F457980

General Info

Members Datasets Scaffolds Average Seq Length
516 235 503 268

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100249002|Ga0068871_1002490021
Length 304
Sequence MQVAVRISPAKSRLYVNPIGQGVPRSRTVVTKAMWLATGLVACWLLATAALAQQPFIVVASTTSTEQSGLFPQLLPAFENDTGIKVRVVAVGTGQALDIGRRGDADVVLVHDRDAELKWLSEGEGVKRYPVMYNDFILVGPAADRAHVKGGKDITAALKAIADAKAWFISRADKSGTHAAELRLWKDAGVDIDTAKGPWYRETGFGMGAALNTATAMNAYILADRGTWLNFKNRGELGIVVEGDKRLFNQYGVMLVNPAKHPNVKKDLGQKFIDWLVSPRGQAVIAAYKIDGQQLFFPNAGTDS

Samples

Sample ID Description Type Environment
1 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
2 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
3 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
4 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
5 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
6 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
7 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
8 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
9 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
10 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
11 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
12 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
13 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
24 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
25 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
111 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
168 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
169 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
171 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
172 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
179 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
180 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
181 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
182 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
183 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
190 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
200 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
203 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
204 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
208 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
211 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
217 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
218 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
219 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
220 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
221 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
227 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
228 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
229 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
230 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
231 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
232 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
235 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0
Isolates 2.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.1
Nodule 2.52
Rhizoplane 5.04
Rhizosphere 87.79
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10039039 3300002077 Bacteria 891
2 JGI25153J46596_10000697 3300003215 Bacteria 20546
3 JGI25160J50197_1016718 3300003354 Bacteria 2352
4 Ga0055531_10001781 3300003794 Bacteria 15298
5 Ga0065712_10142291 3300005290 Bacteria 1439
6 Ga0065715_10169866 3300005293 Bacteria 1555
7 Ga0070658_10007510 3300005327 Bacteria 8797
8 Ga0070658_10165782 3300005327 Bacteria 1855
9 Ga0070658_10202078 3300005327 Bacteria 1677
10 Ga0070676_10024310 3300005328 Bacteria 3412
11 Ga0070676_10154802 3300005328 Bacteria 1470
12 Ga0070683_100015951 3300005329 Bacteria 6609
13 Ga0070683_100033050 3300005329 Bacteria 4714
14 Ga0070683_100033783 3300005329 Bacteria 4667
15 Ga0070683_100048106 3300005329 Bacteria 3943
16 Ga0070683_100094466 3300005329 Bacteria 2810
17 Ga0070690_100138468 3300005330 Bacteria 1650
18 Ga0070670_100616404 3300005331 Bacteria 972
19 Ga0070677_10000279 3300005333 Bacteria 17887
20 Ga0070677_10004604 3300005333 Bacteria 4509
21 Ga0068869_100018799 3300005334 Bacteria 4710
22 Ga0070666_10000909 3300005335 Bacteria 17984
23 Ga0070666_10009328 3300005335 Bacteria 6114
24 Ga0070680_100042347 3300005336 Bacteria 3695
25 Ga0070680_100244796 3300005336 Bacteria 1516
26 Ga0070680_100352506 3300005336 Bacteria 1251
27 Ga0070682_100226119 3300005337 Bacteria 1335
28 Ga0068868_100014717 3300005338 Bacteria 5770
29 Ga0070660_100003025 3300005339 Bacteria 11572
30 Ga0070660_100005144 3300005339 Bacteria 9042
31 Ga0070660_100013300 3300005339 Bacteria 5898
32 Ga0070689_100014090 3300005340 Bacteria 5799
33 Ga0070661_100006294 3300005344 Bacteria 8189
34 Ga0070661_100006707 3300005344 Bacteria 7942
35 Ga0070661_100018286 3300005344 Bacteria 4981
36 Ga0070661_100028394 3300005344 Bacteria 4035
37 Ga0070661_100095953 3300005344 Bacteria 2200
38 Ga0070661_100169268 3300005344 Bacteria 1658
39 Ga0070668_100006984 3300005347 Bacteria 8364
40 Ga0070675_100002259 3300005354 Bacteria 14291
41 Ga0070671_100007760 3300005355 Bacteria 8572
42 Ga0070671_100172141 3300005355 Bacteria 1831
43 Ga0070674_100007912 3300005356 Bacteria 6291
44 Ga0070674_100029928 3300005356 Bacteria 3595
45 Ga0070674_100247866 3300005356 Bacteria 1398
46 Ga0070673_100031152 3300005364 Bacteria 4000
47 Ga0070673_100137596 3300005364 Bacteria 2057
48 Ga0070673_100153650 3300005364 Bacteria 1951
49 Ga0070673_100198300 3300005364 Bacteria 1728
50 Ga0070673_100274453 3300005364 Bacteria 1477
51 Ga0070659_100006487 3300005366 Bacteria 8444
52 Ga0070659_100016986 3300005366 Bacteria 5470
53 Ga0070659_100024659 3300005366 Bacteria 4613
54 Ga0070667_100028719 3300005367 Bacteria 4631
55 Ga0070667_100068856 3300005367 Bacteria 3012
56 Ga0070667_100080563 3300005367 Bacteria 2785
57 Ga0070667_100149407 3300005367 Bacteria 2051
58 Ga0070714_100005916 3300005435 Bacteria 9386
59 Ga0070714_100026036 3300005435 Bacteria 4832
60 Ga0070714_100029982 3300005435 Bacteria 4526
61 Ga0070714_100090910 3300005435 Bacteria 2674
62 Ga0070714_100093841 3300005435 Bacteria 2633
63 Ga0070713_100331451 3300005436 Bacteria 1408
64 Ga0070710_10008802 3300005437 Bacteria 4923
65 Ga0070710_10049965 3300005437 Bacteria 2342
66 Ga0070701_10130416 3300005438 Bacteria 1428
67 Ga0070711_100528396 3300005439 Bacteria 976
68 Ga0070663_100004923 3300005455 Bacteria 7885
69 Ga0070663_100017836 3300005455 Bacteria 4641
70 Ga0070663_100026482 3300005455 Bacteria 3929
71 Ga0070663_100108957 3300005455 Bacteria 2078
72 Ga0070678_100005292 3300005456 Bacteria 7436
73 Ga0070662_100000176 3300005457 Bacteria 37127
74 Ga0070662_100213880 3300005457 Bacteria 1535
75 Ga0070681_10018775 3300005458 Bacteria 6920
76 Ga0070681_10019135 3300005458 Bacteria 6852
77 Ga0068867_100012504 3300005459 Bacteria 6008
78 Ga0068867_100061533 3300005459 Bacteria 2787
79 Ga0070679_100041004 3300005530 Bacteria 4608
80 Ga0070679_100059215 3300005530 Bacteria 3817
81 Ga0070679_100187306 3300005530 Bacteria 2039
82 Ga0070679_100506202 3300005530 Bacteria 1151
83 Ga0070684_100011072 3300005535 Bacteria 7175
84 Ga0070684_100051881 3300005535 Bacteria 3564
85 Ga0070684_100141909 3300005535 Bacteria 2172
86 Ga0070684_100200258 3300005535 Bacteria 1818
87 Ga0068853_100002699 3300005539 Bacteria 13382
88 Ga0068853_100018236 3300005539 Bacteria 5807
89 Ga0068853_100144886 3300005539 Bacteria 2134
90 Ga0068853_100151346 3300005539 Bacteria 2089
91 Ga0068853_100346231 3300005539 Bacteria 1382
92 Ga0070672_100004215 3300005543 Bacteria 9405
93 Ga0070672_100020336 3300005543 Bacteria 4840
94 Ga0070672_100232774 3300005543 Bacteria 1548
95 Ga0070696_100017753 3300005546 Bacteria 4804
96 Ga0070665_100001520 3300005548 Bacteria 26875
97 Ga0070665_100084139 3300005548 Bacteria 3186
98 Ga0068855_100000851 3300005563 Bacteria 37847
99 Ga0068855_100006879 3300005563 Bacteria 13795
100 Ga0068855_100007145 3300005563 Bacteria 13553
101 Ga0068855_100012156 3300005563 Bacteria 10402
102 Ga0068855_100067326 3300005563 Bacteria 4173
103 Ga0068855_100099998 3300005563 Bacteria 3340
104 Ga0068855_100176418 3300005563 Bacteria 2418
105 Ga0068855_100261101 3300005563 Bacteria 1929
106 Ga0070664_100002386 3300005564 Bacteria 15087
107 Ga0070664_100005097 3300005564 Bacteria 10539
