F458177

General Info

Members Datasets Scaffolds Average Seq Length
517 430 1034 214

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0518316|Ga0496115_0518316_140_916
Length 250
Sequence MAEMQFAVGAGREAECQERHVSGGNRVVLLFRRLLPCGTFQDKETMQRIVTLDDIARGLDALCIIDPRLEKVRGKAGEVPLRLSEPGFRSLASIIVSQQVSRASADAIFGRLTRLVDPLTPQAILAASEDMFREAGLSRPKQRGLIAVAQAVADGLDLNHLCSLDAAVPGIGPWTAEVYLLFAAGHPDIFPARDVALQTAVGHALGIDPRPPEKTLIALAESWSPWRGVASRLFWSYYRETRGRDAAPPS

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
28 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
29 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
39 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
40 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
41 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
42 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
47 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
65 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
66 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
67 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
68 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
69 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
70 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
73 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
74 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
79 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
80 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
81 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
82 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
85 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
86 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
87 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
88 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
89 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
90 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
91 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
94 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
95 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
96 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
105 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
107 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
117 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
123 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
124 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
129 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
130 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
131 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
134 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
135 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
136 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
137 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
138 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
139 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
140 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
141 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
142 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
143 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
144 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
145 2512875024
146 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
147 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
148 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
149 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
150 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
151 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
152 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
153 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
154 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
155 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
156 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
157 2643221568 Rhizobium sp. Root564 Isolate Unclassified
158 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
159 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
160 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
161 2643221629 Devosia sp. Root105 Isolate Unclassified
162 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
163 2643221662 Devosia sp. Root413D1 Isolate Unclassified
164 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
165 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
166 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
167 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
168 2738543024 Aminobacter sp. AP02 Isolate Unclassified
169 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
170 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
171 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
172 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
173 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
174 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
175 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
176 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
177 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
178 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
179 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
180 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
181 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
182 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
183 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
184 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
185 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
186 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
187 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
188 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
189 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
190 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
191 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
192 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
193 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
194 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
195 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
196 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
197 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
198 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
199 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
200 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
201 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
202 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
203 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
204 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
205 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
206 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
207 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
