644179306 2643221631 Bacteria 8168043
451 2644264537 2643221647 Bacteria 10741251
452 2644385661 2643221670 Bacteria 6497041
453 2644409365 2643221673 Bacteria 9196637
454 2644431311 2643221677 Bacteria 7584031
455 2644436703 2643221678 Bacteria 9540101
456 2644462494 2643221682 Bacteria 6743283
457 2644625487 2643221714 Bacteria 9015452
458 2768643275 2767802112 Bacteria 6465194
459 2784588188 2784132148 Bacteria 8627943
460 2785343877 2784746763 Bacteria 9783172
461 2786670133 2786546132 Bacteria 10419719
462 2793982614 2791355406 Bacteria 11364898
463 2808841603 2808606359 Bacteria 9866990
464 2809231798 2808606448 Bacteria 8656184
465 2811848558 2808606982 Bacteria 7791042
466 2812358640 2811994879 Bacteria 9313447
467 2812480965 2811994917 Bacteria 7761064
468 2819693367 2818991463 Bacteria 7948711
469 2819742589 2818991472 Bacteria 10089953
470 2852642366 2852635781 Bacteria 8251373
471 2862287780 2862281513 Bacteria 9621493
472 2862291630 2862290372 Bacteria 7471434
473 2862514987 2862507626 Bacteria 9425308
474 2862705537 2862705112 Bacteria 6563286
475 2863405165 2863404153 Bacteria 9672205
476 2867371487 2867369537 Bacteria 6501581
477 2873156207 2873151551 Bacteria 8625867
478 2875394109 2875391855 Bacteria 7600475
479 2877681576 2877676314 Bacteria 9512378
480 2912720513 2912715099 Bacteria 9460473
481 2912724705 2912723979 Bacteria 8557534
482 2912760224 2912757875 Bacteria 7940295
483 2918504099 2918501144 Bacteria 8668083
484 2919473407 2919468124 Bacteria 9133025
485 2935396714 2935390628 Bacteria 7043367
486 2946050505 2946045630 Bacteria 8527308
487 2946067233 2946064051 Bacteria 8957905
488 2946075507 2946072368 Bacteria 8999607
489 2947230008 2947224130 Bacteria 9938529
490 2954003222 2954002825 Bacteria 9173742
491 2954386705 2954380949 Bacteria 10050426
492 2954676469 2954673503 Bacteria 9685905
493 2954687698 2954682443 Bacteria 9862841
494 2954697520 2954691527 Bacteria 10720516
495 2954704688 2954701450 Bacteria 10834262
496 2966602974 2966598605 Bacteria 7676064
497 2990046683 2990044586 Bacteria 6603797
498 2990062846 2990059506 Bacteria 9321252
499 2990094248 2990088156 Bacteria 6657676
500 2995466147 2995463766 Bacteria 8577691
501 2997601686 2997600082 Bacteria 9896405
502 3006396218 3006393351 Bacteria 6615579
503 3006486383 3006486233 Bacteria 8157040
504 3006496479 3006493962 Bacteria 8825450
505 8008487388 8008485437 Bacteria 7198341
506 8008579266 8008574985 Bacteria 7815457
507 8023631369 8023623736 Bacteria 8593882
508 8025482419 8025478263 Bacteria 8209203
509 8025526462 8025524527 Bacteria 7197316
510 8025533136 8025530807 Bacteria 8495698
511 8033687836 8033684223 Bacteria 6906479
512 8047898530 8047893842 Bacteria 11723082
513 8048132755 8048127548 Bacteria 11053136
514 8048360380 8048356638 Bacteria 11044339
515 8048375492 8048369669 Bacteria 11666822
516 8048382713 8048379754 Bacteria 11877923
517 8048413184 8048406513 Bacteria 8936924
518 rootH1_10028943
519 rootH2_10053788
520 Ga0006562J51391_1115016
521 Ga0006562J51391_1115018
522 Ga0006562J51391_1168946
523 Ga0006562J51391_1168947
524 Ga0070682_101006389