108 Ga0070664_100020677 3300005564 Bacteria 5421
109 Ga0070664_100022515 3300005564 Bacteria 5196
110 Ga0070664_100078837 3300005564 Bacteria 2834
111 Ga0070664_100089381 3300005564 Bacteria 2665
112 Ga0068857_100006451 3300005577 Bacteria 10059
113 Ga0068857_100017532 3300005577 Bacteria 6278
114 Ga0068857_100034957 3300005577 Bacteria 4447
115 Ga0068857_100188771 3300005577 Bacteria 1877
116 Ga0068857_100201582 3300005577 Bacteria 1814
117 Ga0068857_100462109 3300005577 Bacteria 1188
118 Ga0068854_100021119 3300005578 Bacteria 4415
119 Ga0068854_100112741 3300005578 Bacteria 2053
120 Ga0068856_100001266 3300005614 Bacteria 26611
121 Ga0068856_100020324 3300005614 Bacteria 6450
122 Ga0068856_100021333 3300005614 Bacteria 6295
123 Ga0068856_100024124 3300005614 Bacteria 5918
124 Ga0068856_100104480 3300005614 Bacteria 2827
125 Ga0068856_100145280 3300005614 Bacteria 2380
126 Ga0068856_100293288 3300005614 Bacteria 1643
127 Ga0068856_100453037 3300005614 Bacteria 1304
128 Ga0068852_100009114 3300005616 Bacteria 7347
129 Ga0068852_100010673 3300005616 Bacteria 6877
130 Ga0068852_100028326 3300005616 Bacteria 4582
131 Ga0068852_100093796 3300005616 Bacteria 2691
132 Ga0068852_100151145 3300005616 Bacteria 2159
133 Ga0068852_100170130 3300005616 Bacteria 2042
134 Ga0068859_100207669 3300005617 Bacteria 2044
135 Ga0068859_100330232 3300005617 Bacteria 1619
136 Ga0068859_100356190 3300005617 Bacteria 1558
137 Ga0068864_100013666 3300005618 Bacteria 6732
138 Ga0068864_100667763 3300005618 Bacteria 1013
139 Ga0068866_10036483 3300005718 Bacteria 2409
140 Ga0068851_10000824 3300005834 Bacteria 13390
141 Ga0068851_10000909 3300005834 Bacteria 12750
142 Ga0068851_10004313 3300005834 Bacteria 6402
143 Ga0068851_10012042 3300005834 Bacteria 4071
144 Ga0068870_10006392 3300005840 Bacteria 5190
145 Ga0068870_10049631 3300005840 Bacteria 2214
146 Ga0068863_100017681 3300005841 Bacteria 6826
147 Ga0068858_100020003 3300005842 Bacteria 6261
148 Ga0068858_100134652 3300005842 Bacteria 2318
149 Ga0068858_100178331 3300005842 Bacteria 2005
150 Ga0068858_100497337 3300005842 Bacteria 1178
151 Ga0068858_100536522 3300005842 Bacteria 1132
152 Ga0068860_100033550 3300005843 Bacteria 4925
153 Ga0070717_10001296 3300006028 Bacteria 17113
154 Ga0075365_10007768 3300006038 Bacteria 6040
155 Ga0097621_100071118 3300006237 Bacteria 2874
156 Ga0097621_100099829 3300006237 Bacteria 2441
157 Ga0097621_100718796 3300006237 Bacteria 921
158 Ga0068871_100249002 3300006358 Bacteria 1547
159 Ga0075433_10062711 3300006852 Bacteria 3256
160 Ga0075434_100104946 3300006871 Bacteria 2836
161 Ga0075434_100375131 3300006871 Bacteria 1443
162 Ga0068865_100010976 3300006881 Bacteria 5653
163 Ga0068865_100071874 3300006881 Bacteria 2456
164 Ga0068865_100102558 3300006881 Bacteria 2097
165 Ga0075436_100006862 3300006914 Bacteria 7787
166 Ga0097620_100207657 3300006931 Bacteria 2044
167 Ga0097620_100330211 3300006931 Bacteria 1619
168 Ga0097620_100356202 3300006931 Bacteria 1558
169 Ga0099822_1003706 3300006943 Bacteria 19688
170 Ga0075435_100037211 3300007076 Bacteria 3873
171 Ga0075435_100193711 3300007076 Bacteria 1721
172 Ga0075435_100545862 3300007076 Bacteria 1003
173 Ga0105240_10000332 3300009093 Bacteria 88613
174 Ga0105240_10013728 3300009093 Bacteria 11101
175 Ga0105240_10033938 3300009093 Bacteria 6589
176 Ga0111539_10111532 3300009094 Bacteria 3209
177 Ga0105241_10003744 3300009174 Bacteria 11281
178 Ga0105241_10179466 3300009174 Bacteria 1755
179 Ga0105241_10242766 3300009174 Bacteria 1523
180 Ga0105242_10000453 3300009176 Bacteria 32663
181 Ga0105242_10180014 3300009176 Bacteria 1864
182 Ga0105248_10003684 3300009177 Bacteria 16977
183 Ga0105248_10121436 3300009177 Bacteria 2947
184 Ga0105248_10274503 3300009177 Bacteria 1898
185 Ga0105248_10338045 3300009177 Bacteria 1695
186 Ga0105248_10417514 3300009177 Bacteria 1511
187 Ga0105248_10507468 3300009177 Bacteria 1360
188 Ga0105237_10120603 3300009545 Bacteria 2617
189 Ga0105237_10122414 3300009545 Bacteria 2595
190 Ga0105238_10001058 3300009551 Bacteria 27802
191 Ga0105238_10011120 3300009551 Bacteria 9049
192 Ga0105238_10057303 3300009551 Bacteria 3907
193 Ga0105238_10062676 3300009551 Bacteria 3718
194 Ga0105249_10218552 3300009553 Bacteria 1874
195 Ga0105239_10050704 3300010375 Bacteria 4551
196 Ga0105239_10654926 3300010375 Bacteria 1200
197 Ga0105246_10220483 3300011119 Bacteria 1486
198 Ga0157373_10008042 3300013100 Bacteria 7837
199 Ga0157373_10257451 3300013100 Bacteria 1235
200 Ga0157371_10000194 3300013102 Bacteria 90011
201 Ga0157371_10061815 3300013102 Bacteria 2655
202 Ga0157370_10010640 3300013104 Bacteria 9683
203 Ga0157370_10052778 3300013104 Bacteria 3880
204 Ga0157370_10258626 3300013104 Bacteria 1609
205 Ga0157369_10011173 3300013105 Bacteria 10204
206 Ga0157369_10044614 3300013105 Bacteria 4824
207 Ga0157369_10082153 3300013105 Bacteria 3448
208 Ga0157369_10488040 3300013105 Bacteria 1275
209 Ga0157374_10103596 3300013296 Bacteria 2731
210 Ga0157374_10500702 3300013296 Bacteria 1219
211 Ga0157378_10127037 3300013297 Bacteria 2356
212 Ga0157378_10133221 3300013297 Bacteria 2302
213 Ga0157378_10365637 3300013297 Bacteria 1413
214 Ga0157378_10737650 3300013297 Bacteria 1007
215 Ga0163162_10014258 3300013306 Bacteria 7764
216 Ga0163162_10260323 3300013306 Bacteria 1866
217 Ga0163162_10334055 3300013306 Bacteria 1648
218 Ga0157372_10001272 3300013307 Bacteria 27282
219 Ga0157372_10003176 3300013307 Bacteria 17723
220 Ga0157372_10051946 3300013307 Bacteria 4563
221 Ga0157372_10067960 3300013307 Bacteria 4006
222 Ga0157372_10147182 3300013307 Bacteria 2716
223 Ga0157372_10159116 3300013307 Bacteria 2609
224 Ga0157372_10162389 3300013307 Bacteria 2582
225 Ga0157372_10644574 3300013307 Bacteria 1234
226 Ga0157375_10009192 3300013308 Bacteria 8664
227 Ga0157375_10062879 3300013308 Bacteria 3690
228 Ga0157375_10645665 3300013308 Bacteria 1215
229 Ga0163163_10058784 3300014325 Bacteria 3802
230 Ga0157380_10166869 3300014326 Bacteria 1920
231 Ga0157379_10016563 3300014968 Bacteria 6482
232 Ga0157379_10414012 3300014968 Bacteria 1240
233 Ga0157376_10008379 3300014969 Bacteria 7456
234 Ga0157376_10008591 3300014969 Bacteria 7380
235 Ga0163161_10035976 3300017792 Bacteria 3545
236 Ga0163161_10122912 3300017792 Bacteria 1952
237 Ga0207425_1016882 3300025245 Bacteria 1613
238 Ga0209564_1007414 3300025295 Bacteria 5673
239 Ga0209758_1000026 3300025297 Bacteria 582706
240 Ga0209758_1000097 3300025297 Bacteria 230529
241 Ga0209758_1060436 3300025297 Bacteria 1254
242 Ga0209256_1009481 3300025299 Bacteria 4262
243 Ga0207426_1013811 3300025302 Bacteria 2977
244 Ga0209257_1000201 3300025304 Bacteria 147272
245 Ga0207697_10002605 3300025315 Bacteria 9281
246 Ga0207697_10111055 3300025315 Bacteria 1174
247 Ga0207656_10007517 3300025321 Bacteria 3973
248 Ga0207656_10013274 3300025321 Bacteria 3144
249 Ga0207656_10023313 3300025321 Bacteria 2491
250 Ga0207682_10002556 3300025893 Bacteria 8121
251 Ga0207692_10101527 3300025898 Bacteria 1580
252 Ga0207688_10000438 3300025901 Bacteria 19706
253 Ga0207680_10018388 3300025903 Bacteria 3715
254 Ga0207647_10148290 3300025904 Bacteria 1372
255 Ga0207647_10185971 3300025904 Bacteria 1205
256 Ga0207645_10000139 3300025907 Bacteria 55848
257 Ga0207645_10011262 3300025907 Bacteria 6113
258 Ga0207643_10000089 3300025908 Bacteria 61020
259 Ga0207643_10046360 3300025908 Bacteria 2457
260 Ga0207705_10051043 3300025909 Bacteria 2978
261 Ga0207705_10149748 3300025909 Bacteria 1748
262 Ga0207705_10227890 3300025909 Bacteria 1417
263 Ga0207654_10075274 3300025911 Bacteria 2017
264 Ga0207654_10132439 3300025911 Bacteria 1579
265 Ga0207654_10340114 3300025911 Bacteria 1031
266 Ga0207707_10017469 3300025912 Bacteria 6255
267 Ga0207707_10046829 3300025912 Bacteria 3766
268 Ga0207707_10058218 3300025912 Bacteria 3363
269 Ga0207695_10041522 3300025913 Bacteria 4923
270 Ga0207695_10067902 3300025913 Bacteria 3655
271 Ga0207695_10211687 3300025913 Bacteria 1849
272 Ga0207671_10203410 3300025914 Bacteria 1547
273 Ga0207671_10346711 3300025914 Bacteria 1177
274 Ga0207660_10019993 3300025917 Bacteria 4487
275 Ga0207660_10059701 3300025917 Bacteria 2739
276 Ga0207660_10309179 3300025917 Bacteria 1260
277 Ga0207657_10000240 3300025919 Bacteria 58053
278 Ga0207657_10000803 3300025919 Bacteria 33281