208 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
209 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
210 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
211 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
212 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
213 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
214 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
215 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
216 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
217 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
218 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
219 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
220 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
221 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
222 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
223 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
224 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
225 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
226 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
227 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
228 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
229 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
230 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
231 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
232 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
233 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
234 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
235 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
236 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
237 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
238 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
239 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
240 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
241 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
242 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
243 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
244 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
245 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
246 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
247 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
248 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
249 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
250 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
251 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
252 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
253 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
254 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
255 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
256 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
257 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
258 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
259 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
260 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
261 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
262 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
263 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
264 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
265 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
266 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
267 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
268 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
269 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
270 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
271 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
272 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
273 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
274 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
275 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
276 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
277 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
278 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
279 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
280 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
281 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
282 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
283 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
284 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
285 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
286 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
287 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
288 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
289 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
290 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
291 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
292 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
293 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
294 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
295 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
296 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
297 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
298 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
299 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
300 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
301 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
302 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
303 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
304 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
305 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
306 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
307 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
308 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
309 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
310 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
311 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
312 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
313 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
314 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
315 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
316 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
317 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
318 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
319 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
320 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
321 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
322 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
323 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
324 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
325 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
326 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
327 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
328 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
329 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
330 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
331 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
332 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
333 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
334 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
335 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
336 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
337 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
338 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
339 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
340 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
341 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
342 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
343 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
344 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
345 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
346 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
347 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
348 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
349 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
350 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
351 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
352 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
353 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
354 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
355 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
356 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
357 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
358 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
359 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
360 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
361 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
362 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
363 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
364 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
365 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
366 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
367 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
368 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
369 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
370 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
371 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
372 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
373 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
374 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
375 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
376 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
377 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
378 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
379 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
380 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
381 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
382 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
383 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
384 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
385 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
386 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
387 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
388 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
389 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
390 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
391 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
392 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
393 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
394 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
395 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
396 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
397 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
398 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
399 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
400 3004167301 Mesorhizobium loti 582 Isolate Unclassified
401 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
402 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
403 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
404 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
405 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
406 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
407 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
408 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
409 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
410 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
411 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
412 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
413 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
414 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
415 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
416 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
417 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
418 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
419 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
420 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
421 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
422 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
423 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
424 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
425 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
426 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
427 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
428 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
429 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
430 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 42.75
Metatranscriptomes 0
Isolates 57.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.19
Bulb 0
Endosphere 8.51
Nodule 45.84
Rhizoplane 1.93
Rhizosphere 29.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0518316 3300048918 Bacteria 956
2 JGI24739J22299_10005006 3300001989 Bacteria 5043
3 JGI25155J39150_1000010 3300002704 Bacteria 207717
4 JGI25156J39149_1000033 3300002705 Bacteria 114688
5 JGI25156J39149_1000186 3300002705 Bacteria 45132
6 JGI25154J39366_1000187 3300002738 Bacteria 46590
7 JGI25157J39369_1000009 3300002741 Bacteria 207868
8 JGI25165J46597_1000310 3300003214 Bacteria 59406
9 rootL2_10055145 3300003322 Bacteria 3019
10 rootH1_10196348 3300003323 Bacteria 2765
11 Ga0055542_1000373 3300003762 Bacteria 46236