525 Ga0070667_100746702
526 Ga0070681_10272196
527 Ga0070693_100294202
528 Ga0070665_100855364
529 Ga0068861_100006980
530 Ga0075365_10491956
531 Ga0075368_10011078
532 Ga0075367_10037671
533 Ga0105250_10330178
534 Ga0105245_10864548
535 Ga0105243_10721868
536 Ga0105243_11188202
537 Ga0105248_10416811
538 Ga0105246_10004139
539 Ga0105246_10619996
540 Ga0157372_10293802
541 Ga0182006_1088540
542 Ga0182007_10000422
543 Ga0213875_10012115
544 Ga0207647_10138724
545 Ga0207685_10449786
546 Ga0207667_11418832
547 Ga0207678_10711040
548 Ga0207678_11090333
549 Ga0207702_10446822
550 Ga0207702_10722354
551 Ga0207674_10626056
552 Ga0207675_100071182
553 Ga0209371_1010316
554 Ga0209813_10027533
555 Ga0268266_10128872
556 Ga0268265_10031639
557 Ga0268264_10168855
558 Ga0307517_10007378
559 Ga0307517_10020930
560 Ga0307515_10002412
561 Ga0307515_10162002
562 Ga0268256_1007296
563 Ga0307511_10001229
564 Ga0307512_10003613
565 Ga0307513_10038933
566 Ga0307513_10144811
567 Ga0307509_10025220
568 Ga0307508_10006984
569 Ga0307508_10035817
570 Ga0307508_10161542
571 Ga0307508_10198182
572 Ga0307514_10006992
573 Ga0307514_10052719
574 Ga0307514_10118353
575 Ga0307516_10005616
576 Ga0307516_10027532
577 Ga0307516_10070621
578 Ga0307516_10193957
579 Ga0307413_10361754
580 Ga0307518_10150026
581 Ga0307518_10172677
582 Ga0307412_10370582
583 Ga0307416_101266113
584 Ga0307507_10033782
585 Ga0307507_10071410
586 Ga0307507_10230652
587 Ga0307510_10047137
588 Ga0307510_10069166
589 Ga0395898_0002383
590 Ga0395898_0035107
591 Ga0436364_0550711
592 Ga0395901_0050250
593 Ga0439436_0001068
594 Ga0439436_0024823
595 Ga0439439_0005769
596 Ga0439439_0084063
597 Ga0451841_0139026
598 Ga0451853_0268200
599 Ga0451853_1315420
600 Ga0439433_0035667
601 Ga0439448_0007453
602 Ga0439449_0001333
603 Ga0439449_0040284
604 Ga0439457_000094
605 Ga0439457_000214
606 Ga0439462_0003811
607 Ga0450890_004020
608 Ga0450894_016355
609 Ga0450902_026398
610 Ga0450903_000218
611 Ga0450903_041425
612 Ga0439458_0001942
613 Ga0466969_0001841
614 Ga0466969_0022167
615 Ga0466969_0155527
616 Ga0466972_0008629
617 Ga0466972_0132349
618 Ga0466972_0278828
619 Ga0466965_0001830
620 Ga0466965_0067338
621 Ga0466965_0118377
622 Ga0466965_0250620
623 Ga0466965_0547636
624 Ga0466966_0201421
625 Ga0466961_0000293
626 Ga0466961_0019122
627 Ga0466961_0043032
628 Ga0466961_0047485
629 Ga0466961_0111583
630 Ga0466961_0194189
631 Ga0466963_0037374
632 Ga0466963_0261344
633 Ga0466964_0189472
634 Ga0466971_0002061
635 Ga0466971_0018011
636 Ga0466968_0279821
637 Ga0466970_0000816
638 Ga0466970_0006802
639 Ga0466970_0159383
640 Ga0466957_0033753
641 Ga0466960_0002414
642 Ga0466959_0011485
643 Ga0466959_0039135
644 Ga0466959_0054698
645 Ga0466967_0247131
646 Ga0466967_0275655
647 Ga0466967_1661175
648 Ga0495592_0005623
649 Ga0495592_0010408
650 Ga0495592_0029979
651 Ga0495592_0051735
652 Ga0495603_0007810
653 Ga0495603_0010747
654 Ga0495603_0395106
655 Ga0495590_0037373
656 Ga0495629_0001923
657 Ga0495629_0019960
658 Ga0495629_0029253
659 Ga0495629_0048938
660 Ga0495629_0069111
661 Ga0495629_0070567
662 Ga0495629_0232927
663 Ga0495638_0288784
