metagRoot

F457979

General Info

Members	Datasets	Scaffolds	Average Seq Length
516	263	500	272

Family's Representative Sequence

Representative Sequence	3300005983\|Ga0081540_1113684\|Ga0081540_11136842
Length	307
Sequence	MTSPEGRSDAGSPHAGGGPTQPEAMATTEGTAHDPLVPRPAATVILIRDSADGIKLFLMRRHSAMDFVAGVMVFPGGGVDDRDRNADVAWFGPEPDWWAERFGIKPDLAEALVCAAARETFEESGVLFAGPADDPDSMVSDASIYRASRQALADRSLSFGEFLRRENLVLRADLLRPWANWVTPKEERTRRYDTYFFVGALPEGQRADGDNTEADRAFWSTPQQGLDEFAEGRSFLLPPTWTQLDSLNGRTVAEVLAVERKIVAVEPHLAADEVTGNWEIEFFNSDRYNAARNRRAPEGYGADTPLA

Samples

	Sample ID	Description	Type	Environment
1	2547132424	Nocardia nova SH22a	Isolate	Unclassified
2	2551306166	Nocardia tenerifensis NBRC 101015	Isolate	Rhizosphere
3	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
4	2643221692	Nocardia sp. Root136	Isolate	Unclassified
5	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
6	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
7	2738541274	Mycobacterium sp. YR708	Isolate	Unclassified
8	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
9	2738543028	Mycobacterium sp. YR782	Isolate	Unclassified
10	2744054611	Aldersonia kunmingensis DSM 45001	Isolate	Rhizosphere
11	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
12	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
13	2902799365	Mycolicibacterium sp. P1-5	Isolate	Unclassified
14	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
15	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
16	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
17	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
18	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
19	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
20	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
21	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
22	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
23	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
24	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
25	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
26	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
27	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
28	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
29	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
30	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
31	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
32	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
33	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
34	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
35	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
36	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
37	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
38	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
39	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
40	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
41	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
42	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
43	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
46	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
47	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
48	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
49	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
50	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
51	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
52	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
55	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
56	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
57	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
58	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
59	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
60	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
61	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
62	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
63	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
64	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
65	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
66	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
67	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
68	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
69	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
70	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
71	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
72	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
73	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
75	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
76	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
77	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
78	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
79	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
81	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
82	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
83	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
85	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
86	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
87	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
88	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
89	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
90	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
91	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
92	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
93	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
94	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
95	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
96	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
97	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
98	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
99	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
100	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
101	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
102	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
103	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
104	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
105	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
106	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
107	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
108	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
157	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