12 Ga0055529_1003026 3300003763 Bacteria 2944
13 Ga0070670_100000117 3300005331 Bacteria 74455
14 Ga0070661_100394564 3300005344 Bacteria 1093
15 Ga0070663_100482404 3300005455 Bacteria 1027
16 Ga0068867_100340392 3300005459 Bacteria 1249
17 Ga0070665_100005352 3300005548 Bacteria 13259
18 Ga0070665_100177540 3300005548 Bacteria 2130
19 Ga0068855_100722154 3300005563 Bacteria 1064
20 Ga0068852_100060673 3300005616 Bacteria 3283
21 Ga0081455_10379135 3300005937 Bacteria 988
22 Ga0081540_1029085 3300005983 Bacteria 3087
23 Ga0081539_10002004 3300005985 Bacteria 30879
24 Ga0075365_10003778 3300006038 Bacteria 7888
25 Ga0075365_10011265 3300006038 Bacteria 5253
26 Ga0075365_10052752 3300006038 Bacteria 2691
27 Ga0075365_10254545 3300006038 Bacteria 1234
28 Ga0075365_10324372 3300006038 Bacteria 1084
29 Ga0075368_10035760 3300006042 Bacteria 1939
30 Ga0075364_10010836 3300006051 Bacteria 5520
31 Ga0075364_10309585 3300006051 Bacteria 1075
32 Ga0075362_10070859 3300006177 Bacteria 1592
33 Ga0075367_10031249 3300006178 Bacteria 3057
34 Ga0075367_10186631 3300006178 Bacteria 1293
35 Ga0075367_10215334 3300006178 Bacteria 1201
36 Ga0075369_10098368 3300006186 Bacteria 1311
37 Ga0075366_10237426 3300006195 Bacteria 1111
38 Ga0075370_10085817 3300006353 Bacteria 1813
39 Ga0105243_10361117 3300009148 Bacteria 1337
40 Ga0105241_10248828 3300009174 Bacteria 1506
41 Ga0105237_10209565 3300009545 Bacteria 1949
42 Ga0105238_10071905 3300009551 Bacteria 3456
43 Ga0105249_10370665 3300009553 Bacteria 1455
44 Ga0105239_10081778 3300010375 Bacteria 3556
45 Ga0105239_10217685 3300010375 Bacteria 2141
46 Ga0105239_10865259 3300010375 Bacteria 1037
47 Ga0157371_10004449 3300013102 Bacteria 12229
48 Ga0157369_10068264 3300013105 Bacteria 3819
49 Ga0157369_10147193 3300013105 Bacteria 2490
50 Ga0182008_10038037 3300014497 Bacteria 2407
51 Ga0209435_100009 3300025206 Bacteria 476614
52 Ga0209646_1000018 3300025246 Bacteria 476716
53 Ga0209026_1000068 3300025250 Bacteria 207601
54 Ga0209148_1000069 3300025254 Bacteria 334444
55 Ga0209759_1000007 3300025256 Bacteria 476614
56 Ga0209759_1000183 3300025256 Bacteria 102218
57 Ga0209233_1000030 3300025261 Bacteria 636702
58 Ga0209233_1016673 3300025261 Bacteria 2018
59 Ga0209455_1000317 3300025272 Bacteria 48015
60 Ga0209758_1008637 3300025297 Bacteria 6541
61 Ga0207647_10053199 3300025904 Bacteria 2496
62 Ga0207705_10085130 3300025909 Bacteria 2309
63 Ga0207671_10095065 3300025914 Bacteria 2250
64 Ga0207671_10586087 3300025914 Bacteria 889
65 Ga0207657_10131743 3300025919 Bacteria 2048
66 Ga0207649_10100108 3300025920 Bacteria 1916
67 Ga0207694_10047800 3300025924 Bacteria 3309
68 Ga0207650_10000206 3300025925 Bacteria 67660
69 Ga0207709_10230131 3300025935 Bacteria 1342
70 Ga0207669_10391888 3300025937 Bacteria 1085
71 Ga0207678_10095428 3300026067 Bacteria 2542
72 Ga0207702_10118579 3300026078 Bacteria 2365
73 Ga0207648_10216498 3300026089 Bacteria 1701
74 Ga0207674_10286585 3300026116 Bacteria 1595
75 Ga0207698_10039501 3300026142 Bacteria 3497
76 Ga0268266_10006863 3300028379 Bacteria 10364
77 Ga0268266_10328577 3300028379 Bacteria 1433
78 Ga0307515_10236635 3300028794 Bacteria 1606
79 Ga0307406_10135757 3300031901 Bacteria 1734
80 Ga0307412_10062171 3300031911 Bacteria 2513
81 Ga0373941_0146923 3300035115 Bacteria 862
82 Ga0316582_0400590 3300036647 Bacteria 945
83 Ga0395899_0000107 3300037312 Bacteria 144087
84 Ga0395899_0204506 3300037312 Bacteria 1375
85 Ga0395899_0431150 3300037312 Bacteria 867
86 Ga0395900_0000101 3300037418 Bacteria 153550
87 Ga0395900_0072399 3300037418 Bacteria 3543
88 Ga0395900_0235140 3300037418 Bacteria 1841
89 Ga0395900_0338867 3300037418 Bacteria 1480
90 Ga0395898_0000043 3300037466 Bacteria 301783
91 Ga0395905_0000101 3300037471 Bacteria 144115
92 Ga0395905_0031687 3300037471 Bacteria 4974
93 Ga0395905_0467185 3300037471 Bacteria 1160
94 Ga0395901_0000068 3300038443 Bacteria 144095
95 Ga0395901_0017499 3300038443 Bacteria 7316
96 Ga0395901_0073030 3300038443 Bacteria 3577
97 Ga0395901_0719161 3300038443 Bacteria 994
98 Ga0395901_0760544 3300038443 Bacteria 961
99 Ga0439465_0011396 3300041413 Bacteria 2791
100 Ga0439465_0062459 3300041413 Bacteria 1236
101 Ga0439458_0039188 3300042157 Bacteria 1146
102 Ga0466972_0191942 3300044658 Bacteria 957
103 Ga0495638_0077066 3300046460 Bacteria 2030
104 Ga0495585_0071516 3300046492 Bacteria 1891
105 Ga0495607_0245999 3300046501 Bacteria 863
106 Ga0495606_0125600 3300046507 Bacteria 1530
107 Ga0495610_0238165 3300046512 Bacteria 727
108 Ga0495620_0018495 3300046515 Bacteria 3450
109 Ga0495643_0070443 3300046522 Bacteria 1836
110 Ga0495668_0302270 3300046616 Bacteria 877
111 Ga0495625_0326013 3300046660 Bacteria 977
112 Ga0495649_0175297 3300046694 Bacteria 1121
113 Ga0495687_087626 3300047443 Bacteria 1201
114 Ga0495626_0021386 3300048091 Bacteria 3210
115 Ga0496106_0528809 3300048909 Bacteria 947
116 Ga0496109_0574287 3300048912 Bacteria 1063
117 Ga0496112_0063240 3300048915 Bacteria 3650
118 Ga0496112_0817549 3300048915 Bacteria 856
119 Ga0496113_0415043 3300048916 Bacteria 1081
120 Ga0496115_0251823 3300048918 Bacteria 1454
121 Ga0496116_0000026 3300048919 Bacteria 450803
122 Ga0496117_0161548 3300048920 Bacteria 1312
123 Ga0496119_0026449 3300048922 Bacteria 4023
124 Ga0496119_0082358 3300048922 Bacteria 1851
125 Ga0496119_0173222 3300048922 Bacteria 1138
126 Ga0496120_0000550 3300048923 Bacteria 57310
127 Ga0496121_0186828 3300048924 Bacteria 1490
128 Ga0496124_0109416 3300048927 Bacteria 2227
129 Ga0496126_0000059 3300048929 Bacteria 267449
130 Ga0496126_0062938 3300048929 Bacteria 3327
131 Ga0496126_0233414 3300048929 Bacteria 1540
132 Ga0501031_0000016 3300049568 Bacteria 110858
133 Ga0501031_0009606 3300049568 Bacteria 6298
134 Ga0501032_0000029 3300049569 Bacteria 130865
135 Ga0501032_0000044 3300049569 Bacteria 110899
136 Ga0501032_0085875 3300049569 Bacteria 2091
137 Ga0501033_0000052 3300049570 Bacteria 110545
138 Ga0501033_0000168 3300049570 Bacteria 62921
139 Ga0501033_0011017 3300049570 Bacteria 6924
140 Ga0501034_0000212 3300049571 Bacteria 110795
141 Ga0501034_0000434 3300049571 Bacteria 69367
142 Ga0501034_0000675 3300049571 Bacteria 51860
143 Ga0501034_0049092 3300049571 Bacteria 4259
144 Ga0501034_0062180 3300049571 Bacteria 3749
145 Ga0501034_0067777 3300049571 Bacteria 3580
146 Ga0501034_0073976 3300049571 Bacteria 3416
147 Ga0501034_0211503 3300049571 Bacteria 1894
148 Ga0501034_0396048 3300049571 Bacteria 1304
149 Ga0501034_0409368 3300049571 Bacteria 1278
150 Ga0501034_0533278 3300049571 Bacteria 1084
151 Ga0501036_0000022 3300049572 Bacteria 111251
152 Ga0501036_0000533 3300049572 Bacteria 27318
153 Ga0501036_0411438 3300049572 Bacteria 1128
154 Ga0501036_0520189 3300049572 Bacteria 989
155 Ga0501036_0736809 3300049572 Bacteria 813
156 Ga0501037_0000052 3300049573 Bacteria 110932
157 Ga0501037_0000335 3300049573 Bacteria 39826