279 Ga0207657_10005719 3300025919 Bacteria 12972
280 Ga0207657_10013201 3300025919 Bacteria 8110
281 Ga0207657_10013747 3300025919 Bacteria 7925
282 Ga0207657_10017881 3300025919 Bacteria 6784
283 Ga0207657_10151043 3300025919 Bacteria 1892
284 Ga0207649_10014372 3300025920 Bacteria 4431
285 Ga0207649_10018271 3300025920 Bacteria 3984
286 Ga0207649_10054193 3300025920 Bacteria 2495
287 Ga0207649_10155735 3300025920 Bacteria 1578
288 Ga0207649_10324659 3300025920 Bacteria 1132
289 Ga0207652_10076161 3300025921 Bacteria 2925
290 Ga0207652_10078076 3300025921 Bacteria 2890
291 Ga0207652_10187801 3300025921 Bacteria 1858
292 Ga0207652_10323114 3300025921 Bacteria 1393
293 Ga0207652_10554386 3300025921 Bacteria 1033
294 Ga0207681_10028259 3300025923 Bacteria 3632
295 Ga0207694_10002852 3300025924 Bacteria 13942
296 Ga0207694_10038187 3300025924 Bacteria 3692
297 Ga0207694_10045460 3300025924 Bacteria 3392
298 Ga0207694_10067024 3300025924 Bacteria 2802
299 Ga0207694_10095860 3300025924 Bacteria 2346
300 Ga0207650_10034392 3300025925 Bacteria 3675
301 Ga0207650_10102100 3300025925 Bacteria 2209
302 Ga0207659_10120452 3300025926 Bacteria 2010
303 Ga0207700_10193289 3300025928 Bacteria 1711
304 Ga0207664_10011033 3300025929 Bacteria 6401
305 Ga0207664_10051453 3300025929 Bacteria 3252
306 Ga0207664_10081637 3300025929 Bacteria 2631
307 Ga0207644_10007082 3300025931 Bacteria 7311
308 Ga0207644_10201383 3300025931 Bacteria 1570
309 Ga0207690_10057581 3300025932 Bacteria 2626
310 Ga0207690_10065109 3300025932 Bacteria 2491
311 Ga0207690_10223127 3300025932 Bacteria 1443
312 Ga0207690_10250389 3300025932 Bacteria 1368
313 Ga0207706_10000002 3300025933 Bacteria 360309
314 Ga0207706_10000456 3300025933 Bacteria 43575
315 Ga0207706_10043559 3300025933 Bacteria 3977
316 Ga0207706_10368169 3300025933 Bacteria 1248
317 Ga0207686_10174187 3300025934 Bacteria 1520
318 Ga0207670_10006537 3300025936 Bacteria 6472
319 Ga0207669_10004348 3300025937 Bacteria 6225
320 Ga0207704_10368178 3300025938 Bacteria 1124
321 Ga0207691_10000040 3300025940 Bacteria 106561
322 Ga0207691_10003578 3300025940 Bacteria 15125
323 Ga0207691_10009315 3300025940 Bacteria 9423
324 Ga0207711_10013697 3300025941 Bacteria 6732
325 Ga0207711_10305759 3300025941 Bacteria 1467
326 Ga0207711_10548073 3300025941 Bacteria 1079
327 Ga0207689_10001781 3300025942 Bacteria 20348
328 Ga0207661_10029815 3300025944 Bacteria 4194
329 Ga0207661_10067072 3300025944 Bacteria 2917
330 Ga0207679_10006221 3300025945 Bacteria 7538
331 Ga0207679_10018114 3300025945 Bacteria 4711
332 Ga0207679_10019867 3300025945 Bacteria 4524
333 Ga0207679_10031330 3300025945 Bacteria 3721
334 Ga0207679_10053421 3300025945 Bacteria 2969
335 Ga0207667_10011280 3300025949 Bacteria 10393
336 Ga0207667_10012368 3300025949 Bacteria 9838
337 Ga0207667_10021438 3300025949 Bacteria 7159
338 Ga0207667_10032823 3300025949 Bacteria 5589
339 Ga0207667_10033094 3300025949 Bacteria 5561
340 Ga0207667_10069071 3300025949 Bacteria 3678
341 Ga0207667_10103601 3300025949 Bacteria 2935
342 Ga0207651_10000966 3300025960 Bacteria 12704
343 Ga0207651_10077558 3300025960 Bacteria 2379
344 Ga0207651_10231415 3300025960 Bacteria 1500
345 Ga0207651_10432293 3300025960 Bacteria 1126
346 Ga0207712_10123539 3300025961 Bacteria 1962
347 Ga0207668_10008843 3300025972 Bacteria 6021
348 Ga0207668_10030829 3300025972 Bacteria 3527
349 Ga0207640_10018881 3300025981 Bacteria 4060
350 Ga0207640_10046229 3300025981 Bacteria 2800
351 Ga0207640_10132575 3300025981 Bacteria 1803
352 Ga0207658_10008367 3300025986 Bacteria 7042
353 Ga0207658_10045659 3300025986 Bacteria 3195
354 Ga0207658_10067571 3300025986 Bacteria 2693
355 Ga0207658_10081450 3300025986 Bacteria 2482
356 Ga0207658_10178271 3300025986 Bacteria 1757
357 Ga0207658_10223924 3300025986 Bacteria 1584
358 Ga0207658_10701591 3300025986 Bacteria 914
359 Ga0207677_10712024 3300026023 Bacteria 892
360 Ga0207703_10019682 3300026035 Bacteria 5275
361 Ga0207703_10134308 3300026035 Bacteria 2140
362 Ga0207639_10035409 3300026041 Bacteria 3694
363 Ga0207639_10052336 3300026041 Bacteria 3111
364 Ga0207639_10201975 3300026041 Bacteria 1705
365 Ga0207678_10001203 3300026067 Bacteria 23759
366 Ga0207678_10001320 3300026067 Bacteria 22902
367 Ga0207678_10005474 3300026067 Bacteria 11357
368 Ga0207678_10008360 3300026067 Bacteria 9126
369 Ga0207678_10023571 3300026067 Bacteria 5382
370 Ga0207678_10230294 3300026067 Bacteria 1586
371 Ga0207708_10000775 3300026075 Bacteria 24063
372 Ga0207702_10005409 3300026078 Bacteria 11176
373 Ga0207702_10016317 3300026078 Bacteria 6147
374 Ga0207702_10245138 3300026078 Bacteria 1680
375 Ga0207702_10322695 3300026078 Bacteria 1471
376 Ga0207702_10470102 3300026078 Bacteria 1222
377 Ga0207641_10213539 3300026088 Bacteria 1785
378 Ga0207648_10002404 3300026089 Bacteria 20161
379 Ga0207648_10007985 3300026089 Bacteria 10323
380 Ga0207648_10019772 3300026089 Bacteria 6076
381 Ga0207648_10059981 3300026089 Bacteria 3318
382 Ga0207676_10033173 3300026095 Bacteria 3899
383 Ga0207674_10000064 3300026116 Bacteria 109914
384 Ga0207674_10000237 3300026116 Bacteria 68721
385 Ga0207674_10083006 3300026116 Bacteria 3204
386 Ga0207674_10200138 3300026116 Bacteria 1947
387 Ga0207674_10226919 3300026116 Bacteria 1816
388 Ga0207675_100001078 3300026118 Bacteria 27027
389 Ga0207675_100452411 3300026118 Bacteria 1273
390 Ga0207683_10000059 3300026121 Bacteria 83666
391 Ga0207683_10009554 3300026121 Bacteria 8268
392 Ga0207683_10014708 3300026121 Bacteria 6664
393 Ga0207683_10039783 3300026121 Bacteria 4102
394 Ga0207698_10005749 3300026142 Bacteria 7694
395 Ga0207698_10012411 3300026142 Bacteria 5573
396 Ga0207698_10269044 3300026142 Bacteria 1570
397 Ga0209389_1000060 3300027296 Bacteria 106050
398 Ga0209589_1000015 3300027357 Bacteria 225913
399 Ga0209589_1000062 3300027357 Bacteria 106048
400 Ga0209969_1022618 3300027360 Bacteria 941
401 Ga0209489_100015 3300027361 Bacteria 225913
402 Ga0209489_103702 3300027361 Bacteria 29364
403 Ga0209700_100025 3300027363 Bacteria 225913
404 Ga0209995_1004767 3300027471 Bacteria 2178
405 Ga0209983_1003323 3300027665 Bacteria 3445
406 Ga0209971_1003271 3300027682 Bacteria 3851
407 Ga0209971_1029627 3300027682 Bacteria 1311
408 Ga0209974_10000662 3300027876 Bacteria 11657
409 Ga0209974_10031576 3300027876 Bacteria 1754
410 Ga0268266_10086274 3300028379 Bacteria 2744
411 Ga0268266_10262293 3300028379 Bacteria 1601
412 Ga0268264_10161622 3300028381 Bacteria 2018
413 Ga0265330_10000014 3300031235 Bacteria 175673
414 Ga0265332_10000011 3300031238 Bacteria 284299
415 Ga0265332_10004125 3300031238 Bacteria 6894
416 Ga0265325_10008886 3300031241 Bacteria 5902
417 Ga0265340_10013732 3300031247 Bacteria 4248
418 Ga0307408_100036177 3300031548 Bacteria 3469
419 Ga0307408_100268752 3300031548 Bacteria 1415
420 Ga0265314_10000026 3300031711 Bacteria 284299
421 Ga0265314_10003013 3300031711 Bacteria 16655
422 Ga0307413_10171462 3300031824 Bacteria 1536
423 Ga0307407_10034461 3300031903 Bacteria 2772
424 Ga0307416_100057753 3300032002 Bacteria 3141
425 Ga0373956_0074400 3300035119 Bacteria 1553
426 Ga0373937_0101719 3300036401 Bacteria 2667
427 Ga0373937_0312855 3300036401 Bacteria 1485
428 Ga0395899_0128331 3300037312 Bacteria 1812
429 Ga0395900_0011743 3300037418 Bacteria 8956
430 Ga0395900_0015947 3300037418 Bacteria 7656
431 Ga0395900_0058938 3300037418 Bacteria 3953
432 Ga0395900_0072140 3300037418 Bacteria 3550
433 Ga0395900_0205387 3300037418 Bacteria 1991
434 Ga0395898_0057482 3300037466 Bacteria 3790
435 Ga0395905_0000377 3300037471 Bacteria 63595
436 Ga0395905_0037335 3300037471 Bacteria 4562
437 Ga0395905_0540194 3300037471 Bacteria 1067
438 Ga0395901_0015978 3300038443 Bacteria 7648
439 Ga0395901_0026809 3300038443 Bacteria 5917
440 Ga0395901_0048127 3300038443 Bacteria 4428
441 Ga0395901_0351839 3300038443 Bacteria 1520
442 Ga0395901_0353987 3300038443 Bacteria 1515
443 Ga0395901_0645311 3300038443 Bacteria 1062
444 Ga0395901_0950203 3300038443 Bacteria 838
445 Ga0436365_1361131 3300039437 Bacteria 1709
446 Ga0451577_0000851 3300042876 Bacteria 45473
447 Ga0451577_0726820 3300042876 Bacteria 899
448 Ga0466969_0076759 3300044656 Bacteria 1599
449 Ga0466972_0044257 3300044658 Bacteria 2160
450 Ga0453683_0115078 3300044673 Bacteria 1692
451 Ga0466966_0002649 3300044684 Bacteria 11727