158	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
159	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
160	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
161	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
162	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
163	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
164	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
165	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
166	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
167	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
168	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
169	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
170	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
171	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
172	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
173	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
174	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
175	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
176	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
177	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
178	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
179	3300042436	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520	Metagenome	Rhizosphere
180	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
181	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
182	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
183	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
184	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
185	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
186	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
187	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
188	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
189	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
190	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
191	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
192	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
193	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
194	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
195	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
196	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
197	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
198	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
199	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
200	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
201	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
202	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
203	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
204	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
205	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
206	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
207	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
208	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
209	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
210	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
211	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
212	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
213	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
214	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
215	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
216	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
217	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
218	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
219	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
220	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
221	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
222	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
223	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
224	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
225	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
226	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
227	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
228	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
229	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
230	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
231	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
232	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
233	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
234	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
235	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
238	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
239	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
240	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
241	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
244	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
245	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
246	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
247	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
248	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
249	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
250	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
251	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
252	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
253	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
254	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
255	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
256	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
257	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
258	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
259	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
260	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
261	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
262	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
263	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.9
Metatranscriptomes	0
Isolates	3.1

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	11.82
Nodule	0.19
Rhizoplane	11.43
Rhizosphere	64.34
Stem	0
Stem Tuber	0
Unclassified	12.21

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24742J22300_10000851	3300002244	Bacteria	4663
2	rootH2_10047012	3300003320	Bacteria	7156
3	Ga0055540_1000003	3300003792	Bacteria	428375
4	Ga0055540_1000739	3300003792	Bacteria	22175
5	Ga0055540_1009731	3300003792	Bacteria	3282
6	Ga0055540_1017077	3300003792	Bacteria	2038