158 Ga0501037_0265191 3300049573 Bacteria 1199
159 Ga0501038_0000044 3300049574 Bacteria 110876
160 Ga0501038_0000275 3300049574 Bacteria 43504
161 Ga0501039_0000040 3300049575 Bacteria 115567
162 Ga0501039_0000042 3300049575 Bacteria 113008
163 Ga0501039_0084115 3300049575 Bacteria 2478
164 Ga0501040_0071078 3300049576 Bacteria 2402
165 Ga0501043_0000054 3300049579 Bacteria 105924
166 Ga0501043_0000236 3300049579 Bacteria 49931
167 Ga0501046_0018499 3300049580 Bacteria 5795
168 Ga0501046_0019865 3300049580 Bacteria 5564
169 Ga0501046_0132560 3300049580 Bacteria 1889
170 Ga0501047_0000838 3300049581 Bacteria 31753
171 Ga0501047_0045832 3300049581 Bacteria 4227
172 Ga0501047_0096030 3300049581 Bacteria 2842
173 Ga0501047_0270274 3300049581 Bacteria 1546
174 Ga0501047_0618943 3300049581 Bacteria 903
175 Ga0501047_0741095 3300049581 Bacteria 799
176 Ga0501048_0110120 3300049582 Bacteria 1944
177 Ga0501067_0055009 3300049583 Bacteria 2205
178 Ga0501067_0279604 3300049583 Bacteria 929
179 Ga0501068_0357120 3300049584 Bacteria 940
180 Ga0501069_0013189 3300049585 Bacteria 4404
181 Ga0501070_0005587 3300049586 Bacteria 10729
182 Ga0501070_0108673 3300049586 Bacteria 2291
183 Ga0501070_0213963 3300049586 Bacteria 1581
184 Ga0501070_0230793 3300049586 Bacteria 1516
185 Ga0501071_0281956 3300049587 Bacteria 1257
186 Ga0501073_0019232 3300049589 Bacteria 4934
187 Ga0501074_0165013 3300049590 Bacteria 1581
188 Ga0501080_0029481 3300049742 Bacteria 5109
189 Ga0501083_0161299 3300049744 Bacteria 1467
190 Ga0501035_0000095 3300049822 Bacteria 110735
191 Ga0501035_0000557 3300049822 Bacteria 41380
192 Ga0501035_0010601 3300049822 Bacteria 8535
193 Ga0501035_0024027 3300049822 Bacteria 5592
194 Ga0501035_0430182 3300049822 Bacteria 1095
195 Ga0501044_0000091 3300049823 Bacteria 111251
196 Ga0501044_0049026 3300049823 Bacteria 4359
197 Ga0501044_0604421 3300049823 Bacteria 989
198 Ga0501045_0024565 3300049824 Bacteria 4327
199 Ga0501045_0441729 3300049824 Bacteria 967
200 nmdc:mga03683_102904_c1 3300050489 Bacteria 1256
201 nmdc:mga03n38_164853_c1 3300050490 Bacteria 1124
202 nmdc:mga03n38_2162_c1 3300050490 Bacteria 5984
203 nmdc:mga00v17_240302_c1 3300050491 Bacteria 1174
204 nmdc:mga00v17_50366_c1 3300050491 Bacteria 2530
205 nmdc:mga0yw44_18556_c1 3300050492 Bacteria 3814
206 nmdc:mga0yw44_3221_c1 3300050492 Bacteria 7188
207 nmdc:mga0yw44_44476_c1 3300050492 Bacteria 2656
208 nmdc:mga0yw44_76857_c1 3300050492 Bacteria 2085
209 nmdc:mga06z11_286545_c1 3300050494 Bacteria 977
210 nmdc:mga07m45_132795_c1 3300050496 Bacteria 1440
211 nmdc:mga07m45_26378_c1 3300050496 Bacteria 3194
212 nmdc:mga0sz30_43781_c1 3300050516 Bacteria 1885
213 Ga0500610_0019125 3300053079 Bacteria 3324
214 Ga0500562_030317 3300053108 Bacteria 1425
215 Ga0500568_0000232 3300053139 Bacteria 47704
216 Ga0500604_0046096 3300053151 Bacteria 1332
217 Ga0500616_0040621 3300053153 Bacteria 2501
218 Ga0500616_0099290 3300053153 Bacteria 1426
219 Ga0500620_000326 3300053155 Bacteria 8995
220 Ga0500620_075234 3300053155 Bacteria 1165
221 Ga0501084_0515955 3300054114 Bacteria 1010
222 2503199645 2503198000 Bacteria 6884444
223 2509115160 2508501123 Bacteria 6283661
224 2509142727 2508501127 Bacteria 7037543
225 2509371085 2509276018 Bacteria 6910194
226 2509394571 2509276022 Bacteria 6200534
227 2510319199 2510065059 Bacteria 6847884
228 2511392238 2511231027 Bacteria 5013807
229 2512932953 2512875016 Bacteria 6529530
230 2512960974 2512875024 Bacteria 7195110
231 2514038506 2513237164 Bacteria 7563725
232 2514416907 2513237305 Bacteria 7293571
233 2514587214 2513237351 Bacteria 6968952
234 2588519006 2588253730 Bacteria 6881675
235 2597811320 2597489875 Bacteria 7010078
236 2599939012 2599185301 Bacteria 6161860
237 2617385015 2617270742 Bacteria 6808054
238 2643770043 2643221550 Bacteria 4619371
239 2643776822 2643221551 Bacteria 3750538
240 2643795270 2643221555 Bacteria 3749717
241 2643840223 2643221564 Bacteria 4193379
242 2643854106 2643221568 Bacteria 5187270
243 2643986040 2643221595 Bacteria 6565519
244 2644130783 2643221623 Bacteria 5239945
245 2644153606 2643221627 Bacteria 6761570
246 2644169413 2643221629 Bacteria 5850260
247 2644194058 2643221634 Bacteria 6705461
248 2644350810 2643221662 Bacteria 5851492
249 2688596893 2687453392 Bacteria 6880454
250 2694629220 2693429783 Bacteria 7019804
251 2694637914 2693429784 Bacteria 7241525
252 2723574015 2721755686 Bacteria 7343952
253 2739310357 2738543024 Bacteria 5603683
254 2756670835 2756170246 Bacteria 7451806
255 2757570570 2757320392 Bacteria 3737298
256 2765467931 2765235802 Bacteria 5618596
257 2770198570 2767802442 Bacteria 5747986
258 2776270112 2775506902 Bacteria 6208009
259 2776281225 2775506904 Bacteria 5954060
260 2792748354 2791355123 Bacteria 8049106
261 2819611071 2818991448 Bacteria 6772224
262 2837653979 2837651117 Bacteria 3772164
263 2838030757 2838029111 Bacteria 6603031
264 2839997881 2839993093 Bacteria 5512535
265 2840765519 2840764183 Bacteria 6358399
266 2841737386 2841734538 Bacteria 6784580
267 2842875883 2842871566 Bacteria 4827117
268 2844009079 2844002411 Bacteria 7168230
269 2844012240 2844009547 Bacteria 6728125
270 2847674652 2847670302 Bacteria 6165597
271 2847690776 2847686936 Bacteria 6278406
272 2856317462 2856314179 Bacteria 6477897
273 2856322728 2856320880 Bacteria 7263508
274 2856328805 2856328259 Bacteria 6528202
275 2856336777 2856334872 Bacteria 7037011
276 2856346055 2856342000 Bacteria 7176905
277 2856351514 2856349417 Bacteria 6230045
278 2856366764 2856364286 Bacteria 6939991
279 2857356553 2857349434 Bacteria 7926032
280 2857374743 2857367948 Bacteria 6965560
281 2869165202 2869162929 Bacteria 6399702
282 2869174280 2869169390 Bacteria 6659796
283 2869237250 2869234852 Bacteria 6654993
284 2869247141 2869242130 Bacteria 6609239
285 2869250850 2869249662 Bacteria 6868783
286 2869258889 2869256925 Bacteria 6981691
287 2869264460 2869264136 Bacteria 6880765
288 2869276805 2869271264 Bacteria 6908218
289 2869285754 2869278585 Bacteria 7077053
290 2869287825 2869285874 Bacteria 6901219
291 2871435773 2871429161 Bacteria 6547891
292 2871443142 2871435913 Bacteria 6880295
293 2871454587 2871451962 Bacteria 7336357
294 2871474234 2871466892 Bacteria 6923287
295 2871478867 2871474448 Bacteria 6806570
296 2871487854 2871481445 Bacteria 6700002
297 2871489951 2871488783 Bacteria 6929816
298 2871498073 2871495908 Bacteria 6935695
299 2874104568 2874102143 Bacteria 6342645
300 2874110477 2874109183 Bacteria 6517025
301 2874128866 2874123672 Bacteria 7238285
302 2874141932 2874139085 Bacteria 7021506
303 2874151457 2874146452 Bacteria 7533118
304 2874159090 2874155637 Bacteria 6724144
305 2874167649 2874162495 Bacteria 6174670
306 2874175643 2874168670 Bacteria 8062617
307 2876364801 2876363079 Bacteria 6544991
308 2876371392 2876369609 Bacteria 6807521
309 2876385297 2876377896 Bacteria 6565995