452 Ga0466961_0004698 3300044693 Bacteria 8587
453 Ga0466963_0171045 3300044694 Bacteria 1515
454 Ga0466963_0203555 3300044694 Bacteria 1385
455 Ga0453684_0001945 3300044712 Bacteria 53289
456 Ga0453684_0003131 3300044712 Bacteria 38095
457 Ga0466970_0019696 3300044765 Bacteria 3500
458 Ga0466959_0026963 3300045049 Bacteria 4261
459 Ga0466959_0477577 3300045049 Bacteria 844
460 Ga0451576_0005539 3300045051 Bacteria 15773
461 Ga0495580_0289611 3300046472 Bacteria 1116
462 Ga0495659_0106068 3300046664 Bacteria 1093
463 Ga0496101_0003156 3300048904 Bacteria 10200
464 Ga0496101_0289583 3300048904 Bacteria 1281
465 Ga0496102_0001341 3300048905 Bacteria 22071
466 Ga0496102_0019726 3300048905 Bacteria 5943
467 Ga0496102_0580692 3300048905 Bacteria 1044
468 Ga0496103_0060295 3300048906 Bacteria 2358
469 Ga0496105_0004030 3300048908 Bacteria 10992
470 Ga0496106_0006681 3300048909 Bacteria 8538
471 Ga0496106_0253922 3300048909 Bacteria 1406
472 Ga0496107_0006330 3300048910 Bacteria 8138
473 Ga0496107_0071999 3300048910 Bacteria 2512
474 Ga0496107_0193398 3300048910 Bacteria 1512
475 Ga0496107_0321892 3300048910 Bacteria 1151
476 Ga0496108_0019241 3300048911 Bacteria 5605
477 Ga0496109_0020734 3300048912 Bacteria 5805
478 Ga0496109_0136740 3300048912 Bacteria 2290
479 Ga0496110_0054590 3300048913 Bacteria 3514
480 Ga0496110_0165606 3300048913 Bacteria 2005
481 Ga0496111_0281687 3300048914 Bacteria 1233
482 Ga0496112_0006440 3300048915 Bacteria 10307
483 Ga0496112_0101990 3300048915 Bacteria 2839
484 Ga0496112_0269624 3300048915 Bacteria 1651
485 Ga0496113_0126987 3300048916 Bacteria 1998
486 Ga0496114_0010872 3300048917 Bacteria 7251
487 Ga0496114_0245064 3300048917 Bacteria 1577
488 Ga0496115_0012251 3300048918 Bacteria 6450
489 Ga0501036_0161993 3300049572 Bacteria 1886
490 Ga0501037_0080570 3300049573 Bacteria 2362
491 Ga0501038_0107728 3300049574 Bacteria 2312
492 Ga0501047_0154858 3300049581 Bacteria 2166
493 nmdc:mga0yw44_98881_c1 3300050492 Bacteria 1856
494 nmdc:mga08y16_581991_c1 3300050511 Bacteria 1130
495 nmdc:mga0n895_10713_c1 3300050512 Bacteria 8124
496 nmdc:mga0n895_14725_c1 3300050512 Bacteria 7113
497 nmdc:mga0rr50_142934_c1 3300050513 Bacteria 1926
498 nmdc:mga08x19_4952_c1 3300050514 Bacteria 7865
499 nmdc:mga0a205_32557_c1 3300050515 Bacteria 4998
500 Ga0495612_0155796 3300053078 Bacteria 996
501 Ga0500642_0015291 3300053130 Bacteria 2881
502 Ga0500603_028660 3300053150 Bacteria 1422
503 Ga0500616_0000038 3300053153 Bacteria 386801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005842 Ga0068858_100536522 Ga0068858_1005365221 213
2 3300038443 Ga0395901_0351839 Ga0395901_0351839_91_816 232
3 3300038443 Ga0395901_0950203 Ga0395901_0950203_84_809 232
4 3300045049 Ga0466959_0477577 Ga0466959_0477577_97_825 233
5 3300005435 Ga0070714_100029982 Ga0070714_1000299822 234
6 3300006028 Ga0070717_10001296 Ga0070717_1000129612 234
7 3300025929 Ga0207664_10051453 Ga0207664_100514533 234
8 3300031548 Ga0307408_100268752 Ga0307408_1002687522 236
9 3300005329 Ga0070683_100048106 Ga0070683_1000481062 237
10 3300005614 Ga0068856_100024124 Ga0068856_1000241245 237
11 3300005616 Ga0068852_100170130 Ga0068852_1001701302 237
12 3300005842 Ga0068858_100497337 Ga0068858_1004973372 237
13 3300009551 Ga0105238_10062676 Ga0105238_100626764 237
14 3300013100 Ga0157373_10008042 Ga0157373_100080424 237
15 3300013102 Ga0157371_10000194 Ga0157371_10000194100 237
16 3300013307 Ga0157372_10001272 Ga0157372_1000127226 237
17 3300025924 Ga0207694_10038187 Ga0207694_100381873 237
18 3300026142 Ga0207698_10269044 Ga0207698_102690442 237
19 3300031238 Ga0265332_10004125 Ga0265332_100041257 237
20 3300031548 Ga0307408_100036177 Ga0307408_1000361773 237
21 3300031711 Ga0265314_10003013 Ga0265314_100030136 237
22 3300037471 Ga0395905_0000377 Ga0395905_0000377_48819_49613 237
23 3300042876 Ga0451577_0000851 Ga0451577_0000851_16119_16955 237
24 3300044712 Ga0453684_0001945 Ga0453684_0001945_14499_15335 237
25 3300045051 Ga0451576_0005539 Ga0451576_0005539_10180_11016 237
26 3300046472 Ga0495580_0289611 Ga0495580_0289611_191_973 237
27 3300048904 Ga0496101_0289583 Ga0496101_0289583_27_797 237
28 3300005563 Ga0068855_100261101 Ga0068855_1002611012 238
29 3300005577 Ga0068857_100017532 Ga0068857_1000175322 238
30 3300006038 Ga0075365_10007768 Ga0075365_100077687 238
31 3300013297 Ga0157378_10127037 Ga0157378_101270372 238
32 3300026116 Ga0207674_10200138 Ga0207674_102001382 238
33 3300037418 Ga0395900_0058938 Ga0395900_0058938_2092_2889 238
34 3300037418 Ga0395900_0072140 Ga0395900_0072140_927_1724 238
35 3300037471 Ga0395905_0037335 Ga0395905_0037335_3678_4463 238
36 3300037471 Ga0395905_0540194 Ga0395905_0540194_171_968 238
37 3300038443 Ga0395901_0026809 Ga0395901_0026809_4977_5774 238
38 3300038443 Ga0395901_0048127 Ga0395901_0048127_1598_2395 238
39 3300039437 Ga0436365_1361131 Ga0436365_1361131_28_834 238
40 3300044656 Ga0466969_0076759 Ga0466969_0076759_487_1284 238
41 3300044684 Ga0466966_0002649 Ga0466966_0002649_5832_6629 238
42 3300044693 Ga0466961_0004698 Ga0466961_0004698_6983_7780 238
43 3300044765 Ga0466970_0019696 Ga0466970_0019696_1699_2496 238
44 3300045049 Ga0466959_0026963 Ga0466959_0026963_2887_3684 238
45 3300050492 nmdc:mga0yw44_98881_c1 nmdc:mga0yw44_98881_c1_414_1217 238
46 3300037312 Ga0395899_0128331 Ga0395899_0128331_901_1713 239
47 3300037466 Ga0395898_0057482 Ga0395898_0057482_140_952 239
48 3300038443 Ga0395901_0353987 Ga0395901_0353987_273_1085 239
49 3300038443 Ga0395901_0645311 Ga0395901_0645311_111_923 239
50 3300042876 Ga0451577_0726820 Ga0451577_0726820_40_858 239
51 3300044712 Ga0453684_0003131 Ga0453684_0003131_31825_32631 239
52 3300049573 Ga0501037_0080570 Ga0501037_0080570_77_886 239
53 3300049574 Ga0501038_0107728 Ga0501038_0107728_672_1481 239
54 3300049581 Ga0501047_0154858 Ga0501047_0154858_1179_1988 239
55 3300005530 Ga0070679_100041004 Ga0070679_1000410042 240
56 3300005563 Ga0068855_100007145 Ga0068855_10000714513 240
57 3300006852 Ga0075433_10062711 Ga0075433_100627114 240
58 3300006871 Ga0075434_100375131 Ga0075434_1003751311 240
59 3300007076 Ga0075435_100037211 Ga0075435_1000372115 240
60 3300007076 Ga0075435_100545862 Ga0075435_1005458621 240
61 3300025913 Ga0207695_10067902 Ga0207695_100679024 240
62 3300025919 Ga0207657_10013747 Ga0207657_100137474 240
63 3300025921 Ga0207652_10323114 Ga0207652_103231142 240
64 3300025949 Ga0207667_10021438 Ga0207667_100214381 240
65 3300037418 Ga0395900_0011743 Ga0395900_0011743_4164_4976 240
66 3300050512 nmdc:mga0n895_10713_c1 nmdc:mga0n895_10713_c1_4988_5794 240
67 3300050515 nmdc:mga0a205_32557_c1 nmdc:mga0a205_32557_c1_2442_3248 240
68 3300003215 JGI25153J46596_10000697 JGI25153J46596_100006978 241
69 3300003354 JGI25160J50197_1016718 JGI25160J50197_10167183 241
70 3300003794 Ga0055531_10001781 Ga0055531_100017815 241
71 3300005336 Ga0070680_100352506 Ga0070680_1003525061 241
72 3300005455 Ga0070663_100026482 Ga0070663_1000264826 241
73 3300005577 Ga0068857_100462109 Ga0068857_1004621091 241
74 3300006914 Ga0075436_100006862 Ga0075436_1000068627 241
75 3300006943 Ga0099822_1003706 Ga0099822_100370624 241
76 3300009176 Ga0105242_10180014 Ga0105242_101800142 241
77 3300010375 Ga0105239_10050704 Ga0105239_100507047 241
78 3300013100 Ga0157373_10257451 Ga0157373_102574513 241
79 3300013306 Ga0163162_10014258 Ga0163162_100142585 241
80 3300014969 Ga0157376_10008591 Ga0157376_100085913 241
81 3300025245 Ga0207425_1016882 Ga0207425_10168822 241
82 3300025295 Ga0209564_1007414 Ga0209564_10074142 241
83 3300025297 Ga0209758_1000026 Ga0209758_1000026355 241
84 3300025297 Ga0209758_1000097 Ga0209758_100009754 241
85 3300025297 Ga0209758_1060436 Ga0209758_10604362 241
86 3300025299 Ga0209256_1009481 Ga0209256_10094811 241
87 3300025302 Ga0207426_1013811 Ga0207426_10138113 241
88 3300025304 Ga0209257_1000201 Ga0209257_1000201101 241
89 3300025315 Ga0207697_10111055 Ga0207697_101110551 241
90 3300025917 Ga0207660_10309179 Ga0207660_103091792 241
91 3300025934 Ga0207686_10174187 Ga0207686_101741872 241
92 3300026067 Ga0207678_10023571 Ga0207678_100235712 241
93 3300027296 Ga0209389_1000060 Ga0209389_100006045 241
94 3300027357 Ga0209589_1000015 Ga0209589_1000015133 241
95 3300027357 Ga0209589_1000062 Ga0209589_100006262 241
96 3300027361 Ga0209489_100015 Ga0209489_100015133 241