7	Ga0070676_10048920	3300005328	Bacteria	2473
8	Ga0070690_100015214	3300005330	Bacteria	4584
9	Ga0070666_10034345	3300005335	Bacteria	3361
10	Ga0070682_100005653	3300005337	Bacteria	6970
11	Ga0068868_100007656	3300005338	Bacteria	7703
12	Ga0070689_100118500	3300005340	Bacteria	2112
13	Ga0070687_100075682	3300005343	Bacteria	1821
14	Ga0070668_100002256	3300005347	Bacteria	14200
15	Ga0070668_100011153	3300005347	Bacteria	6690
16	Ga0070669_100004872	3300005353	Bacteria	9685
17	Ga0070671_100001509	3300005355	Bacteria	17434
18	Ga0070674_100000330	3300005356	Bacteria	23424
19	Ga0070667_100000042	3300005367	Bacteria	168902
20	Ga0070667_100020237	3300005367	Bacteria	5525
21	Ga0070667_100032397	3300005367	Bacteria	4359
22	Ga0070667_100094829	3300005367	Bacteria	2572
23	Ga0070714_100012119	3300005435	Bacteria	6868
24	Ga0070714_100232453	3300005435	Bacteria	1699
25	Ga0070714_100237125	3300005435	Bacteria	1682
26	Ga0070714_100275075	3300005435	Bacteria	1563
27	Ga0070713_100025971	3300005436	Bacteria	4590
28	Ga0070710_10159434	3300005437	Bacteria	1398
29	Ga0070711_100006569	3300005439	Bacteria	7018
30	Ga0070711_100107019	3300005439	Bacteria	2046
31	Ga0070700_100037630	3300005441	Bacteria	2944
32	Ga0070700_100128994	3300005441	Bacteria	1704
33	Ga0070694_100022792	3300005444	Bacteria	4018
34	Ga0070663_100004199	3300005455	Bacteria	8425
35	Ga0070678_100011778	3300005456	Bacteria	5409
36	Ga0070678_100075485	3300005456	Bacteria	2536
37	Ga0070678_100182466	3300005456	Bacteria	1719
38	Ga0070662_100009566	3300005457	Bacteria	6343
39	Ga0070662_100030403	3300005457	Bacteria	3778
40	Ga0068867_100001083	3300005459	Bacteria	18635
41	Ga0070684_100323228	3300005535	Bacteria	1417
42	Ga0070697_100106914	3300005536	Bacteria	2328
43	Ga0068853_100024319	3300005539	Bacteria	5078
44	Ga0068853_100098279	3300005539	Bacteria	2585
45	Ga0068853_100123585	3300005539	Bacteria	2311
46	Ga0068853_100452496	3300005539	Bacteria	1208
47	Ga0070696_100012136	3300005546	Bacteria	5774
48	Ga0070696_100043984	3300005546	Bacteria	3091
49	Ga0070693_100118233	3300005547	Bacteria	1640
50	Ga0070665_100007320	3300005548	Bacteria	11229
51	Ga0070665_100013740	3300005548	Bacteria	8149
52	Ga0070665_100138495	3300005548	Bacteria	2437
53	Ga0070704_100000296	3300005549	Bacteria	21955
54	Ga0068855_100154075	3300005563	Bacteria	2612
55	Ga0070664_100236112	3300005564	Bacteria	1640
56	Ga0068854_100004078	3300005578	Bacteria	9178
57	Ga0070702_100002214	3300005615	Bacteria	8292
58	Ga0070702_100028014	3300005615	Bacteria	3048
59	Ga0068852_100090959	3300005616	Bacteria	2730
60	Ga0068859_100003293	3300005617	Bacteria	16424
61	Ga0068859_100008137	3300005617	Bacteria	10632
62	Ga0068866_10000928	3300005718	Bacteria	12858
63	Ga0068861_100001249	3300005719	Bacteria	15856
64	Ga0068863_100006121	3300005841	Bacteria	11800
65	Ga0068863_100006656	3300005841	Bacteria	11340
66	Ga0068863_100052510	3300005841	Bacteria	3863
67	Ga0068858_100002786	3300005842	Bacteria	17570
68	Ga0068858_100020513	3300005842	Bacteria	6177
69	Ga0068860_100000020	3300005843	Bacteria	283324
70	Ga0068860_100003649	3300005843	Bacteria	15840
71	Ga0068860_100351050	3300005843	Bacteria	1452
72	Ga0068862_100002277	3300005844	Bacteria	17181
73	Ga0068862_100013205	3300005844	Bacteria	6830
74	Ga0068862_100238909	3300005844	Bacteria	1651
75	Ga0081455_10099944	3300005937	Bacteria	2332
76	Ga0081540_1113684	3300005983	Bacteria	1138
77	Ga0070717_10070845	3300006028	Bacteria	2906
78	Ga0075365_10120171	3300006038	Bacteria	1812
79	Ga0075365_10141596	3300006038	Bacteria	1669
80	Ga0075365_10144433	3300006038	Bacteria	1653
81	Ga0075365_10232264	3300006038	Bacteria	1295
82	Ga0075368_10017358	3300006042	Bacteria	2693
83	Ga0075368_10148708	3300006042	Bacteria	978
84	Ga0075363_100000083	3300006048	Bacteria	20120
85	Ga0075363_100002132	3300006048	Bacteria	7954
86	Ga0075363_100005241	3300006048	Bacteria	5747
87	Ga0075363_100073808	3300006048	Bacteria	1856
88	Ga0075363_100121519	3300006048	Bacteria	1459
89	Ga0075364_10005547	3300006051	Bacteria	7349
90	Ga0075364_10036019	3300006051	Bacteria	3199
91	Ga0075364_10060600	3300006051	Bacteria	2481
92	Ga0075364_10126412	3300006051	Bacteria	1714
93	Ga0075364_10207327	3300006051	Bacteria	1329
94	Ga0070715_10014934	3300006163	Bacteria	2887
95	Ga0070716_100002757	3300006173	Bacteria	8157
96	Ga0070712_100003355	3300006175	Bacteria	9836
97	Ga0070712_100061330	3300006175	Bacteria	2656
98	Ga0070712_100310810	3300006175	Bacteria	1279
99	Ga0075367_10007896	3300006178	Bacteria	5481
100	Ga0075367_10159293	3300006178	Bacteria	1403
101	Ga0075369_10000536	3300006186	Bacteria	12013
102	Ga0075369_10001130	3300006186	Bacteria	8980
103	Ga0097621_100018722	3300006237	Bacteria	5298
104	Ga0075370_10006858	3300006353	Bacteria	5761
105	Ga0075370_10018527	3300006353	Bacteria	3779
106	Ga0075370_10030437	3300006353	Bacteria	3012
107	Ga0075370_10208101	3300006353	Bacteria	1155
108	Ga0075428_100006651	3300006844	Bacteria	12854
109	Ga0075431_100020973	3300006847	Bacteria	6678
110	Ga0075433_10745360	3300006852	Bacteria	857
111	Ga0068865_100003823	3300006881	Bacteria	9036
112	Ga0097620_100003293	3300006931	Bacteria	16424
113	Ga0097620_100008137	3300006931	Bacteria	10632
114	Ga0097620_100868085	3300006931	Bacteria	988
115	Ga0105250_10122895	3300009092	Bacteria	1068
116	Ga0105245_10000730	3300009098	Bacteria	29616
117	Ga0105245_10062713	3300009098	Bacteria	3354
118	Ga0105247_10000009	3300009101	Bacteria	385991
119	Ga0105247_10001224	3300009101	Bacteria	19053
120	Ga0105247_10065572	3300009101	Bacteria	2259
121	Ga0105247_10140917	3300009101	Bacteria	1580
122	Ga0114129_10030572	3300009147	Bacteria	7620
123	Ga0114129_10538137	3300009147	Bacteria	1521
124	Ga0105243_10001353	3300009148	Bacteria	21797
125	Ga0105241_10036851	3300009174	Bacteria	3682
126	Ga0105242_10000385	3300009176	Bacteria	35131
127	Ga0105242_10144720	3300009176	Bacteria	2066
128	Ga0105248_10003175	3300009177	Bacteria	18211
129	Ga0105248_10003351	3300009177	Bacteria	17805
130	Ga0105248_10014166	3300009177	Bacteria	8779
131	Ga0105237_10005076	3300009545	Bacteria	14956
132	Ga0105237_10009765	3300009545	Bacteria	10264
133	Ga0105237_10043848	3300009545	Bacteria	4504
134	Ga0105238_10366690	3300009551	Bacteria	1430
135	Ga0105249_10000011	3300009553	Bacteria	292812
136	Ga0105249_10001770	3300009553	Bacteria	18822
137	Ga0105239_10004884	3300010375	Bacteria	15866
138	Ga0105239_10016200	3300010375	Bacteria	8247
139	Ga0105239_10020239	3300010375	Bacteria	7341
140	Ga0105246_10098860	3300011119	Bacteria	2120