664 Ga0495638_0392531
665 Ga0495651_0007543
666 Ga0495651_0034069
667 Ga0495651_0159324
668 Ga0495580_0013658
669 Ga0495580_0212871
670 Ga0495582_0023793
671 Ga0495582_0045277
672 Ga0495605_0032583
673 Ga0495662_0000170
674 Ga0495662_0053961
675 Ga0495662_0245256
676 Ga0495664_0004799
677 Ga0495664_0007202
678 Ga0495585_0019891
679 Ga0495585_0092522
680 Ga0495585_0215824
681 Ga0495594_0014372
682 Ga0495594_0027688
683 Ga0495594_0079657
684 Ga0495594_0176327
685 Ga0495594_0448972
686 Ga0495596_0084089
687 Ga0495607_0165118
688 Ga0495583_0016901
689 Ga0495583_0066041
690 Ga0495606_0084904
691 Ga0495608_0004583
692 Ga0495608_0083017
693 Ga0495608_0535449
694 Ga0495610_0049886
695 Ga0495610_0244481
696 Ga0495618_0027688
697 Ga0495620_0016913
698 Ga0495620_0157659
699 Ga0495628_0004035
700 Ga0495628_0026327
701 Ga0495628_0230851
702 Ga0495630_0042993
703 Ga0495630_0423687
704 Ga0495632_0041529
705 Ga0495643_0003342
706 Ga0495643_0003993
707 Ga0495643_0138112
708 Ga0495648_0194809
709 Ga0495666_0002747
710 Ga0495642_0233704
711 Ga0495652_0006829
712 Ga0495652_0008047
713 Ga0495652_0042146
714 Ga0495652_0296831
715 Ga0495652_0301659
716 Ga0495640_0004464
717 Ga0495640_0010415
718 Ga0495640_0021927
719 Ga0495640_0280408
720 Ga0495586_0014955
721 Ga0495586_0147066
722 Ga0495587_0006656
723 Ga0495597_0035364
724 Ga0495645_0002369
725 Ga0495645_0005222
726 Ga0495645_0063929
727 Ga0495622_0157560
728 Ga0495633_0164212
729 Ga0495667_0029444
730 Ga0495667_0297601
731 Ga0495656_0374926
732 Ga0495668_0109185
733 Ga0495634_0000288
734 Ga0495634_0014997
735 Ga0495634_0029326
736 Ga0495634_0097279
737 Ga0495611_0110484
738 Ga0495611_0210689
739 Ga0495625_0011417
740 Ga0495625_0077444
741 Ga0495635_0004117
742 Ga0495635_0030521
743 Ga0495635_0090165
744 Ga0495588_0006621
745 Ga0495588_0020284
746 Ga0495588_0058996
747 Ga0495588_0148059
748 Ga0495588_0345726
749 Ga0495657_0015537
750 Ga0495657_0029029
751 Ga0495657_0254020
752 Ga0495657_0305751
753 Ga0495599_0423467
754 Ga0495623_0101513
755 Ga0495646_0003726
756 Ga0495646_0045161
757 Ga0495658_0025744
758 Ga0495613_0003894
759 Ga0495613_0011607
760 Ga0495613_0015831
761 Ga0495613_0025823
762 Ga0495613_0027678
763 Ga0495613_0031222
764 Ga0495613_0118434
765 Ga0495624_0172705
766 Ga0495670_0001680
767 Ga0495670_0042810
768 Ga0495671_0024312
769 Ga0495649_0013187
770 Ga0495649_0191921
771 Ga0495649_0192549
772 Ga0495589_0002931
773 Ga0495589_0055846
774 Ga0495589_0106936
775 Ga0495589_0135801
776 Ga0495600_0046633
777 Ga0495600_0063702
778 Ga0495600_0093760
779 Ga0495660_0061583
780 Ga0495660_0132581
781 Ga0495581_0055016
782 Ga0495581_0073712
783 Ga0495581_0118757
784 Ga0495581_0131515
785 Ga0495581_0207999
786 Ga0495581_0291862
787 Ga0495581_0346346
788 Ga0495604_0000456
789 Ga0495604_0007193
790 Ga0495604_0020676
791 Ga0495604_0083185
792 Ga0495604_0158427
793 Ga0495636_0006914
794 Ga0495636_0011786
795 Ga0495636_0236678
796 Ga0495674_0027752
797 Ga0495672_0119044
798 Ga0495676_0008200
799 Ga0495676_0010371
800 Ga0495676_0054311
801 Ga0495680_0021153
802 Ga0495680_0667826
803 Ga0495683_0033718
804 Ga0495683_0077616
805 Ga0495687_000864