97 3300027361 Ga0209489_103702 Ga0209489_10370213 241
98 3300027363 Ga0209700_100025 Ga0209700_100025133 241
99 3300044658 Ga0466972_0044257 Ga0466972_0044257_603_1412 241
100 3300048905 Ga0496102_0001341 Ga0496102_0001341_19817_20626 241
101 3300048910 Ga0496107_0071999 Ga0496107_0071999_914_1723 241
102 3300048911 Ga0496108_0019241 Ga0496108_0019241_96_905 241
103 3300048915 Ga0496112_0101990 Ga0496112_0101990_621_1430 241
104 3300048917 Ga0496114_0010872 Ga0496114_0010872_1777_2586 241
105 3300048918 Ga0496115_0012251 Ga0496115_0012251_3951_4760 241
106 3300050514 nmdc:mga08x19_4952_c1 nmdc:mga08x19_4952_c1_3687_4496 241
107 3300053078 Ga0495612_0155796 Ga0495612_0155796_102_920 241
108 3300053130 Ga0500642_0015291 Ga0500642_0015291_1703_2530 241
109 3300053150 Ga0500603_028660 Ga0500603_028660_244_1053 241
110 iso_pu_bacteria 2513237102 2513701071 241
111 iso_pu_bacteria 2824617872 2824620811 241
112 iso_pu_bacteria 2824626560 2824628327 241
113 iso_pu_bacteria 2824635225 2824636124 241
114 iso_pu_bacteria 2824644064 2824647231 241
115 iso_pu_bacteria 2824679649 2824681012 241
116 iso_pu_bacteria 2824714736 2824718059 241
117 iso_pu_bacteria 2824723954 2824726861 241
118 iso_pu_bacteria 2841957949 2841960479 241
119 iso_pu_bacteria 2842038055 2842043129 241
120 iso_pu_bacteria 2842045827 2842051170 241
121 iso_pu_bacteria 2849076700 2849081231 241
122 iso_pu_bacteria 2922393267 2922399490 241
123 3300005356 Ga0070674_100247866 Ga0070674_1002478661 242
124 3300005364 Ga0070673_100198300 Ga0070673_1001983002 242
125 3300005459 Ga0068867_100061533 Ga0068867_1000615332 242
126 3300006237 Ga0097621_100718796 Ga0097621_1007187961 242
127 3300006881 Ga0068865_100071874 Ga0068865_1000718743 242
128 3300009177 Ga0105248_10417514 Ga0105248_104175142 242
129 3300017792 Ga0163161_10122912 Ga0163161_101229123 242
130 3300025938 Ga0207704_10368178 Ga0207704_103681782 242
131 3300025941 Ga0207711_10548073 Ga0207711_105480732 242
132 3300025986 Ga0207658_10178271 Ga0207658_101782712 242
133 3300026089 Ga0207648_10007985 Ga0207648_100079859 242
134 3300026121 Ga0207683_10039783 Ga0207683_100397834 242
135 3300031235 Ga0265330_10000014 Ga0265330_1000001452 242
136 3300031238 Ga0265332_10000011 Ga0265332_10000011187 242
137 3300031241 Ga0265325_10008886 Ga0265325_100088866 242
138 3300031247 Ga0265340_10013732 Ga0265340_100137324 242
139 3300031711 Ga0265314_10000026 Ga0265314_1000002681 242
140 3300005344 Ga0070661_100169268 Ga0070661_1001692683 243
141 3300005535 Ga0070684_100051881 Ga0070684_1000518812 243
142 3300005539 Ga0068853_100346231 Ga0068853_1003462312 243
143 3300005543 Ga0070672_100020336 Ga0070672_1000203363 243
144 3300005563 Ga0068855_100099998 Ga0068855_1000999983 243
145 3300005564 Ga0070664_100078837 Ga0070664_1000788374 243
146 3300005577 Ga0068857_100188771 Ga0068857_1001887713 243
147 3300005614 Ga0068856_100104480 Ga0068856_1001044804 243
148 3300005614 Ga0068856_100145280 Ga0068856_1001452803 243
149 3300005616 Ga0068852_100028326 Ga0068852_1000283264 243
150 3300005618 Ga0068864_100667763 Ga0068864_1006677632 243
151 3300009177 Ga0105248_10003684 Ga0105248_100036846 243
152 3300009551 Ga0105238_10057303 Ga0105238_100573032 243
153 3300013105 Ga0157369_10082153 Ga0157369_100821533 243
154 3300013306 Ga0163162_10334055 Ga0163162_103340552 243
155 3300013308 Ga0157375_10062879 Ga0157375_100628795 243
156 3300014968 Ga0157379_10414012 Ga0157379_104140121 243
157 3300025903 Ga0207680_10018388 Ga0207680_100183884 243
158 3300025904 Ga0207647_10148290 Ga0207647_101482903 243
159 3300025914 Ga0207671_10203410 Ga0207671_102034102 243
160 3300025924 Ga0207694_10067024 Ga0207694_100670244 243
161 3300025924 Ga0207694_10095860 Ga0207694_100958602 243
162 3300025931 Ga0207644_10007082 Ga0207644_100070825 243
163 3300025933 Ga0207706_10368169 Ga0207706_103681692 243
164 3300025940 Ga0207691_10003578 Ga0207691_1000357815 243
165 3300025941 Ga0207711_10013697 Ga0207711_100136976 243
166 3300025945 Ga0207679_10018114 Ga0207679_100181144 243
167 3300026116 Ga0207674_10226919 Ga0207674_102269194 243
168 3300036401 Ga0373937_0312855 Ga0373937_0312855_252_1091 243
169 3300037418 Ga0395900_0015947 Ga0395900_0015947_1136_1957 243
170 3300048905 Ga0496102_0019726 Ga0496102_0019726_1591_2388 243
171 3300048909 Ga0496106_0006681 Ga0496106_0006681_6171_6968 243
172 3300048910 Ga0496107_0006330 Ga0496107_0006330_5747_6544 243
173 3300048910 Ga0496107_0193398 Ga0496107_0193398_638_1447 243
174 3300048913 Ga0496110_0165606 Ga0496110_0165606_796_1605 243
175 3300049572 Ga0501036_0161993 Ga0501036_0161993_783_1604 243
176 3300050512 nmdc:mga0n895_14725_c1 nmdc:mga0n895_14725_c1_55_957 243
177 3300006237 Ga0097621_100099829 Ga0097621_1000998294 244
178 3300009176 Ga0105242_10000453 Ga0105242_100004533 244
179 3300009177 Ga0105248_10121436 Ga0105248_101214363 244
180 3300013306 Ga0163162_10260323 Ga0163162_102603232 244
181 3300053153 Ga0500616_0000038 Ga0500616_0000038_217478_218299 244
182 3300005530 Ga0070679_100506202 Ga0070679_1005062022 245
183 3300005617 Ga0068859_100356190 Ga0068859_1003561902 245
184 3300006931 Ga0097620_100356202 Ga0097620_1003562022 245
185 3300005364 Ga0070673_100153650 Ga0070673_1001536502 246
186 3300005364 Ga0070673_100274453 Ga0070673_1002744533 246
187 3300006871 Ga0075434_100104946 Ga0075434_1001049464 246
188 3300013297 Ga0157378_10365637 Ga0157378_103656371 246
189 3300014968 Ga0157379_10016563 Ga0157379_100165632 246
190 3300025920 Ga0207649_10324659 Ga0207649_103246591 246
191 3300025945 Ga0207679_10019867 Ga0207679_100198674 246
192 3300025949 Ga0207667_10033094 Ga0207667_100330945 246
193 3300025960 Ga0207651_10432293 Ga0207651_104322931 246
194 3300026023 Ga0207677_10712024 Ga0207677_107120241 246
195 3300026067 Ga0207678_10230294 Ga0207678_102302942 246
196 3300048910 Ga0496107_0321892 Ga0496107_0321892_142_984 246
197 3300048912 Ga0496109_0136740 Ga0496109_0136740_691_1521 246
198 3300048915 Ga0496112_0006440 Ga0496112_0006440_6147_6977 246
199 3300048916 Ga0496113_0126987 Ga0496113_0126987_820_1650 246
200 3300005331 Ga0070670_100616404 Ga0070670_1006164041 247
201 3300005333 Ga0070677_10000279 Ga0070677_100002796 247
202 3300005335 Ga0070666_10000909 Ga0070666_100009094 247
203 3300005335 Ga0070666_10009328 Ga0070666_100093287 247
204 3300005338 Ga0068868_100014717 Ga0068868_1000147176 247
205 3300005339 Ga0070660_100005144 Ga0070660_1000051445 247
206 3300005347 Ga0070668_100006984 Ga0070668_1000069844 247
207 3300005354 Ga0070675_100002259 Ga0070675_10000225911 247
208 3300005355 Ga0070671_100007760 Ga0070671_1000077604 247
209 3300005355 Ga0070671_100172141 Ga0070671_1001721412 247
210 3300005356 Ga0070674_100007912 Ga0070674_1000079124 247
211 3300005356 Ga0070674_100029928 Ga0070674_1000299282 247
212 3300005367 Ga0070667_100028719 Ga0070667_1000287194 247
213 3300005367 Ga0070667_100068856 Ga0070667_1000688563 247
214 3300005367 Ga0070667_100080563 Ga0070667_1000805633 247
215 3300005367 Ga0070667_100149407 Ga0070667_1001494073 247
216 3300005455 Ga0070663_100108957 Ga0070663_1001089573 247
217 3300005456 Ga0070678_100005292 Ga0070678_1000052925 247
218 3300005459 Ga0068867_100012504 Ga0068867_1000125041 247
219 3300005539 Ga0068853_100018236 Ga0068853_1000182363 247
220 3300005539 Ga0068853_100144886 Ga0068853_1001448864 247
221 3300005543 Ga0070672_100004215 Ga0070672_1000042154 247
222 3300005548 Ga0070665_100001520 Ga0070665_1000015204 247
223 3300005617 Ga0068859_100330232 Ga0068859_1003302322 247
224 3300005618 Ga0068864_100013666 Ga0068864_1000136665 247
225 3300005834 Ga0068851_10000909 Ga0068851_1000090911 247
226 3300005840 Ga0068870_10006392 Ga0068870_100063926 247
227 3300005841 Ga0068863_100017681 Ga0068863_1000176816 247
228 3300005842 Ga0068858_100020003 Ga0068858_1000200033 247
229 3300005842 Ga0068858_100134652 Ga0068858_1001346523 247
230 3300005843 Ga0068860_100033550 Ga0068860_1000335505 247
231 3300006237 Ga0097621_100071118 Ga0097621_1000711182 247
232 3300006881 Ga0068865_100102558 Ga0068865_1001025582 247
233 3300006931 Ga0097620_100330211 Ga0097620_1003302112 247
234 3300009177 Ga0105248_10274503 Ga0105248_102745032 247
235 3300009177 Ga0105248_10338045 Ga0105248_103380452 247
236 3300013104 Ga0157370_10010640 Ga0157370_100106408 247
237 3300013296 Ga0157374_10500702 Ga0157374_105007022 247