310 2876387711 2876386047 Bacteria 6698674
311 2876396142 2876392853 Bacteria 6660880
312 2876404742 2876399893 Bacteria 6927900
313 2876417509 2876413966 Bacteria 6831344
314 2876423456 2876420981 Bacteria 6687741
315 2878038500 2878035449 Bacteria 6555736
316 2878733848 2878730984 Bacteria 6380721
317 2878739329 2878738818 Bacteria 7136951
318 2878749336 2878745973 Bacteria 6867388
319 2878754481 2878753008 Bacteria 6922523
320 2878762295 2878760144 Bacteria 6823465
321 2878769262 2878767105 Bacteria 6898628
322 2878774889 2878774303 Bacteria 6108671
323 2878786338 2878781027 Bacteria 6834456
324 2878796715 2878788777 Bacteria 6567085
325 2881149476 2881147464 Bacteria 7779814
326 2881160674 2881155292 Bacteria 6461656
327 2881166367 2881161766 Bacteria 7127907
328 2881847391 2881845957 Bacteria 6611900
329 2881856120 2881853255 Bacteria 6698367
330 2881864935 2881861095 Bacteria 7128710
331 2882634140 2882632389 Bacteria 8154593
332 2882913160 2882912400 Bacteria 6801539
333 2885307804 2885305155 Bacteria 7348390
334 2885313202 2885312484 Bacteria 6415165
335 2885318951 2885318864 Bacteria 6729568
336 2885334028 2885326080 Bacteria 7134805
337 2885350018 2885342637 Bacteria 7011821
338 2885354957 2885350715 Bacteria 6787678
339 2888338018 2888337043 Bacteria 6629336
340 2888345317 2888343758 Bacteria 6611049
341 2888354607 2888350351 Bacteria 7372807
342 2889016216 2889010040 Bacteria 6749192
343 2889018748 2889016732 Bacteria 6700763
344 2894654196 2894652903 Bacteria 4587256
345 2903449213 2903448605 Bacteria 7357801
346 2903497686 2903492973 Bacteria 13473544
347 2903504196 2903492973 Bacteria 13473544
348 2903518103 2903513507 Bacteria 6344008
349 2903522463 2903521522 Bacteria 6525694
350 2903528842 2903528002 Bacteria 6586099
351 2903542871 2903540706 Bacteria 7062119
352 2904580457 2904578770 Bacteria 5302906
353 2904662918 2904659560 Bacteria 6685615
354 2906310374 2906308376 Bacteria 6841989
355 2906324439 2906321335 Bacteria 6579571
356 2906333240 2906328253 Bacteria 6585166
357 2906370344 2906363423 Bacteria 6856682
358 2906377944 2906370794 Bacteria 6881062
359 2906379221 2906378014 Bacteria 6911440
360 2906386869 2906386501 Bacteria 5977019
361 2906399059 2906393657 Bacteria 6790866
362 2906405705 2906401398 Bacteria 6693206
363 2906412904 2906408224 Bacteria 6162342
364 2906417527 2906414383 Bacteria 6580790
365 2906435878 2906427513 Bacteria 6375796
366 2919119866 2919119836 Bacteria 5208557
367 2919168494 2919166419 Bacteria 4952238
368 2922154017 2922151315 Bacteria 6902399
369 2922161683 2922158528 Bacteria 6573167
370 2922173370 2922172374 Bacteria 6167644
371 2922192105 2922185730 Bacteria 7113964
372 2924716461 2924710171 Bacteria 6752351
373 2924720506 2924718760 Bacteria 6331356
374 2924729313 2924726620 Bacteria 6271473
375 2924734009 2924733363 Bacteria 7574837
376 2924748270 2924741084 Bacteria 6661321
377 2924748464 2924748358 Bacteria 6154725
378 2924756345 2924754689 Bacteria 6774424
379 2924769240 2924762789 Bacteria 6561353
380 2924776850 2924776078 Bacteria 7492003
381 2924790131 2924784321 Bacteria 7416538
382 2937817202 2937813078 Bacteria 7783518
383 2937826865 2937822353 Bacteria 7290551
384 2937840684 2937836603 Bacteria 6811263
385 2937855392 2937848649 Bacteria 6983481
386 2937862313 2937861824 Bacteria 6660327
387 2937869591 2937868953 Bacteria 6639878
388 2937883549 2937877337 Bacteria 7246526
389 2937897844 2937891427 Bacteria 6357007
390 2937973472 2937972304 Bacteria 7532020
391 2937987439 2937980651 Bacteria 6517427
392 2937996721 2937994558 Bacteria 7036190
393 2938014939 2938014810 Bacteria 6700592
394 2958041769 2958034702 Bacteria 6989922
395 2958043389 2958041894 Bacteria 13082850
396 2958050300 2958041894 Bacteria 13082850
397 2958065875 2958064165 Bacteria 7158582
398 2958073682 2958071322 Bacteria 6815895
399 2958090717 2958084443 Bacteria 7312792
400 2958098633 2958092219 Bacteria 6861151
401 2958106413 2958100919 Bacteria 6800575
402 2958110684 2958108152 Bacteria 6681128
403 2958120829 2958115193 Bacteria 6923548
404 2958124261 2958122699 Bacteria 7280457
405 2958132229 2958130278 Bacteria 6897202
406 2958138736 2958137437 Bacteria 6050276
407 2958144991 2958144490 Bacteria 6677056
408 2958160938 2958158011 Bacteria 6058449
409 2958167193 2958165035 Bacteria 6906348
410 2958176548 2958172287 Bacteria 6716688
411 2958182043 2958179912 Bacteria 6874908
412 2961079887 2961077736 Bacteria 7079850
413 2961117944 2961114664 Bacteria 6680456
414 2961134758 2961127735 Bacteria 7196641
415 2961165662 2961163497 Bacteria 6901077
416 2961171911 2961170736 Bacteria 7072258
417 2961189555 2961183825 Bacteria 6688536
418 2963646257 2963644680 Bacteria 6530403
419 2965020485 2965018300 Bacteria 6883036
420 2965025721 2965025482 Bacteria 6532201
421 2965039872 2965032056 Bacteria 6887443
422 2965042138 2965040258 Bacteria 6855979
423 2965049571 2965047637 Bacteria 6623551
424 2965064838 2965062239 Bacteria 7412989
425 2965089708 2965089291 Bacteria 6866420
426 2965109124 2965102966 Bacteria 6800987
427 2965115109 2965110997 Bacteria 6693150
428 2965124274 2965119406 Bacteria 6956431
429 2967997018 2967996073 Bacteria 6787468
430 2968005079 2968003550 Bacteria 6929263
431 2968016733 2968016561 Bacteria 7022047
432 2968085276 2968083720 Bacteria 7351627
433 2968091394 2968091066 Bacteria 6052692
434 2968099073 2968097103 Bacteria 6107094
435 2968114005 2968110612 Bacteria 6814636
436 2968123195 2968117919 Bacteria 6536078
437 2968129016 2968128360 Bacteria 6270294
438 2968143670 2968138860 Bacteria 6605449
439 2968174064 2968171901 Bacteria 6894245
440 2970470075 2970469710 Bacteria 6969209
441 2970490505 2970489779 Bacteria 6517260
442 2970504509 2970503327 Bacteria 7099517
443 2970515132 2970510686 Bacteria 7006402
444 2970527025 2970524798 Bacteria 6840927
445 2970535581 2970532167 Bacteria 6553173
446 2970545711 2970540015 Bacteria 6977556
447 2970554738 2970547951 Bacteria 6931819
448 2970557150 2970554993 Bacteria 6814252
449 2970600370 2970593180 Bacteria 7073582
450 2970623057 2970619444 Bacteria 6986144
451 2970630710 2970627176 Bacteria 6680862
452 2977823698 2977821940 Bacteria 6906439
453 2977833146 2977828996 Bacteria 7007971
454 2977847491 2977843712 Bacteria 6753583
455 2977852070 2977851361 Bacteria 6694324
456 2977864843 2977858184 Bacteria 6215359
457 2977866786 2977864932 Bacteria 7534097
458 2977878844 2977872689 Bacteria 7270173
459 2977899152 2977898635 Bacteria 6675551
460 2977909547 2977907340 Bacteria 6577984
461 2977922594 2977915119 Bacteria 6829656
462 2977928902 2977922695 Bacteria 6956781
463 2977940568 2977935797 Bacteria 6252826
464 2977943121 2977942078 Bacteria 7570577
465 2977956610 2977950692 Bacteria 6893264
466 2977959866 2977957713 Bacteria 6877875
467 2977979572 2977971508 Bacteria 7472917
468 2977990187 2977986579 Bacteria 6581278