806 Ga0495687_003599
807 Ga0495687_056686
808 Ga0495687_103803
809 Ga0495675_0003793
810 Ga0495675_0042194
811 Ga0495675_0161605
812 Ga0495675_0187968
813 Ga0495677_0049397
814 Ga0495685_001714
815 Ga0495685_002905
816 Ga0495685_008530
817 Ga0495685_032598
818 Ga0495685_080378
819 Ga0495685_102702
820 Ga0495681_0000117
821 Ga0495681_0011094
822 Ga0495681_0103635
823 Ga0495681_0217162
824 Ga0495684_0014112
825 Ga0495686_0076088
826 Ga0495686_0332072
827 Ga0495593_0010537
828 Ga0495593_0013712
829 Ga0495593_0051299
830 Ga0495593_0081631
831 Ga0495602_0054523
832 Ga0495602_0286428
833 Ga0495614_0007323
834 Ga0495614_0008811
835 Ga0495614_0062999
836 Ga0495614_0140670
837 Ga0496104_1126706
838 Ga0496107_0733378
839 Ga0496109_0211432
840 Ga0496110_0751332
841 Ga0496113_0232805
842 Ga0495678_029246
843 Ga0501031_0009312
844 Ga0501031_0123944
845 Ga0501032_0013697
846 Ga0501032_0026029
847 Ga0501032_0055459
848 Ga0501032_0122595
849 Ga0501032_0262890
850 Ga0501033_0004404
851 Ga0501033_0065099
852 Ga0501033_0068684
853 Ga0501033_0167617
854 Ga0501034_0031914
855 Ga0501034_0094618
856 Ga0501034_0130704
857 Ga0501034_0486238
858 Ga0501036_0004390
859 Ga0501036_0011678
860 Ga0501036_0033865
861 Ga0501036_0044683
862 Ga0501036_0092692
863 Ga0501036_0258642
864 Ga0501037_0015350
865 Ga0501037_0082999
866 Ga0501037_0142832
867 Ga0501037_0226401
868 Ga0501038_0001931
869 Ga0501038_0047153
870 Ga0501038_0064995
871 Ga0501038_0284651
872 Ga0501038_0839423
873 Ga0501039_0020906
874 Ga0501039_0133007
875 Ga0501039_0222789
876 Ga0501039_0290039
877 Ga0501039_0702888
878 Ga0501042_0041801
879 Ga0501042_0092916
880 Ga0501043_0028218
881 Ga0501043_0037912
882 Ga0501043_0042365
883 Ga0501043_0300128
884 Ga0501043_0330697
885 Ga0501043_0418759
886 Ga0501046_0005530
887 Ga0501046_0072994
888 Ga0501046_0311695
889 Ga0501046_0858567
890 Ga0501047_0000327
891 Ga0501047_0013875
892 Ga0501047_0023850
893 Ga0501047_0067274
894 Ga0501047_0083851
895 Ga0501047_0101352
896 Ga0501047_0225907
897 Ga0501047_0302886
898 Ga0501047_0434897
899 Ga0501047_0442487
900 Ga0501048_0484005
901 Ga0501070_0031145
902 Ga0501070_0071800
903 Ga0501070_0104599
904 Ga0501070_0166572
905 Ga0501070_0290452
906 Ga0501073_0255017
907 Ga0501073_0378364
908 Ga0501074_0039561
909 Ga0501080_0126758
910 Ga0501083_0215994
911 Ga0501035_0025441
912 Ga0501035_0035439
913 Ga0501035_0067742
914 Ga0501035_0076951
915 Ga0501035_0098319
916 Ga0501035_0119160
917 Ga0501035_0189288
918 Ga0501035_0607508
919 Ga0501044_0053494
920 Ga0501044_0067385
921 Ga0501044_0113517
922 Ga0501044_0126240
923 Ga0501044_0142637
924 Ga0501044_0767612
925 nmdc:mga03n38_55598_c1
926 nmdc:mga06z11_4807_c1
927 nmdc:mga04h51_2243_c1
928 Ga0495601_0090046
929 Ga0495612_0077160
930 Ga0495612_0121876
931 Ga0495655_0097093
932 Ga0495595_0395748
933 Ga0500578_0108068
934 Ga0500583_0368267
935 Ga0500566_0031495
936 Ga0500566_0257242
937 Ga0500654_150906
938 Ga0500560_009328
939 Ga0500560_064602
940 Ga0500572_022216
941 Ga0500594_0044738
942 Ga0500621_046276
943 Ga0500658_0022763
944 Ga0500561_0002732
945 Ga0500573_0322839
946 Ga0500573_0396802