238 3300013297 Ga0157378_10737650 Ga0157378_107376502 247
239 3300013307 Ga0157372_10051946 Ga0157372_100519464 247
240 3300013307 Ga0157372_10147182 Ga0157372_101471823 247
241 3300013308 Ga0157375_10009192 Ga0157375_100091923 247
242 3300013308 Ga0157375_10645665 Ga0157375_106456652 247
243 3300014969 Ga0157376_10008379 Ga0157376_100083792 247
244 3300025321 Ga0207656_10023313 Ga0207656_100233132 247
245 3300025907 Ga0207645_10000139 Ga0207645_1000013919 247
246 3300025908 Ga0207643_10046360 Ga0207643_100463603 247
247 3300025919 Ga0207657_10005719 Ga0207657_100057193 247
248 3300025923 Ga0207681_10028259 Ga0207681_100282592 247
249 3300025933 Ga0207706_10043559 Ga0207706_100435593 247
250 3300025937 Ga0207669_10004348 Ga0207669_100043484 247
251 3300025940 Ga0207691_10000040 Ga0207691_1000004015 247
252 3300025940 Ga0207691_10009315 Ga0207691_100093154 247
253 3300025960 Ga0207651_10000966 Ga0207651_100009663 247
254 3300025972 Ga0207668_10008843 Ga0207668_100088436 247
255 3300025972 Ga0207668_10030829 Ga0207668_100308295 247
256 3300025986 Ga0207658_10008367 Ga0207658_100083677 247
257 3300025986 Ga0207658_10045659 Ga0207658_100456592 247
258 3300025986 Ga0207658_10067571 Ga0207658_100675712 247
259 3300025986 Ga0207658_10081450 Ga0207658_100814502 247
260 3300026035 Ga0207703_10019682 Ga0207703_100196825 247
261 3300026035 Ga0207703_10134308 Ga0207703_101343082 247
262 3300026041 Ga0207639_10201975 Ga0207639_102019752 247
263 3300026067 Ga0207678_10008360 Ga0207678_100083602 247
264 3300026089 Ga0207648_10019772 Ga0207648_100197722 247
265 3300026089 Ga0207648_10059981 Ga0207648_100599813 247
266 3300026118 Ga0207675_100452411 Ga0207675_1004524111 247
267 3300026121 Ga0207683_10000059 Ga0207683_1000005956 247
268 3300026121 Ga0207683_10014708 Ga0207683_100147083 247
269 3300027360 Ga0209969_1022618 Ga0209969_10226182 247
270 3300028379 Ga0268266_10086274 Ga0268266_100862742 247
271 3300044694 Ga0466963_0203555 Ga0466963_0203555_220_1050 247
272 3300046664 Ga0495659_0106068 Ga0495659_0106068_171_1001 247
273 3300005336 Ga0070680_100042347 Ga0070680_1000423474 248
274 3300005435 Ga0070714_100093841 Ga0070714_1000938413 248
275 3300005458 Ga0070681_10019135 Ga0070681_100191356 248
276 3300005530 Ga0070679_100059215 Ga0070679_1000592153 248
277 3300005563 Ga0068855_100012156 Ga0068855_1000121568 248
278 3300005577 Ga0068857_100201582 Ga0068857_1002015822 248
279 3300005614 Ga0068856_100293288 Ga0068856_1002932881 248
280 3300013105 Ga0157369_10488040 Ga0157369_104880402 248
281 3300013307 Ga0157372_10644574 Ga0157372_106445741 248
282 3300025912 Ga0207707_10017469 Ga0207707_100174693 248
283 3300025917 Ga0207660_10059701 Ga0207660_100597013 248
284 3300025921 Ga0207652_10078076 Ga0207652_100780762 248
285 3300025929 Ga0207664_10081637 Ga0207664_100816372 248
286 3300026078 Ga0207702_10245138 Ga0207702_102451382 248
287 3300026116 Ga0207674_10083006 Ga0207674_100830064 248
288 3300037418 Ga0395900_0205387 Ga0395900_0205387_538_1365 248
289 3300038443 Ga0395901_0015978 Ga0395901_0015978_5748_6575 248
290 3300044673 Ga0453683_0115078 Ga0453683_0115078_166_1023 248
291 3300048905 Ga0496102_0580692 Ga0496102_0580692_173_1000 248
292 3300005328 Ga0070676_10024310 Ga0070676_100243104 249
293 3300005329 Ga0070683_100033050 Ga0070683_1000330505 249
294 3300005339 Ga0070660_100003025 Ga0070660_1000030255 249
295 3300005339 Ga0070660_100013300 Ga0070660_1000133004 249
296 3300005344 Ga0070661_100006707 Ga0070661_1000067073 249
297 3300005344 Ga0070661_100018286 Ga0070661_1000182864 249
298 3300005364 Ga0070673_100031152 Ga0070673_1000311521 249
299 3300005366 Ga0070659_100006487 Ga0070659_1000064874 249
300 3300005366 Ga0070659_100016986 Ga0070659_1000169866 249
301 3300005435 Ga0070714_100005916 Ga0070714_1000059164 249
302 3300005435 Ga0070714_100090910 Ga0070714_1000909103 249
303 3300005455 Ga0070663_100004923 Ga0070663_10000492310 249
304 3300005457 Ga0070662_100000176 Ga0070662_10000017616 249
305 3300005458 Ga0070681_10018775 Ga0070681_100187757 249
306 3300005535 Ga0070684_100141909 Ga0070684_1001419093 249
307 3300005539 Ga0068853_100002699 Ga0068853_10000269913 249
308 3300005543 Ga0070672_100232774 Ga0070672_1002327742 249
309 3300005563 Ga0068855_100000851 Ga0068855_10000085128 249
310 3300005563 Ga0068855_100006879 Ga0068855_1000068797 249
311 3300005564 Ga0070664_100002386 Ga0070664_10000238615 249
312 3300005564 Ga0070664_100022515 Ga0070664_1000225155 249
313 3300005577 Ga0068857_100006451 Ga0068857_1000064513 249
314 3300005614 Ga0068856_100001266 Ga0068856_10000126618 249
315 3300005614 Ga0068856_100020324 Ga0068856_1000203247 249
316 3300005616 Ga0068852_100010673 Ga0068852_1000106733 249
317 3300009093 Ga0105240_10000332 Ga0105240_1000033248 249
318 3300009174 Ga0105241_10179466 Ga0105241_101794662 249
319 3300009545 Ga0105237_10122414 Ga0105237_101224142 249
320 3300009551 Ga0105238_10001058 Ga0105238_1000105823 249
321 3300010375 Ga0105239_10654926 Ga0105239_106549262 249
322 3300013105 Ga0157369_10011173 Ga0157369_100111737 249
323 3300013307 Ga0157372_10003176 Ga0157372_100031764 249
324 3300025911 Ga0207654_10075274 Ga0207654_100752742 249
325 3300025912 Ga0207707_10058218 Ga0207707_100582182 249
326 3300025913 Ga0207695_10211687 Ga0207695_102116873 249
327 3300025919 Ga0207657_10000803 Ga0207657_1000080327 249
328 3300025919 Ga0207657_10013201 Ga0207657_100132017 249
329 3300025920 Ga0207649_10014372 Ga0207649_100143723 249
330 3300025920 Ga0207649_10054193 Ga0207649_100541933 249
331 3300025924 Ga0207694_10002852 Ga0207694_1000285213 249
332 3300025928 Ga0207700_10193289 Ga0207700_101932892 249
333 3300025929 Ga0207664_10011033 Ga0207664_100110335 249
334 3300025932 Ga0207690_10057581 Ga0207690_100575811 249
335 3300025932 Ga0207690_10223127 Ga0207690_102231271 249
336 3300025932 Ga0207690_10250389 Ga0207690_102503892 249
337 3300025933 Ga0207706_10000002 Ga0207706_10000002202 249
338 3300025944 Ga0207661_10029815 Ga0207661_100298153 249
339 3300025949 Ga0207667_10012368 Ga0207667_100123685 249
340 3300025949 Ga0207667_10032823 Ga0207667_100328232 249
341 3300025960 Ga0207651_10077558 Ga0207651_100775583 249
342 3300025981 Ga0207640_10046229 Ga0207640_100462294 249
343 3300025986 Ga0207658_10223924 Ga0207658_102239242 249
344 3300026041 Ga0207639_10035409 Ga0207639_100354093 249
345 3300026067 Ga0207678_10001320 Ga0207678_1000132012 249
346 3300026078 Ga0207702_10005409 Ga0207702_100054094 249
347 3300026078 Ga0207702_10016317 Ga0207702_100163173 249
348 3300026116 Ga0207674_10000064 Ga0207674_1000006430 249
349 3300026142 Ga0207698_10012411 Ga0207698_100124116 249
350 3300027471 Ga0209995_1004767 Ga0209995_10047672 249
351 3300027665 Ga0209983_1003323 Ga0209983_10033233 249
352 3300027682 Ga0209971_1003271 Ga0209971_10032714 249
353 3300027876 Ga0209974_10000662 Ga0209974_1000066211 249
354 3300027876 Ga0209974_10031576 Ga0209974_100315763 249
355 3300031824 Ga0307413_10171462 Ga0307413_101714622 249
356 3300031903 Ga0307407_10034461 Ga0307407_100344613 249
357 3300032002 Ga0307416_100057753 Ga0307416_1000577533 249
358 3300035119 Ga0373956_0074400 Ga0373956_0074400_421_1248 249
359 3300036401 Ga0373937_0101719 Ga0373937_0101719_131_958 249
360 3300005327 Ga0070658_10007510 Ga0070658_100075107 250
361 3300005327 Ga0070658_10202078 Ga0070658_102020781 250
362 3300005329 Ga0070683_100015951 Ga0070683_1000159515 250
363 3300005336 Ga0070680_100244796 Ga0070680_1002447961 250
364 3300005344 Ga0070661_100095953 Ga0070661_1000959533 250
365 3300005366 Ga0070659_100024659 Ga0070659_1000246594 250
366 3300005435 Ga0070714_100026036 Ga0070714_1000260362 250
367 3300005437 Ga0070710_10049965 Ga0070710_100499652 250
368 3300005535 Ga0070684_100011072 Ga0070684_1000110725 250
369 3300005539 Ga0068853_100151346 Ga0068853_1001513462 250
370 3300005564 Ga0070664_100020677 Ga0070664_1000206774 250
371 3300005578 Ga0068854_100021119 Ga0068854_1000211192 250
372 3300005614 Ga0068856_100021333 Ga0068856_1000213335 250
373 3300005616 Ga0068852_100151145 Ga0068852_1001511452 250
374 3300005617 Ga0068859_100207669 Ga0068859_1002076693 250
375 3300005834 Ga0068851_10004313 Ga0068851_100043133 250
376 3300006931 Ga0097620_100207657 Ga0097620_1002076573 250
377 3300007076 Ga0075435_100193711 Ga0075435_1001937112 250