469 2978971177 2978969890 Bacteria 5400756
470 2979712313 2979710463 Bacteria 6785254
471 2979769139 2979764755 Bacteria 6610066
472 2979799756 2979793036 Bacteria 6808957
473 2979809146 2979808191 Bacteria 7179355
474 2984588327 2984587000 Bacteria 5263363
475 2987643833 2987636660 Bacteria 8088555
476 2987647002 2987645492 Bacteria 6117018
477 2987659082 2987652177 Bacteria 6969023
478 2987661670 2987659509 Bacteria 6966464
479 2987672416 2987666974 Bacteria 6509233
480 2987674767 2987673487 Bacteria 6884027
481 2996313427 2996310559 Bacteria 6357320
482 2996347870 2996341866 Bacteria 6643098
483 2996352996 2996348954 Bacteria 7239054
484 2996391821 2996386984 Bacteria 6978667
485 3000141287 3000135777 Bacteria 6891109
486 3002141194 3002141150 Bacteria 5254435
487 3004174408 3004167301 Bacteria 8330599
488 3004190719 3004188549 Bacteria 6952365
489 3004199971 3004195979 Bacteria 6776956
490 3004207982 3004203850 Bacteria 7307914
491 3004211548 3004211236 Bacteria 7417683
492 3004224903 3004218560 Bacteria 7421728
493 3004233475 3004232784 Bacteria 6662140
494 3004251779 3004248173 Bacteria 6563236
495 3004270006 3004268573 Bacteria 7043476
496 3004279678 3004275668 Bacteria 7114440
497 3004293683 3004289098 Bacteria 6135450
498 3004336161 3004334049 Bacteria 8449246
499 637076033 637000159 Bacteria 7596297
500 649871452 649633066 Bacteria 6690028
501 8002290159 8002285264 Bacteria 6717907
502 8004302879 8004300914 Bacteria 6132239
503 8004315480 8004312739 Bacteria 7444653
504 8004366180 8004361976 Bacteria 6858373
505 8004376057 8004374579 Bacteria 6898112
506 8004389613 8004387939 Bacteria 7049250
507 8004398625 8004395343 Bacteria 6620908
508 8004449989 8004445564 Bacteria 6322258
509 8004636772 8004633249 Bacteria 6723080
510 8004645465 8004640170 Bacteria 6723001
511 8004705624 8004703790 Bacteria 8006957
512 8004718010 8004714634 Bacteria 6776161
513 8004730719 8004727605 Bacteria 6643904
514 8005490122 8005484373 Bacteria 6297373
515 8005646779 8005645114 Bacteria 6950293
516 8005687638 8005682033 Bacteria 6726518
517 8055618889 8055617313 Bacteria 7548464
518 Ga0496115_0518316
519 JGI24739J22299_10005006
520 JGI25155J39150_1000010
521 JGI25156J39149_1000033
522 JGI25156J39149_1000186
523 JGI25154J39366_1000187
524 JGI25157J39369_1000009
525 JGI25165J46597_1000310
526 rootL2_10055145
527 rootH1_10196348
528 Ga0055542_1000373
529 Ga0055529_1003026
530 Ga0070670_100000117
531 Ga0070661_100394564
532 Ga0070663_100482404
533 Ga0068867_100340392
534 Ga0070665_100005352
535 Ga0070665_100177540
536 Ga0068855_100722154
537 Ga0068852_100060673
538 Ga0081455_10379135
539 Ga0081540_1029085
540 Ga0081539_10002004
541 Ga0075365_10003778
542 Ga0075365_10011265
543 Ga0075365_10052752
544 Ga0075365_10254545
545 Ga0075365_10324372
546 Ga0075368_10035760
547 Ga0075364_10010836
548 Ga0075364_10309585
549 Ga0075362_10070859
550 Ga0075367_10031249
551 Ga0075367_10186631
552 Ga0075367_10215334
553 Ga0075369_10098368
554 Ga0075366_10237426
555 Ga0075370_10085817
556 Ga0105243_10361117
557 Ga0105241_10248828
558 Ga0105237_10209565
559 Ga0105238_10071905
560 Ga0105249_10370665
561 Ga0105239_10081778
562 Ga0105239_10217685
563 Ga0105239_10865259
564 Ga0157371_10004449
565 Ga0157369_10068264
566 Ga0157369_10147193
567 Ga0182008_10038037
568 Ga0209435_100009
569 Ga0209646_1000018
570 Ga0209026_1000068
571 Ga0209148_1000069
572 Ga0209759_1000007
573 Ga0209759_1000183
574 Ga0209233_1000030
575 Ga0209233_1016673
576 Ga0209455_1000317
577 Ga0209758_1008637
578 Ga0207647_10053199
579 Ga0207705_10085130
580 Ga0207671_10095065
581 Ga0207671_10586087
582 Ga0207657_10131743
583 Ga0207649_10100108
584 Ga0207694_10047800
585 Ga0207650_10000206
586 Ga0207709_10230131
587 Ga0207669_10391888
588 Ga0207678_10095428
589 Ga0207702_10118579
590 Ga0207648_10216498
591 Ga0207674_10286585
592 Ga0207698_10039501
593 Ga0268266_10006863
594 Ga0268266_10328577
595 Ga0307515_10236635
596 Ga0307406_10135757
597 Ga0307412_10062171
598 Ga0373941_0146923
599 Ga0316582_0400590
600 Ga0395899_0000107
601 Ga0395899_0204506
602 Ga0395899_0431150
603 Ga0395900_0000101
604 Ga0395900_0072399
605 Ga0395900_0235140
606 Ga0395900_0338867
607 Ga0395898_0000043
608 Ga0395905_0000101
609 Ga0395905_0031687
610 Ga0395905_0467185
611 Ga0395901_0000068
612 Ga0395901_0017499
613 Ga0395901_0073030
614 Ga0395901_0719161
615 Ga0395901_0760544
616 Ga0439465_0011396
617 Ga0439465_0062459
618 Ga0439458_0039188
619 Ga0466972_0191942
620 Ga0495638_0077066
621 Ga0495585_0071516
622 Ga0495607_0245999
623 Ga0495606_0125600
624 Ga0495610_0238165
625 Ga0495620_0018495
626 Ga0495643_0070443
627 Ga0495668_0302270
628 Ga0495625_0326013
629 Ga0495649_0175297
630 Ga0495687_087626
631 Ga0495626_0021386
632 Ga0496106_0528809
633 Ga0496109_0574287
634 Ga0496112_0063240
635 Ga0496112_0817549
636 Ga0496113_0415043
637 Ga0496115_0251823
638 Ga0496116_0000026
639 Ga0496117_0161548
640 Ga0496119_0026449
641 Ga0496119_0082358
642 Ga0496119_0173222
643 Ga0496120_0000550
644 Ga0496121_0186828
645 Ga0496124_0109416
646 Ga0496126_0000059
647 Ga0496126_0062938
648 Ga0496126_0233414
649 Ga0501031_0000016
650 Ga0501031_0009606
651 Ga0501032_0000029
652 Ga0501032_0000044
653 Ga0501032_0085875
654 Ga0501033_0000052
655 Ga0501033_0000168
656 Ga0501033_0011017
657 Ga0501034_0000212
658 Ga0501034_0000434
659 Ga0501034_0000675
660 Ga0501034_0049092
661 Ga0501034_0062180
662 Ga0501034_0067777
663 Ga0501034_0073976
664 Ga0501034_0211503
665 Ga0501034_0396048
666 Ga0501034_0409368
667 Ga0501034_0533278
668 Ga0501036_0000022
669 Ga0501036_0000533
670 Ga0501036_0411438
671 Ga0501036_0520189
672 Ga0501036_0736809
673 Ga0501037_0000052
674 Ga0501037_0000335
675 Ga0501037_0265191
676 Ga0501038_0000044
677 Ga0501038_0000275
678 Ga0501039_0000040
679 Ga0501039_0000042
680 Ga0501039_0084115
681 Ga0501040_0071078
682 Ga0501043_0000054
683 Ga0501043_0000236
684 Ga0501046_0018499
685 Ga0501046_0019865
686 Ga0501046_0132560
687 Ga0501047_0000838
688 Ga0501047_0045832
689 Ga0501047_0096030
690 Ga0501047_0270274
691 Ga0501047_0618943
692 Ga0501047_0741095
693 Ga0501048_0110120
694 Ga0501067_0055009
695 Ga0501067_0279604
696 Ga0501068_0357120
697 Ga0501069_0013189
698 Ga0501070_0005587
699 Ga0501070_0108673
700 Ga0501070_0213963
701 Ga0501070_0230793
702 Ga0501071_0281956
703 Ga0501073_0019232
704 Ga0501074_0165013
705 Ga0501080_0029481
706 Ga0501083_0161299
707 Ga0501035_0000095
708 Ga0501035_0000557
709 Ga0501035_0010601
710 Ga0501035_0024027
711 Ga0501035_0430182
712 Ga0501044_0000091
713 Ga0501044_0049026
714 Ga0501044_0604421
715 Ga0501045_0024565
716 Ga0501045_0441729
717 nmdc:mga03683_102904_c1
718 nmdc:mga03n38_164853_c1
719 nmdc:mga03n38_2162_c1
720 nmdc:mga00v17_240302_c1
721 nmdc:mga00v17_50366_c1
722 nmdc:mga0yw44_18556_c1
723 nmdc:mga0yw44_3221_c1
724 nmdc:mga0yw44_44476_c1
725 nmdc:mga0yw44_76857_c1
726 nmdc:mga06z11_286545_c1