141	Ga0105246_10205865	3300011119	Bacteria	1533
142	Ga0157374_10256190	3300013296	Bacteria	1722
143	Ga0157378_10024489	3300013297	Bacteria	5312
144	Ga0157378_10187871	3300013297	Bacteria	1947
145	Ga0163162_10016281	3300013306	Bacteria	7268
146	Ga0163162_10151156	3300013306	Bacteria	2440
147	Ga0163162_10191545	3300013306	Bacteria	2173
148	Ga0157372_10013026	3300013307	Bacteria	8870
149	Ga0157375_10001319	3300013308	Bacteria	21398
150	Ga0157375_10228102	3300013308	Bacteria	2021
151	Ga0157375_10337757	3300013308	Bacteria	1672
152	Ga0157375_10455788	3300013308	Bacteria	1444
153	Ga0163163_10018241	3300014325	Bacteria	6564
154	Ga0157380_10090966	3300014326	Bacteria	2518
155	Ga0157377_10093027	3300014745	Bacteria	1784
156	Ga0157379_10039874	3300014968	Bacteria	4191
157	Ga0157379_10213114	3300014968	Bacteria	1749
158	Ga0163161_10049216	3300017792	Bacteria	3045
159	Ga0163161_10296208	3300017792	Bacteria	1273
160	Ga0213874_10044800	3300021377	Bacteria	1337
161	Ga0213876_10004047	3300021384	Bacteria	8252
162	Ga0213876_10036298	3300021384	Bacteria	2600
163	Ga0213876_10154636	3300021384	Bacteria	1220
164	Ga0213875_10016565	3300021388	Bacteria	3572
165	Ga0209673_1034700	3300025273	Bacteria	1519
166	Ga0209051_1000011	3300025303	Bacteria	610828
167	Ga0209051_1000812	3300025303	Bacteria	32460
168	Ga0209051_1001824	3300025303	Bacteria	16845
169	Ga0209051_1006674	3300025303	Bacteria	6456
170	Ga0209051_1029166	3300025303	Bacteria	2164
171	Ga0207696_1065658	3300025711	Bacteria	1015
172	Ga0207692_10005824	3300025898	Bacteria	4966
173	Ga0207642_10000590	3300025899	Bacteria	11166
174	Ga0207710_10000014	3300025900	Bacteria	408072
175	Ga0207710_10001059	3300025900	Bacteria	14226
176	Ga0207710_10024575	3300025900	Bacteria	2596
177	Ga0207688_10002391	3300025901	Bacteria	10106
178	Ga0207688_10049631	3300025901	Bacteria	2346
179	Ga0207680_10041277	3300025903	Bacteria	2690
180	Ga0207699_10123446	3300025906	Bacteria	1678
181	Ga0207699_10284834	3300025906	Bacteria	1149
182	Ga0207645_10005501	3300025907	Bacteria	9175
183	Ga0207643_10064892	3300025908	Bacteria	2090
184	Ga0207671_10003771	3300025914	Bacteria	14901
185	Ga0207671_10046040	3300025914	Bacteria	3227
186	Ga0207693_10001329	3300025915	Bacteria	21897
187	Ga0207693_10002647	3300025915	Bacteria	15552
188	Ga0207693_10135267	3300025915	Bacteria	1938
189	Ga0207693_10189460	3300025915	Bacteria	1619
190	Ga0207663_10055365	3300025916	Bacteria	2488
191	Ga0207662_10024941	3300025918	Bacteria	3442
192	Ga0207646_10369046	3300025922	Bacteria	1297
193	Ga0207694_10264098	3300025924	Bacteria	1411
194	Ga0207687_10027158	3300025927	Bacteria	3840
195	Ga0207700_10035047	3300025928	Bacteria	3611
196	Ga0207700_10170971	3300025928	Bacteria	1813
197	Ga0207664_10127392	3300025929	Bacteria	2139
198	Ga0207644_10205758	3300025931	Bacteria	1554
199	Ga0207690_10382647	3300025932	Bacteria	1119
200	Ga0207706_10049965	3300025933	Bacteria	3695
201	Ga0207686_10011365	3300025934	Bacteria	4875
202	Ga0207709_10007873	3300025935	Bacteria	5906
203	Ga0207709_10027057	3300025935	Bacteria	3300
204	Ga0207669_10010812	3300025937	Bacteria	4410
205	Ga0207669_10050648	3300025937	Bacteria	2484
206	Ga0207704_10000575	3300025938	Bacteria	16369
207	Ga0207704_10064853	3300025938	Bacteria	2284
208	Ga0207704_10241117	3300025938	Bacteria	1351
209	Ga0207665_10015923	3300025939	Bacteria	4936
210	Ga0207691_10074607	3300025940	Bacteria	3059
211	Ga0207711_10002575	3300025941	Bacteria	16131
212	Ga0207711_10021949	3300025941	Bacteria	5333
213	Ga0207711_10036775	3300025941	Bacteria	4155
214	Ga0207689_10039102	3300025942	Bacteria	3928
215	Ga0207667_10028239	3300025949	Bacteria	6096
216	Ga0207712_10000020	3300025961	Bacteria	292796
217	Ga0207712_10007933	3300025961	Bacteria	6709
218	Ga0207668_10004729	3300025972	Bacteria	8009
219	Ga0207668_10007232	3300025972	Bacteria	6592
220	Ga0207658_10000055	3300025986	Bacteria	125014
221	Ga0207658_10012886	3300025986	Bacteria	5709
222	Ga0207658_10039308	3300025986	Bacteria	3413
223	Ga0207677_10016784	3300026023	Bacteria	4347
224	Ga0207677_10158931	3300026023	Bacteria	1753
225	Ga0207703_10008835	3300026035	Bacteria	7944
226	Ga0207639_10007133	3300026041	Bacteria	7614
227	Ga0207639_10644338	3300026041	Bacteria	980
228	Ga0207678_10002463	3300026067	Bacteria	16818
229	Ga0207678_10213601	3300026067	Bacteria	1651
230	Ga0207678_10639931	3300026067	Bacteria	934
231	Ga0207708_10011301	3300026075	Bacteria	6646
232	Ga0207708_10018971	3300026075	Bacteria	5179
233	Ga0207702_10153984	3300026078	Bacteria	2094
234	Ga0207641_10001298	3300026088	Bacteria	24828
235	Ga0207648_10002808	3300026089	Bacteria	18474
236	Ga0207648_10004552	3300026089	Bacteria	14220
237	Ga0207676_10034282	3300026095	Bacteria	3843
238	Ga0207676_10253636	3300026095	Bacteria	1585
239	Ga0207675_100004496	3300026118	Bacteria	13470
240	Ga0207675_100042325	3300026118	Bacteria	4252
241	Ga0207675_100078383	3300026118	Bacteria	3096
242	Ga0207683_10001396	3300026121	Bacteria	21796
243	Ga0207698_10063906	3300026142	Bacteria	2883
244	Ga0207698_10730654	3300026142	Bacteria	987
245	Ga0268266_10002500	3300028379	Bacteria	19615
246	Ga0268266_10010404	3300028379	Bacteria	8131
247	Ga0268266_10025338	3300028379	Bacteria	5045
248	Ga0268265_10000004	3300028380	Bacteria	648376
249	Ga0268265_10052093	3300028380	Bacteria	3093
250	Ga0268265_10303369	3300028380	Bacteria	1439
251	Ga0268264_10000024	3300028381	Bacteria	470081
252	Ga0268264_10007533	3300028381	Bacteria	9081
253	Ga0307511_10065324	3300030521	Bacteria	2725
254	Ga0265327_10000195	3300031251	Bacteria	128364
255	Ga0265327_10001432	3300031251	Bacteria	30164
256	Ga0307413_10011921	3300031824	Bacteria	4301
257	Ga0307413_10056993	3300031824	Bacteria	2387
258	Ga0307410_10067405	3300031852	Bacteria	2469
259	Ga0307410_10120997	3300031852	Bacteria	1909
260	Ga0307406_10102921	3300031901	Bacteria	1949
261	Ga0307407_10105546	3300031903	Bacteria	1758
262	Ga0307409_100026673	3300031995	Bacteria	4079
263	Ga0307416_100038454	3300032002	Bacteria	3692
264	Ga0307411_10058732	3300032005	Bacteria	2547
265	Ga0307415_100126006	3300032126	Bacteria	1930
266	Ga0307415_100591866	3300032126	Bacteria	986
267	Ga0373960_0017210	3300035121	Bacteria	1871
268	Ga0373962_0022842	3300035242	Bacteria	1662
269	Ga0316584_0217052	3300036712	Bacteria	1406
270	Ga0436364_0123211	3300037853	Bacteria	8481
271	Ga0436364_0911230	3300037853	Bacteria	3411
272	Ga0436364_0929723	3300037853	Bacteria	1089
273	Ga0436364_1518806	3300037853	Bacteria	5352
274	Ga0436365_0098557	3300039437	Bacteria	2403