378 3300009093 Ga0105240_10013728 Ga0105240_100137286 250
379 3300009174 Ga0105241_10003744 Ga0105241_100037448 250
380 3300009551 Ga0105238_10011120 Ga0105238_100111206 250
381 3300011119 Ga0105246_10220483 Ga0105246_102204832 250
382 3300013102 Ga0157371_10061815 Ga0157371_100618153 250
383 3300013104 Ga0157370_10258626 Ga0157370_102586262 250
384 3300013105 Ga0157369_10044614 Ga0157369_100446142 250
385 3300013307 Ga0157372_10162389 Ga0157372_101623893 250
386 3300025321 Ga0207656_10007517 Ga0207656_100075171 250
387 3300025898 Ga0207692_10101527 Ga0207692_101015272 250
388 3300025909 Ga0207705_10149748 Ga0207705_101497482 250
389 3300025911 Ga0207654_10340114 Ga0207654_103401142 250
390 3300025912 Ga0207707_10046829 Ga0207707_100468292 250
391 3300025914 Ga0207671_10346711 Ga0207671_103467112 250
392 3300025917 Ga0207660_10019993 Ga0207660_100199932 250
393 3300025919 Ga0207657_10000240 Ga0207657_1000024030 250
394 3300025919 Ga0207657_10017881 Ga0207657_100178819 250
395 3300025921 Ga0207652_10187801 Ga0207652_101878012 250
396 3300025921 Ga0207652_10554386 Ga0207652_105543862 250
397 3300025924 Ga0207694_10045460 Ga0207694_100454603 250
398 3300025925 Ga0207650_10034392 Ga0207650_100343923 250
399 3300025932 Ga0207690_10065109 Ga0207690_100651092 250
400 3300025936 Ga0207670_10006537 Ga0207670_100065375 250
401 3300025945 Ga0207679_10031330 Ga0207679_100313302 250
402 3300025949 Ga0207667_10011280 Ga0207667_1001128010 250
403 3300025949 Ga0207667_10069071 Ga0207667_100690713 250
404 3300025981 Ga0207640_10018881 Ga0207640_100188815 250
405 3300026041 Ga0207639_10052336 Ga0207639_100523363 250
406 3300026067 Ga0207678_10005474 Ga0207678_100054745 250
407 3300026116 Ga0207674_10000237 Ga0207674_1000023710 250
408 3300026142 Ga0207698_10005749 Ga0207698_100057494 250
409 3300002077 JGI24744J21845_10039039 JGI24744J21845_100390391 251
410 3300005290 Ga0065712_10142291 Ga0065712_101422912 251
411 3300005293 Ga0065715_10169866 Ga0065715_101698662 251
412 3300005327 Ga0070658_10165782 Ga0070658_101657822 251
413 3300005328 Ga0070676_10154802 Ga0070676_101548022 251
414 3300005329 Ga0070683_100033783 Ga0070683_1000337832 251
415 3300005329 Ga0070683_100094466 Ga0070683_1000944662 251
416 3300005330 Ga0070690_100138468 Ga0070690_1001384682 251
417 3300005333 Ga0070677_10004604 Ga0070677_100046044 251
418 3300005334 Ga0068869_100018799 Ga0068869_1000187992 251
419 3300005337 Ga0070682_100226119 Ga0070682_1002261192 251
420 3300005340 Ga0070689_100014090 Ga0070689_1000140904 251
421 3300005344 Ga0070661_100006294 Ga0070661_1000062949 251
422 3300005344 Ga0070661_100028394 Ga0070661_1000283941 251
423 3300005364 Ga0070673_100137596 Ga0070673_1001375962 251
424 3300005436 Ga0070713_100331451 Ga0070713_1003314512 251
425 3300005437 Ga0070710_10008802 Ga0070710_100088024 251
426 3300005438 Ga0070701_10130416 Ga0070701_101304161 251
427 3300005439 Ga0070711_100528396 Ga0070711_1005283961 251
428 3300005455 Ga0070663_100017836 Ga0070663_1000178364 251
429 3300005457 Ga0070662_100213880 Ga0070662_1002138802 251
430 3300005530 Ga0070679_100187306 Ga0070679_1001873062 251
431 3300005535 Ga0070684_100200258 Ga0070684_1002002582 251
432 3300005546 Ga0070696_100017753 Ga0070696_1000177534 251
433 3300005548 Ga0070665_100084139 Ga0070665_1000841392 251
434 3300005563 Ga0068855_100067326 Ga0068855_1000673265 251
435 3300005563 Ga0068855_100176418 Ga0068855_1001764182 251
436 3300005564 Ga0070664_100005097 Ga0070664_1000050977 251
437 3300005564 Ga0070664_100089381 Ga0070664_1000893813 251
438 3300005577 Ga0068857_100034957 Ga0068857_1000349572 251
439 3300005578 Ga0068854_100112741 Ga0068854_1001127412 251
440 3300005614 Ga0068856_100453037 Ga0068856_1004530373 251
441 3300005616 Ga0068852_100009114 Ga0068852_1000091149 251
442 3300005616 Ga0068852_100093796 Ga0068852_1000937963 251
443 3300005718 Ga0068866_10036483 Ga0068866_100364833 251
444 3300005834 Ga0068851_10000824 Ga0068851_1000082414 251
445 3300005834 Ga0068851_10012042 Ga0068851_100120422 251
446 3300005840 Ga0068870_10049631 Ga0068870_100496312 251
447 3300005842 Ga0068858_100178331 Ga0068858_1001783313 251
448 3300006358 Ga0068871_100249002 Ga0068871_1002490021 251
449 3300006881 Ga0068865_100010976 Ga0068865_1000109763 251
450 3300009093 Ga0105240_10033938 Ga0105240_100339386 251
451 3300009094 Ga0111539_10111532 Ga0111539_101115323 251
452 3300009174 Ga0105241_10242766 Ga0105241_102427662 251
453 3300009177 Ga0105248_10507468 Ga0105248_105074682 251
454 3300009545 Ga0105237_10120603 Ga0105237_101206033 251
455 3300009553 Ga0105249_10218552 Ga0105249_102185522 251
456 3300013104 Ga0157370_10052778 Ga0157370_100527782 251
457 3300013296 Ga0157374_10103596 Ga0157374_101035963 251
458 3300013297 Ga0157378_10133221 Ga0157378_101332213 251
459 3300013307 Ga0157372_10067960 Ga0157372_100679603 251
460 3300013307 Ga0157372_10159116 Ga0157372_101591162 251
461 3300014325 Ga0163163_10058784 Ga0163163_100587842 251
462 3300014326 Ga0157380_10166869 Ga0157380_101668692 251
463 3300017792 Ga0163161_10035976 Ga0163161_100359763 251
464 3300025315 Ga0207697_10002605 Ga0207697_100026055 251
465 3300025321 Ga0207656_10013274 Ga0207656_100132744 251
466 3300025893 Ga0207682_10002556 Ga0207682_100025563 251
467 3300025901 Ga0207688_10000438 Ga0207688_1000043810 251
468 3300025904 Ga0207647_10185971 Ga0207647_101859712 251
469 3300025907 Ga0207645_10011262 Ga0207645_100112624 251
470 3300025908 Ga0207643_10000089 Ga0207643_1000008942 251
471 3300025909 Ga0207705_10051043 Ga0207705_100510435 251
472 3300025909 Ga0207705_10227890 Ga0207705_102278902 251
473 3300025911 Ga0207654_10132439 Ga0207654_101324393 251
474 3300025913 Ga0207695_10041522 Ga0207695_100415224 251
475 3300025919 Ga0207657_10151043 Ga0207657_101510432 251
476 3300025920 Ga0207649_10018271 Ga0207649_100182717 251
477 3300025920 Ga0207649_10155735 Ga0207649_101557352 251
478 3300025921 Ga0207652_10076161 Ga0207652_100761613 251
479 3300025925 Ga0207650_10102100 Ga0207650_101021003 251
480 3300025926 Ga0207659_10120452 Ga0207659_101204523 251
481 3300025931 Ga0207644_10201383 Ga0207644_102013832 251
482 3300025933 Ga0207706_10000456 Ga0207706_100004568 251
483 3300025941 Ga0207711_10305759 Ga0207711_103057592 251
484 3300025942 Ga0207689_10001781 Ga0207689_1000178111 251
485 3300025944 Ga0207661_10067072 Ga0207661_100670721 251
486 3300025945 Ga0207679_10006221 Ga0207679_100062214 251
487 3300025945 Ga0207679_10053421 Ga0207679_100534212 251
488 3300025949 Ga0207667_10103601 Ga0207667_101036012 251
489 3300025960 Ga0207651_10231415 Ga0207651_102314152 251
490 3300025961 Ga0207712_10123539 Ga0207712_101235393 251
491 3300025981 Ga0207640_10132575 Ga0207640_101325752 251
492 3300025986 Ga0207658_10701591 Ga0207658_107015911 251
493 3300026067 Ga0207678_10001203 Ga0207678_100012034 251
494 3300026075 Ga0207708_10000775 Ga0207708_1000077513 251
495 3300026078 Ga0207702_10322695 Ga0207702_103226953 251
496 3300026078 Ga0207702_10470102 Ga0207702_104701022 251
497 3300026088 Ga0207641_10213539 Ga0207641_102135392 251
498 3300026089 Ga0207648_10002404 Ga0207648_1000240422 251
499 3300026095 Ga0207676_10033173 Ga0207676_100331732 251
500 3300026118 Ga0207675_100001078 Ga0207675_10000107825 251
501 3300026121 Ga0207683_10009554 Ga0207683_100095543 251
502 3300027682 Ga0209971_1029627 Ga0209971_10296271 251
503 3300028379 Ga0268266_10262293 Ga0268266_102622932 251
504 3300028381 Ga0268264_10161622 Ga0268264_101616222 251
505 3300044694 Ga0466963_0171045 Ga0466963_0171045_422_1249 251
506 3300048904 Ga0496101_0003156 Ga0496101_0003156_9107_9934 251
507 3300048906 Ga0496103_0060295 Ga0496103_0060295_56_880 251
508 3300048908 Ga0496105_0004030 Ga0496105_0004030_6899_7726 251
509 3300048909 Ga0496106_0253922 Ga0496106_0253922_550_1380 251
510 3300048912 Ga0496109_0020734 Ga0496109_0020734_958_1785 251
511 3300048913 Ga0496110_0054590 Ga0496110_0054590_1369_2196 251
512 3300048914 Ga0496111_0281687 Ga0496111_0281687_272_1099 251
513 3300048915 Ga0496112_0269624 Ga0496112_0269624_435_1262 251
514 3300048917 Ga0496114_0245064 Ga0496114_0245064_714_1541 251
515 3300050511 nmdc:mga08y16_581991_c1 nmdc:mga08y16_581991_c1_190_1017 251
516 3300050513 nmdc:mga0rr50_142934_c1 nmdc:mga0rr50_142934_c1_296_1126 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12849