727 nmdc:mga07m45_132795_c1
728 nmdc:mga07m45_26378_c1
729 nmdc:mga0sz30_43781_c1
730 Ga0500610_0019125
731 Ga0500562_030317
732 Ga0500568_0000232
733 Ga0500604_0046096
734 Ga0500616_0040621
735 Ga0500616_0099290
736 Ga0500620_000326
737 Ga0500620_075234
738 Ga0501084_0515955
739 2503199645
740 2509115160
741 2509142727
742 2509371085
743 2509394571
744 2510319199
745 2511392238
746 2512932953
747 2512960974
748 2514038506
749 2514416907
750 2514587214
751 2588519006
752 2597811320
753 2599939012
754 2617385015
755 2643770043
756 2643776822
757 2643795270
758 2643840223
759 2643854106
760 2643986040
761 2644130783
762 2644153606
763 2644169413
764 2644194058
765 2644350810
766 2688596893
767 2694629220
768 2694637914
769 2723574015
770 2739310357
771 2756670835
772 2757570570
773 2765467931
774 2770198570
775 2776270112
776 2776281225
777 2792748354
778 2819611071
779 2837653979
780 2838030757
781 2839997881
782 2840765519
783 2841737386
784 2842875883
785 2844009079
786 2844012240
787 2847674652
788 2847690776
789 2856317462
790 2856322728
791 2856328805
792 2856336777
793 2856346055
794 2856351514
795 2856366764
796 2857356553
797 2857374743
798 2869165202
799 2869174280
800 2869237250
801 2869247141
802 2869250850
803 2869258889
804 2869264460
805 2869276805
806 2869285754
807 2869287825
808 2871435773
809 2871443142
810 2871454587
811 2871474234
812 2871478867
813 2871487854
814 2871489951
815 2871498073
816 2874104568
817 2874110477
818 2874128866
819 2874141932
820 2874151457
821 2874159090
822 2874167649
823 2874175643
824 2876364801
825 2876371392
826 2876385297
827 2876387711
828 2876396142
829 2876404742
830 2876417509
831 2876423456
832 2878038500
833 2878733848
834 2878739329
835 2878749336
836 2878754481
837 2878762295
838 2878769262
839 2878774889
840 2878786338
841 2878796715
842 2881149476
843 2881160674
844 2881166367
845 2881847391
846 2881856120
847 2881864935
848 2882634140
849 2882913160
850 2885307804
851 2885313202
852 2885318951
853 2885334028
854 2885350018
855 2885354957
856 2888338018
857 2888345317
858 2888354607
859 2889016216
860 2889018748
861 2894654196
862 2903449213
863 2903497686
864 2903504196
865 2903518103
866 2903522463
867 2903528842
868 2903542871
869 2904580457
870 2904662918
871 2906310374
872 2906324439
873 2906333240
874 2906370344
875 2906377944
876 2906379221
877 2906386869
878 2906399059
879 2906405705
880 2906412904
881 2906417527
882 2906435878
883 2919119866
884 2919168494
885 2922154017
886 2922161683
887 2922173370
888 2922192105
889 2924716461
890 2924720506
891 2924729313
892 2924734009
893 2924748270
894 2924748464
895 2924756345
896 2924769240
897 2924776850
898 2924790131
899 2937817202
900 2937826865
901 2937840684
902 2937855392
903 2937862313
904 2937869591
905 2937883549
906 2937897844
907 2937973472
908 2937987439
909 2937996721
910 2938014939
911 2958041769
912 2958043389
913 2958050300
914 2958065875
915 2958073682
916 2958090717
917 2958098633
918 2958106413
919 2958110684
920 2958120829
921 2958124261
922 2958132229
923 2958138736
924 2958144991
925 2958160938
926 2958167193
927 2958176548
928 2958182043
929 2961079887
930 2961117944
931 2961134758
932 2961165662
933 2961171911
934 2961189555
935 2963646257
936 2965020485
937 2965025721
938 2965039872
939 2965042138
940 2965049571
941 2965064838
942 2965089708
943 2965109124
944 2965115109
945 2965124274
946 2967997018
947 2968005079
948 2968016733
949 2968085276
950 2968091394
951 2968099073
952 2968114005
953 2968123195
954 2968129016
955 2968143670
956 2968174064
957 2970470075
958 2970490505
959 2970504509
960 2970515132
961 2970527025
962 2970535581
963 2970545711
964 2970554738
965 2970557150
966 2970600370
967 2970623057
968 2970630710
969 2977823698
970 2977833146
971 2977847491
972 2977852070
973 2977864843
974 2977866786
975 2977878844
976 2977899152
977 2977909547
978 2977922594
979 2977928902
980 2977940568
981 2977943121
982 2977956610
983 2977959866
984 2977979572
985 2977990187
986 2978971177
987 2979712313
988 2979769139
989 2979799756
990 2979809146
991 2984588327
992 2987643833
993 2987647002
994 2987659082
995 2987661670
996 2987672416
997 2987674767
998 2996313427
999 2996347870
1000 2996352996
1001 2996391821
1002 3000141287
1003 3002141194
1004 3004174408
1005 3004190719
1006 3004199971
1007 3004207982
1008 3004211548
1009 3004224903
1010 3004233475
1011 3004251779
1012 3004270006
1013 3004279678
1014 3004293683
1015 3004336161
1016 637076033
1017 649871452
1018 8002290159
1019 8004302879
1020 8004315480
1021 8004366180
1022 8004376057
1023 8004389613
1024 8004398625
1025 8004449989
1026 8004636772
1027 8004645465
1028 8004705624
1029 8004718010
1030 8004730719
1031 8005490122
1032 8005646779
1033 8005687638
1034 8055618889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00730

HhH-GPD

HhH-GPD superfamily base excision DNA repair protein

92

225

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4b21-assembly1.cif.gz_A unprecedented sculpting of dna at abasic sites by dna glycosylase homolog mag2 0.8932 8 198
3s6i-assembly1.cif.gz_A schizosaccaromyces pombe 3-methyladenine dna glycosylase (mag1) in complex with abasic-dna. 0.8887 12 206
6rlw-assembly1.cif.gz_AAA structure of the human 8-oxoguanine dna glycosylase hogg1 in complex with inhibitor th5487 0.8688 11 206
2noz-assembly1.cif.gz_A structure of q315f human 8-oxoguanine glycosylase distal crosslink to 8-oxoguanine dna 0.8644 11 200
2h56-assembly3.cif.gz_C crystal structure of dna-3-methyladenine glycosidase (10174367) from bacillus halodurans at 2.55 a resolution 0.8588 2 201
ID Description Score Start End Superfamily
af_Q92383_49_162_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9352 43 147 1.10.340.30
af_B4FZ58_120_231_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9254 42 145 1.10.340.30
2h56B02 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.9002 40 140 1.10.340.30
af_A0A1D8PI96_136_252_1.10.340.30 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.8991 43 144 1.10.340.30
1ebmA03 Mainly Alpha;Orthogonal Bundle;Endonuclease III; domain 1;Hypothetical protein; domain 2 0.896 43 147 1.10.340.30
ID Description Score Start End GO Terms
AF-A0A431NU12-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9864 25 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A6N7ZYX1-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.986 1 205 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A845Q7V6-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9826 1 201 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-E2CGX0-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9796 1 210 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916
AF-A0A6N1VIM7-F1-model_v4 DNA-3-methyladenine glycosylase II (EC 3.2.2.21) 0.9759 1 207 GO:0005737
GO:0006285
GO:0006307
GO:0008725
GO:0032131
GO:0032993
GO:0043916

Map