275	Ga0436365_0571433	3300039437	Bacteria	4595
276	Ga0436365_1479739	3300039437	Bacteria	73434
277	Ga0436365_1640556	3300039437	Bacteria	6256
278	Ga0436365_1857005	3300039437	Bacteria	2462
279	Ga0436363_0401056	3300039450	Bacteria	4470
280	Ga0436363_1287577	3300039450	Bacteria	1147
281	Ga0439461_0004625	3300041410	Bacteria	2306
282	Ga0439461_0006988	3300041410	Bacteria	1984
283	Ga0439466_0002627	3300041411	Bacteria	7031
284	Ga0439466_0029639	3300041411	Bacteria	1881
285	Ga0439466_0072931	3300041411	Bacteria	1091
286	Ga0439465_0002699	3300041413	Bacteria	5803
287	Ga0439465_0035327	3300041413	Bacteria	1602
288	Ga0451793_1917720	3300041452	Bacteria	1377
289	Ga0451795_0910377	3300041456	Bacteria	1800
290	Ga0439445_0000297	3300042004	Bacteria	9656
291	Ga0439445_0009046	3300042004	Bacteria	2342
292	Ga0439445_0010232	3300042004	Bacteria	2218
293	Ga0439448_0050305	3300042005	Bacteria	1363
294	Ga0439435_0008559	3300042436	Bacteria	2375
295	Ga0466969_0012463	3300044656	Bacteria	4483
296	Ga0466969_0169379	3300044656	Bacteria	1002
297	Ga0466972_0006692	3300044658	Bacteria	5784
298	Ga0466972_0061243	3300044658	Bacteria	1805
299	Ga0466972_0074698	3300044658	Bacteria	1615
300	Ga0466965_0012970	3300044683	Bacteria	3925
301	Ga0466965_0062550	3300044683	Bacteria	1862
302	Ga0466966_0012961	3300044684	Bacteria	5520
303	Ga0466966_0014326	3300044684	Bacteria	5250
304	Ga0466961_0000997	3300044693	Bacteria	17464
305	Ga0466961_0035403	3300044693	Bacteria	3206
306	Ga0466963_0015142	3300044694	Bacteria	4769
307	Ga0466963_0053554	3300044694	Bacteria	2679
308	Ga0466964_0093399	3300044706	Bacteria	1313
309	Ga0466971_0032453	3300044719	Bacteria	2340
310	Ga0466971_0037047	3300044719	Bacteria	2187
311	Ga0466968_0004191	3300044735	Bacteria	5372
312	Ga0466968_0006279	3300044735	Bacteria	4473
313	Ga0466968_0014662	3300044735	Bacteria	3100
314	Ga0466968_0097135	3300044735	Bacteria	1312
315	Ga0466970_0040614	3300044765	Bacteria	2471
316	Ga0466957_0001718	3300044842	Bacteria	11522
317	Ga0466957_0212193	3300044842	Bacteria	1275
318	Ga0466960_0000175	3300044901	Bacteria	21921
319	Ga0466960_0001664	3300044901	Bacteria	8139
320	Ga0466960_0037935	3300044901	Bacteria	2263
321	Ga0466959_0010817	3300045049	Bacteria	6541
322	Ga0466959_0014801	3300045049	Bacteria	5678
323	Ga0466959_0046294	3300045049	Bacteria	3201
324	Ga0466958_0009168	3300045836	Bacteria	5503
325	Ga0466958_0022570	3300045836	Bacteria	3688
326	Ga0466958_0031571	3300045836	Bacteria	3149
327	Ga0466958_0310869	3300045836	Bacteria	1012
328	Ga0466967_0008027	3300045976	Bacteria	7693
329	Ga0466967_0022814	3300045976	Bacteria	5117
330	Ga0466967_0026481	3300045976	Bacteria	4804
331	Ga0466967_0034810	3300045976	Bacteria	4280
332	Ga0466967_0035445	3300045976	Bacteria	4248
333	Ga0466967_0050945	3300045976	Bacteria	3626
334	Ga0466967_0109953	3300045976	Bacteria	2531
335	Ga0466967_0244341	3300045976	Bacteria	1713
336	Ga0466967_0316975	3300045976	Bacteria	1503
337	Ga0466967_0624111	3300045976	Bacteria	1065
338	Ga0495629_0014161	3300046459	Bacteria	5745
339	Ga0495638_0005895	3300046460	Bacteria	9004
340	Ga0495641_0018720	3300046461	Bacteria	3566
341	Ga0495583_0075816	3300046506	Bacteria	1470
342	Ga0495668_0055090	3300046616	Bacteria	2196
343	Ga0495635_0354701	3300046663	Bacteria	978
344	Ga0495624_0057333	3300046690	Bacteria	2449
345	Ga0495581_0031098	3300047315	Bacteria	3093
346	Ga0495680_0271674	3300047322	Bacteria	1197
347	Ga0495673_0001511	3300047469	Bacteria	18339
348	Ga0495686_0002065	3300047472	Bacteria	19761
349	Ga0495593_0022395	3300047673	Bacteria	3520
350	Ga0496100_0000041	3300048903	Bacteria	92857
351	Ga0496100_0001549	3300048903	Bacteria	11292
352	Ga0496100_0001596	3300048903	Bacteria	11183
353	Ga0496100_0008342	3300048903	Bacteria	5773
354	Ga0496100_0017871	3300048903	Bacteria	4196
355	Ga0496101_0000094	3300048904	Bacteria	95577
356	Ga0496101_0000507	3300048904	Bacteria	24425
357	Ga0496101_0004143	3300048904	Bacteria	9080
358	Ga0496101_0007441	3300048904	Bacteria	7096
359	Ga0496101_0053350	3300048904	Bacteria	2917
360	Ga0496101_0141907	3300048904	Bacteria	1831
361	Ga0496102_0000014	3300048905	Bacteria	310241
362	Ga0496102_0000248	3300048905	Bacteria	70597
363	Ga0496102_0000976	3300048905	Bacteria	26908
364	Ga0496102_0002893	3300048905	Bacteria	14556
365	Ga0496102_0010243	3300048905	Bacteria	8060
366	Ga0496102_0373445	3300048905	Bacteria	1342
367	Ga0496102_0623281	3300048905	Bacteria	1002
368	Ga0496103_0000004	3300048906	Bacteria	510080
369	Ga0496103_0000268	3300048906	Bacteria	49469
370	Ga0496103_0000638	3300048906	Bacteria	26745
371	Ga0496103_0002385	3300048906	Bacteria	11843
372	Ga0496104_0004249	3300048907	Bacteria	12439
373	Ga0496104_0395769	3300048907	Bacteria	1294
374	Ga0496105_0004863	3300048908	Bacteria	10144
375	Ga0496106_0000851	3300048909	Bacteria	22136
376	Ga0496106_0002441	3300048909	Bacteria	13853
377	Ga0496106_0010215	3300048909	Bacteria	6937
378	Ga0496106_0054918	3300048909	Bacteria	3010
379	Ga0496106_0343578	3300048909	Bacteria	1198
380	Ga0496107_0000383	3300048910	Bacteria	24008
381	Ga0496107_0006654	3300048910	Bacteria	7957
382	Ga0496107_0009163	3300048910	Bacteria	6863
383	Ga0496107_0030884	3300048910	Bacteria	3820
384	Ga0496107_0152057	3300048910	Bacteria	1712
385	Ga0496108_0004237	3300048911	Bacteria	11548
386	Ga0496108_0009018	3300048911	Bacteria	8082
387	Ga0496108_0025579	3300048911	Bacteria	4866
388	Ga0496108_0036021	3300048911	Bacteria	4115
389	Ga0496109_0000098	3300048912	Bacteria	90126
390	Ga0496109_0012064	3300048912	Bacteria	7445
391	Ga0496109_0021020	3300048912	Bacteria	5770
392	Ga0496110_0000051	3300048913	Bacteria	58778
393	Ga0496110_0010261	3300048913	Bacteria	7611
394	Ga0496110_0030444	3300048913	Bacteria	4653
395	Ga0496110_0705358	3300048913	Bacteria	911
396	Ga0496111_0046767	3300048914	Bacteria	3116
397	Ga0496111_0340782	3300048914	Bacteria	1110
398	Ga0496112_0010437	3300048915	Bacteria	8424
399	Ga0496112_0028196	3300048915	Bacteria	5417
400	Ga0496114_0000070	3300048917	Bacteria	73843
401	Ga0496114_0002313	3300048917	Bacteria	14515
402	Ga0496114_0003314	3300048917	Bacteria	12375
403	Ga0496114_0048962	3300048917	Bacteria	3516
404	Ga0496115_0011964	3300048918	Bacteria	6519
405	Ga0496115_0031904	3300048918	Bacteria	4154
406	Ga0496115_0071220	3300048918	Bacteria	2819
407	Ga0496116_0000069	3300048919	Bacteria	252643
408	Ga0496116_0002694	3300048919	Bacteria	18332
409	Ga0496117_0000003	3300048920	Bacteria	1881097
410	Ga0496117_0000280	3300048920	Bacteria	95337