PBP_like_2

PBP superfamily domain

47

280

0.9

PF13531

SBP_bac_11

Bacterial extracellular solute-binding protein

57

288

0.79

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

61

283

0.55

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lr1-assembly1.cif.gz_A the crystal structure of the tungstate abc transporter from geobacter sulfurreducens 0.9197 16 235
3cvg-assembly1.cif.gz_A crystal structure of a periplasmic putative metal binding protein 0.8787 10 245
5my5-assembly1.cif.gz_A tungstate binding protein - tupa - from desulfovibrio alaskensis g20 0.8747 9 247
3cvg-assembly5.cif.gz_C crystal structure of a periplasmic putative metal binding protein 0.8588 57 245
3lr1-assembly1.cif.gz_A the crystal structure of the tungstate abc transporter from geobacter sulfurreducens 0.8524 16 235
ID Description Score Start End Superfamily
5my5A01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9209 9 247 3.40.190.10
3muqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9192 81 194 3.40.190.10
3kn3C01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9185 16 236 3.40.190.10
3muqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9151 16 231 3.40.190.10
3muqB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8953 81 194 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A6L8DK65-F1-model_v4 Tungsten ABC transporter substrate-binding protein 0.9835 33 247
AF-A0A6L7MBB3-F1-model_v4 Sulfate transporter 0.9795 16 247
AF-A0A7C5SC37-F1-model_v4 PBP domain-containing protein 0.9786 78 246
AF-A0A537M5M2-F1-model_v4 Tungsten ABC transporter substrate-binding protein 0.9785 16 247
AF-A0A0Q6KPG0-F1-model_v4 PBP domain-containing protein 0.9768 16 250

Feature Viewer

pLDDT pTM Quality
89.09 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map