947 Ga0500588_0014588
948 Ga0500600_0063456
949 Ga0500633_0054539
950 Ga0500634_0003958
951 Ga0500636_0266426
952 Ga0500656_002958
953 Ga0501084_0702102
954 Ga0466962_0000604
955 Ga0466962_0011742
956 Ga0466962_0022385
957 2997456817
958 2547407135
959 2554258306
960 2585299046
961 2616697479
962 2616900394
963 2643765435
964 2643898220
965 2643944413
966 2644013513
967 2644179306
968 2644264537
969 2644385661
970 2644409365
971 2644431311
972 2644436703
973 2644462494
974 2644625487
975 2768643275
976 2784588188
977 2785343877
978 2786670133
979 2793982614
980 2808841603
981 2809231798
982 2811848558
983 2812358640
984 2812480965
985 2819693367
986 2819742589
987 2852642366
988 2862287780
989 2862291630
990 2862514987
991 2862705537
992 2863405165
993 2867371487
994 2873156207
995 2875394109
996 2877681576
997 2912720513
998 2912724705
999 2912760224
1000 2918504099
1001 2919473407
1002 2935396714
1003 2946050505
1004 2946067233
1005 2946075507
1006 2947230008
1007 2954003222
1008 2954386705
1009 2954676469
1010 2954687698
1011 2954697520
1012 2954704688
1013 2966602974
1014 2990046683
1015 2990062846
1016 2990094248
1017 2995466147
1018 2997601686
1019 3006396218
1020 3006486383
1021 3006496479
1022 8008487388
1023 8008579266
1024 8023631369
1025 8025482419
1026 8025526462
1027 8025533136
1028 8033687836
1029 8047898530
1030 8048132755
1031 8048360380
1032 8048375492
1033 8048382713
1034 8048413184

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

1

189

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pl1-assembly1.cif.gz_A determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. 0.8878 3 190
3pl1-assembly1.cif.gz_A determination of the crystal structure of the pyrazinamidase from m.tuberculosis : a structure-function analysis for prediction resistance to pyrazinamide. 0.8696 3 190
2h0r-assembly7.cif.gz_G structure of the yeast nicotinamidase pnc1p 0.8323 3 192
2b34-assembly1.cif.gz_A structure of mar1 ribonuclease from caenorhabditis elegans 0.822 2 190
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.8146 1 190
ID Description Score Start End Superfamily
3pl1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8878 3 190 3.40.50.850
3pl1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8696 3 190 3.40.50.850
3v8eC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8211 3 192 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8146 1 190 3.40.50.850
af_Q54NZ8_2_198_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8123 2 190 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A7V9U805-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9984 109 190 GO:0016787
GO:0019363
GO:0046872
AF-A0A2E6F9J8-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9862 97 191 GO:0016787
GO:0019363
GO:0046872
AF-A0A645C1J8-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9844 101 190 GO:0008936
GO:0019363
GO:0046872
AF-A0A5K7TYJ5-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.977 123 192 GO:0016811
GO:0019363
GO:0046872
AF-A0A3D6B4P7-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9751 101 190 GO:0016811
GO:0019363
GO:0046872

Map