411	Ga0496118_0000001	3300048921	Bacteria	1881100
412	Ga0496118_0003322	3300048921	Bacteria	20385
413	Ga0496118_0005391	3300048921	Bacteria	14559
414	Ga0496118_0015775	3300048921	Bacteria	6969
415	Ga0496119_0001073	3300048922	Bacteria	34598
416	Ga0496119_0003778	3300048922	Bacteria	15490
417	Ga0496119_0220321	3300048922	Bacteria	971
418	Ga0496120_0001262	3300048923	Bacteria	31801
419	Ga0496120_0189065	3300048923	Bacteria	1005
420	Ga0496121_0000016	3300048924	Bacteria	562911
421	Ga0496121_0000032	3300048924	Bacteria	378997
422	Ga0496121_0140830	3300048924	Bacteria	1790
423	Ga0496122_0000470	3300048925	Bacteria	84015
424	Ga0496123_0005802	3300048926	Bacteria	12262
425	Ga0496123_0036938	3300048926	Bacteria	3455
426	Ga0496124_0000015	3300048927	Bacteria	460700
427	Ga0496124_0040003	3300048927	Bacteria	4058
428	Ga0496125_0000021	3300048928	Bacteria	460688
429	Ga0496125_0008485	3300048928	Bacteria	10752
430	Ga0496125_0241826	3300048928	Bacteria	1145
431	Ga0496125_0262277	3300048928	Bacteria	1082
432	Ga0496126_0000015	3300048929	Bacteria	663212
433	Ga0496126_0000037	3300048929	Bacteria	353425
434	Ga0496126_0000067	3300048929	Bacteria	249091
435	Ga0496126_0007978	3300048929	Bacteria	11499
436	Ga0496126_0011832	3300048929	Bacteria	8979
437	Ga0496126_0012005	3300048929	Bacteria	8902
438	Ga0496126_0062136	3300048929	Bacteria	3353
439	Ga0501032_0012124	3300049569	Bacteria	6171
440	Ga0501033_0021034	3300049570	Bacteria	4925
441	Ga0501033_0026456	3300049570	Bacteria	4366
442	Ga0501034_0001093	3300049571	Bacteria	38149
443	Ga0501034_0008439	3300049571	Bacteria	10882
444	Ga0501034_0097001	3300049571	Bacteria	2944
445	Ga0501034_0109097	3300049571	Bacteria	2759
446	Ga0501034_0285534	3300049571	Bacteria	1589
447	Ga0501036_0029007	3300049572	Bacteria	4676
448	Ga0501036_0123235	3300049572	Bacteria	2189
449	Ga0501037_0000319	3300049573	Bacteria	40792
450	Ga0501037_0024240	3300049573	Bacteria	4487
451	Ga0501038_0005689	3300049574	Bacteria	11563
452	Ga0501039_0003256	3300049575	Bacteria	12142
453	Ga0501043_0004437	3300049579	Bacteria	11397
454	Ga0501043_0043405	3300049579	Bacteria	3534
455	Ga0501043_0358031	3300049579	Bacteria	1108
456	Ga0501046_0004040	3300049580	Bacteria	13390
457	Ga0501047_0029851	3300049581	Bacteria	5255
458	Ga0501047_0050787	3300049581	Bacteria	4005
459	Ga0501048_0017387	3300049582	Bacteria	5299
460	Ga0501069_0067729	3300049585	Bacteria	1997
461	Ga0501070_0000458	3300049586	Bacteria	37000
462	Ga0501070_0010494	3300049586	Bacteria	7834
463	Ga0501070_0099656	3300049586	Bacteria	2404
464	Ga0501070_0129624	3300049586	Bacteria	2084
465	Ga0501035_0002730	3300049822	Bacteria	17127
466	Ga0501035_0016343	3300049822	Bacteria	6844
467	Ga0501044_0000376	3300049823	Bacteria	55707
468	Ga0501044_0015686	3300049823	Bacteria	8158
469	Ga0501044_0040343	3300049823	Bacteria	4865
470	Ga0501044_0534231	3300049823	Bacteria	1071
471	nmdc:mga03683_133386_c1	3300050489	Bacteria	1112
472	nmdc:mga03683_223951_c1	3300050489	Bacteria	868
473	nmdc:mga03n38_15426_c1	3300050490	Bacteria	2950
474	nmdc:mga03n38_2876_c1	3300050490	Bacteria	5424
475	nmdc:mga03n38_2900_c1	3300050490	Bacteria	5408
476	nmdc:mga03n38_5872_c1	3300050490	Bacteria	4219
477	nmdc:mga00v17_297923_c1	3300050491	Bacteria	1047
478	nmdc:mga00v17_32628_c1	3300050491	Bacteria	3079
479	nmdc:mga00v17_4635_c1	3300050491	Bacteria	7173
480	nmdc:mga0yw44_127066_c1	3300050492	Bacteria	1647
481	nmdc:mga0yw44_26270_c1	3300050492	Bacteria	3324
482	nmdc:mga0yw44_355687_c1	3300050492	Bacteria	986
483	nmdc:mga0yw44_4795_c1	3300050492	Bacteria	6271
484	nmdc:mga0yw44_58439_c1	3300050492	Bacteria	2356
485	nmdc:mga06z11_146811_c1	3300050494	Bacteria	1337
486	nmdc:mga06z11_1808_c1	3300050494	Bacteria	8057
487	nmdc:mga07m45_1319_c1	3300050496	Bacteria	11303
488	nmdc:mga07m45_16897_c1	3300050496	Bacteria	3910
489	nmdc:mga07m45_30683_c1	3300050496	Bacteria	2978
490	nmdc:mga07m45_9032_c1	3300050496	Bacteria	5149
491	nmdc:mga05p37_211540_c1	3300050507	Bacteria	2344
492	nmdc:mga08y16_179852_c1	3300050511	Bacteria	2196
493	nmdc:mga0sz30_129229_c1	3300050516	Bacteria	1113
494	Ga0500610_0020642	3300053079	Bacteria	3219
495	Ga0500635_0000983	3300053080	Bacteria	6852
496	Ga0500643_013841	3300053087	Bacteria	2827
497	Ga0500652_001205	3300053131	Bacteria	8256
498	Ga0500627_0043242	3300053158	Bacteria	1942
499	Ga0500645_000431	3300053730	Bacteria	28734
500	Ga0466962_0021671	3300061719	Bacteria	3084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300045976	Ga0466967_0316975	Ga0466967_0316975_19_705	228
2	3300048928	Ga0496125_0241826	Ga0496125_0241826_287_1075	231
3	3300048929	Ga0496126_0000037	Ga0496126_0000037_48973_49761	231
4	3300044656	Ga0466969_0169379	Ga0466969_0169379_19_729	236
5	3300048927	Ga0496124_0040003	Ga0496124_0040003_2325_3080	244
6	iso_pu_bacteria	2551306166	2552109718	245
7	3300005841	Ga0068863_100006656	Ga0068863_1000066567	248
8	3300005842	Ga0068858_100020513	Ga0068858_1000205132	248
9	3300009101	Ga0105247_10000009	Ga0105247_10000009103	248
10	3300009553	Ga0105249_10000011	Ga0105249_10000011109	248
11	3300013306	Ga0163162_10151156	Ga0163162_101511563	248
12	3300025900	Ga0207710_10000014	Ga0207710_10000014120	248
13	3300025961	Ga0207712_10000020	Ga0207712_10000020170	248
14	3300026088	Ga0207641_10001298	Ga0207641_1000129816	248
15	3300048910	Ga0496107_0030884	Ga0496107_0030884_1188_1988	248
16	3300048922	Ga0496119_0003778	Ga0496119_0003778_10654_11454	248
17	3300048929	Ga0496126_0007978	Ga0496126_0007978_1635_2435	248
18	3300050489	nmdc:mga03683_223951_c1	nmdc:mga03683_223951_c1_62_817	248
19	3300050491	nmdc:mga00v17_297923_c1	nmdc:mga00v17_297923_c1_275_1021	248
20	3300006931	Ga0097620_100868085	Ga0097620_1008680851	251
21	3300009545	Ga0105237_10005076	Ga0105237_1000507610	251
22	3300010375	Ga0105239_10004884	Ga0105239_100048848	251
23	3300044658	Ga0466972_0006692	Ga0466972_0006692_1672_2439	251
24	3300044901	Ga0466960_0000175	Ga0466960_0000175_12916_13683	251
25	3300048922	Ga0496119_0220321	Ga0496119_0220321_53_808	251
26	3300049581	Ga0501047_0050787	Ga0501047_0050787_2228_3115	251
27	3300049823	Ga0501044_0040343	Ga0501044_0040343_3062_3949	251
28	iso_pu_bacteria	2744054611	2744958141	252
29	iso_pu_bacteria	2643221692	2644513216	253
30	3300044694	Ga0466963_0015142	Ga0466963_0015142_3440_4297	254
31	3300045976	Ga0466967_0624111	Ga0466967_0624111_114_971	254
32	3300037853	Ga0436364_0911230	Ga0436364_0911230_101_877	255
33	3300039437	Ga0436365_1640556	Ga0436365_1640556_2875_3654	255
34	3300044693	Ga0466961_0035403	Ga0466961_0035403_164_940	255
35	3300044735	Ga0466968_0006279	Ga0466968_0006279_2336_3112	255
36	3300045049	Ga0466959_0010817	Ga0466959_0010817_2655_3431	255
37	3300045836	Ga0466958_0009168	Ga0466958_0009168_2094_2870	255
38	3300037853	Ga0436364_0123211	Ga0436364_0123211_1970_2752	256
39	3300037853	Ga0436364_0929723	Ga0436364_0929723_14_796	256
40	3300039437	Ga0436365_1479739	Ga0436365_1479739_52642_53424	256
41	3300046460	Ga0495638_0005895	Ga0495638_0005895_2747_3520	256
42	3300048921	Ga0496118_0003322	Ga0496118_0003322_2140_2910	256
43	3300053079	Ga0500610_0020642	Ga0500610_0020642_2135_2908	256
44	3300045836	Ga0466958_0310869	Ga0466958_0310869_102_887	257
45	3300047472	Ga0495686_0002065	Ga0495686_0002065_17225_18013	257
46	3300005367	Ga0070667_100000042	Ga0070667_100000042152	258
47	3300005548	Ga0070665_100138495	Ga0070665_1001384952	258
48	3300005617	Ga0068859_100003293	Ga0068859_1000032935	258
49	3300005843	Ga0068860_100000020	Ga0068860_1000000207	258
50	3300005844	Ga0068862_100002277	Ga0068862_10000227713	258
51	3300006931	Ga0097620_100003293	Ga0097620_1000032935	258
52	3300009177	Ga0105248_10003175	Ga0105248_100031757	258
53	3300025941	Ga0207711_10002575	Ga0207711_100025757	258
54	3300025986	Ga0207658_10000055	Ga0207658_100000557	258
55	3300028379	Ga0268266_10010404	Ga0268266_100104045	258
56	3300028380	Ga0268265_10000004	Ga0268265_10000004263	258
57	3300028381	Ga0268264_10000024	Ga0268264_10000024265	258
58	3300041410	Ga0439461_0004625	Ga0439461_0004625_513_1307	258
59	3300041411	Ga0439466_0029639	Ga0439466_0029639_386_1180	258
60	3300042004	Ga0439445_0000297	Ga0439445_0000297_2934_3728	258
61	3300048905	Ga0496102_0000248	Ga0496102_0000248_12071_12871	258
62	3300048906	Ga0496103_0000268	Ga0496103_0000268_19672_20472	258
63	3300048920	Ga0496117_0000280	Ga0496117_0000280_53999_54799	258
64	3300048921	Ga0496118_0005391	Ga0496118_0005391_12191_12991	258
65	3300048928	Ga0496125_0008485	Ga0496125_0008485_4154_4954	258
66	3300041452	Ga0451793_1917720	Ga0451793_1917720_242_1033	259
67	3300041456	Ga0451795_0910377	Ga0451795_0910377_741_1532	259
68	3300009177	Ga0105248_10014166	Ga0105248_100141665	260
69	3300044658	Ga0466972_0074698	Ga0466972_0074698_623_1417	260
70	3300048903	Ga0496100_0001549	Ga0496100_0001549_7245_8057	260
71	3300048904	Ga0496101_0004143	Ga0496101_0004143_5002_5814	260
72	3300048907	Ga0496104_0004249	Ga0496104_0004249_5059_5871	260
73	3300048908	Ga0496105_0004863	Ga0496105_0004863_1442_2254	260
74	3300048909	Ga0496106_0002441	Ga0496106_0002441_7870_8682	260
75	3300048910	Ga0496107_0009163	Ga0496107_0009163_5128_5940	260
76	3300048917	Ga0496114_0002313	Ga0496114_0002313_8450_9262	260
77	3300048918	Ga0496115_0071220	Ga0496115_0071220_1951_2763	260
78	3300048928	Ga0496125_0262277	Ga0496125_0262277_277_1065	260
79	3300048903	Ga0496100_0001596	Ga0496100_0001596_6875_7666	261
80	3300048904	Ga0496101_0000094	Ga0496101_0000094_75151_75942	261
81	3300048905	Ga0496102_0000014	Ga0496102_0000014_191941_192732	261
82	3300048906	Ga0496103_0000004	Ga0496103_0000004_192447_193238	261
83	3300048919	Ga0496116_0000069	Ga0496116_0000069_193398_194189	261
84	3300048920	Ga0496117_0000003	Ga0496117_0000003_1390850_1391641	261
85	3300048921	Ga0496118_0000001	Ga0496118_0000001_1390853_1391644	261
86	3300048922	Ga0496119_0001073	Ga0496119_0001073_12240_13031	261
87	3300048923	Ga0496120_0001262	Ga0496120_0001262_9314_10105	261
88	3300048924	Ga0496121_0000032	Ga0496121_0000032_283620_284411	261
89	3300048929	Ga0496126_0000067	Ga0496126_0000067_117386_118177	261
90	3300048929	Ga0496126_0062136	Ga0496126_0062136_1897_2688	261
91	3300049586	Ga0501070_0099656	Ga0501070_0099656_1383_2168	261
92	3300050489	nmdc:mga03683_133386_c1	nmdc:mga03683_133386_c1_149_943	261
93	3300050490	nmdc:mga03n38_15426_c1	nmdc:mga03n38_15426_c1_2067_2861	261
94	3300050492	nmdc:mga0yw44_26270_c1	nmdc:mga0yw44_26270_c1_2300_3094	261
95	3300050496	nmdc:mga07m45_9032_c1	nmdc:mga07m45_9032_c1_1710_2504	261
96	3300050511	nmdc:mga08y16_179852_c1	nmdc:mga08y16_179852_c1_30_827	261
97	3300011119	Ga0105246_10205865	Ga0105246_102058652	262
98	3300021384	Ga0213876_10154636	Ga0213876_101546362	262
99	3300021388	Ga0213875_10016565	Ga0213875_100165652	262
100	3300026067	Ga0207678_10639931	Ga0207678_106399311	262
101	3300030521	Ga0307511_10065324	Ga0307511_100653242	262
102	3300037853	Ga0436364_1518806	Ga0436364_1518806_4097_4891	262
103	3300039437	Ga0436365_0098557	Ga0436365_0098557_970_1785	262
104	3300039437	Ga0436365_0571433	Ga0436365_0571433_2507_3301	262
105	3300045976	Ga0466967_0008027	Ga0466967_0008027_1860_2648	262
106	3300048903	Ga0496100_0017871	Ga0496100_0017871_1886_2698	262
107	3300048904	Ga0496101_0141907	Ga0496101_0141907_482_1294	262
108	3300048909	Ga0496106_0054918	Ga0496106_0054918_447_1259	262
109	iso_pu_bacteria	2547132424	2548694236	262
110	iso_pu_bacteria	2738541264	2738665197	262
111	iso_pu_bacteria	2738541356	2739144331	262
112	3300009101	Ga0105247_10140917	Ga0105247_101409171	263
113	3300009147	Ga0114129_10030572	Ga0114129_100305724	263
114	3300009174	Ga0105241_10036851	Ga0105241_100368512	263
115	3300009545	Ga0105237_10043848	Ga0105237_100438484	263
116	3300011119	Ga0105246_10098860	Ga0105246_100988602	263
117	3300013296	Ga0157374_10256190	Ga0157374_102561901	263
118	3300013307	Ga0157372_10013026	Ga0157372_100130263	263
119	3300013308	Ga0157375_10228102	Ga0157375_102281022	263
120	3300014745	Ga0157377_10093027	Ga0157377_100930272	263
121	3300041410	Ga0439461_0006988	Ga0439461_0006988_70_882	263
122	3300041411	Ga0439466_0002627	Ga0439466_0002627_797_1609	263
123	3300041413	Ga0439465_0035327	Ga0439465_0035327_523_1335	263
124	3300042004	Ga0439445_0010232	Ga0439445_0010232_468_1280	263
125	3300048903	Ga0496100_0008342	Ga0496100_0008342_3806_4597	263
126	3300048904	Ga0496101_0007441	Ga0496101_0007441_4493_5284	263
127	3300048905	Ga0496102_0000976	Ga0496102_0000976_3600_4391	263
128	3300048906	Ga0496103_0000638	Ga0496103_0000638_21984_22775	263
129	3300048907	Ga0496104_0395769	Ga0496104_0395769_306_1097	263
130	3300048909	Ga0496106_0000851	Ga0496106_0000851_258_1049	263
131	3300048910	Ga0496107_0000383	Ga0496107_0000383_16395_17186	263
132	3300048911	Ga0496108_0004237	Ga0496108_0004237_948_1751	263
133	3300048912	Ga0496109_0021020	Ga0496109_0021020_1662_2465	263
134	3300048913	Ga0496110_0705358	Ga0496110_0705358_61_852	263
135	3300048915	Ga0496112_0028196	Ga0496112_0028196_2298_3101	263
136	3300048917	Ga0496114_0003314	Ga0496114_0003314_7855_8646	263
137	3300048918	Ga0496115_0011964	Ga0496115_0011964_3221_4012	263
138	3300050490	nmdc:mga03n38_5872_c1	nmdc:mga03n38_5872_c1_802_1593	263
139	3300050492	nmdc:mga0yw44_4795_c1	nmdc:mga0yw44_4795_c1_4478_5269	263
140	3300050494	nmdc:mga06z11_1808_c1	nmdc:mga06z11_1808_c1_4792_5583	263
141	3300050496	nmdc:mga07m45_1319_c1	nmdc:mga07m45_1319_c1_6022_6813	263
142	3300050507	nmdc:mga05p37_211540_c1	nmdc:mga05p37_211540_c1_18_809	263
143	3300005539	Ga0068853_100098279	Ga0068853_1000982792	264
144	3300005564	Ga0070664_100236112	Ga0070664_1002361122	264
145	3300021377	Ga0213874_10044800	Ga0213874_100448002	264
146	3300026041	Ga0207639_10644338	Ga0207639_106443381	264
147	3300026095	Ga0207676_10253636	Ga0207676_102536362	264
148	3300031251	Ga0265327_10000195	Ga0265327_1000019566	264
149	3300039450	Ga0436363_0401056	Ga0436363_0401056_3315_4121	264
150	3300048911	Ga0496108_0036021	Ga0496108_0036021_52_846	264
151	3300048912	Ga0496109_0012064	Ga0496109_0012064_5556_6350	264
152	3300048913	Ga0496110_0010261	Ga0496110_0010261_2727_3521	264
153	3300048914	Ga0496111_0340782	Ga0496111_0340782_118_912	264
154	3300048915	Ga0496112_0010437	Ga0496112_0010437_2504_3298	264
155	3300049581	Ga0501047_0029851	Ga0501047_0029851_4296_5111	264
156	3300003792	Ga0055540_1000003	Ga0055540_1000003373	265
157	3300005367	Ga0070667_100020237	Ga0070667_1000202376	265
158	3300005535	Ga0070684_100323228	Ga0070684_1003232282	265
159	3300006175	Ga0070712_100310810	Ga0070712_1003108102	265
160	3300006852	Ga0075433_10745360	Ga0075433_107453601	265
161	3300009545	Ga0105237_10009765	Ga0105237_100097655	265
162	3300010375	Ga0105239_10016200	Ga0105239_100162005	265
163	3300025303	Ga0209051_1000011	Ga0209051_1000011223	265
164	3300025914	Ga0207671_10003771	Ga0207671_100037718	265
165	3300025914	Ga0207671_10046040	Ga0207671_100460402	265
166	3300025915	Ga0207693_10189460	Ga0207693_101894601	265
167	3300025932	Ga0207690_10382647	Ga0207690_103826472	265
168	3300025986	Ga0207658_10012886	Ga0207658_100128866	265
169	3300026142	Ga0207698_10730654	Ga0207698_107306542	265
170	3300031251	Ga0265327_10001432	Ga0265327_1000143220	265
171	3300039450	Ga0436363_1287577	Ga0436363_1287577_226_1035	265
172	3300042005	Ga0439448_0050305	Ga0439448_0050305_128_955	265
173	3300044656	Ga0466969_0012463	Ga0466969_0012463_20_844	265
174	3300044683	Ga0466965_0062550	Ga0466965_0062550_519_1343	265
175	3300044684	Ga0466966_0012961	Ga0466966_0012961_1882_2706	265
176	3300044693	Ga0466961_0000997	Ga0466961_0000997_13054_13878	265
177	3300044735	Ga0466968_0014662	Ga0466968_0014662_1341_2165	265
178	3300044765	Ga0466970_0040614	Ga0466970_0040614_455_1279	265
179	3300044842	Ga0466957_0001718	Ga0466957_0001718_2064_2888	265
180	3300044901	Ga0466960_0037935	Ga0466960_0037935_1219_2043	265
181	3300045836	Ga0466958_0022570	Ga0466958_0022570_336_1160	265
182	3300045976	Ga0466967_0035445	Ga0466967_0035445_1987_2787	265
183	3300046459	Ga0495629_0014161	Ga0495629_0014161_46_843	265
184	3300046461	Ga0495641_0018720	Ga0495641_0018720_1525_2322	265
185	3300046663	Ga0495635_0354701	Ga0495635_0354701_35_832	265
186	3300046690	Ga0495624_0057333	Ga0495624_0057333_14_811	265
187	3300047315	Ga0495581_0031098	Ga0495581_0031098_379_1176	265
188	3300047322	Ga0495680_0271674	Ga0495680_0271674_253_1050	265
189	3300047673	Ga0495593_0022395	Ga0495593_0022395_761_1558	265
190	3300048903	Ga0496100_0000041	Ga0496100_0000041_92001_92828	265
191	3300048904	Ga0496101_0000507	Ga0496101_0000507_5487_6314	265
192	3300048905	Ga0496102_0010243	Ga0496102_0010243_2074_2901	265
193	3300048905	Ga0496102_0373445	Ga0496102_0373445_155_952	265
194	3300048905	Ga0496102_0623281	Ga0496102_0623281_150_962	265
195	3300048906	Ga0496103_0002385	Ga0496103_0002385_291_1118	265
196	3300048909	Ga0496106_0010215	Ga0496106_0010215_6096_6923	265
197	3300048910	Ga0496107_0006654	Ga0496107_0006654_2282_3109	265
198	3300048911	Ga0496108_0009018	Ga0496108_0009018_4881_5708	265
199	3300048912	Ga0496109_0000098	Ga0496109_0000098_28583_29410	265
200	3300048913	Ga0496110_0000051	Ga0496110_0000051_27507_28334	265
201	3300048914	Ga0496111_0046767	Ga0496111_0046767_616_1443	265
202	3300048917	Ga0496114_0000070	Ga0496114_0000070_24311_25138	265
203	3300048919	Ga0496116_0002694	Ga0496116_0002694_4285_5112	265
204	3300048921	Ga0496118_0015775	Ga0496118_0015775_3317_4144	265
205	3300048923	Ga0496120_0189065	Ga0496120_0189065_29_835	265
206	3300048924	Ga0496121_0000016	Ga0496121_0000016_154710_155537	265
207	3300048925	Ga0496122_0000470	Ga0496122_0000470_57631_58458	265
208	3300048926	Ga0496123_0005802	Ga0496123_0005802_4116_4943	265
209	3300048927	Ga0496124_0000015	Ga0496124_0000015_222853_223680	265
210	3300048928	Ga0496125_0000021	Ga0496125_0000021_237021_237848	265
211	3300048929	Ga0496126_0000015	Ga0496126_0000015_237021_237848	265
212	3300050491	nmdc:mga00v17_32628_c1	nmdc:mga00v17_32628_c1_2237_3055	265
213	3300053080	Ga0500635_0000983	Ga0500635_0000983_1091_1939	265
214	3300053131	Ga0500652_001205	Ga0500652_001205_3698_4546	265
215	iso_pu_bacteria	2842134933	2842138593	265
216	3300005435	Ga0070714_100275075	Ga0070714_1002750752	267
217	3300006028	Ga0070717_10070845	Ga0070717_100708453	267
218	3300044683	Ga0466965_0012970	Ga0466965_0012970_1236_2051	267
219	3300044694	Ga0466963_0053554	Ga0466963_0053554_1793_2605	267
220	3300044735	Ga0466968_0004191	Ga0466968_0004191_3136_3951	267
221	3300045049	Ga0466959_0046294	Ga0466959_0046294_921_1736	267
222	3300045836	Ga0466958_0031571	Ga0466958_0031571_488_1303	267
223	3300045976	Ga0466967_0022814	Ga0466967_0022814_2536_3351	267
224	3300049569	Ga0501032_0012124	Ga0501032_0012124_1979_2794	267
225	3300049570	Ga0501033_0021034	Ga0501033_0021034_858_1673	267
226	3300049571	Ga0501034_0008439	Ga0501034_0008439_716_1531	267
227	3300049572	Ga0501036_0123235	Ga0501036_0123235_43_858	267
228	3300049573	Ga0501037_0024240	Ga0501037_0024240_1173_1988	267
229	3300049579	Ga0501043_0043405	Ga0501043_0043405_88_903	267
230	3300049580	Ga0501046_0004040	Ga0501046_0004040_4847_5662	267
231	3300049582	Ga0501048_0017387	Ga0501048_0017387_1972_2787	267
232	3300049585	Ga0501069_0067729	Ga0501069_0067729_715_1530	267
233	3300049586	Ga0501070_0010494	Ga0501070_0010494_4189_5004	267
234	3300049586	Ga0501070_0129624	Ga0501070_0129624_266_1105	267
235	3300049822	Ga0501035_0002730	Ga0501035_0002730_14621_15436	267
236	3300003320	rootH2_10047012	rootH2_100470124	268
237	3300003792	Ga0055540_1000739	Ga0055540_100073915	268
238	3300005435	Ga0070714_100012119	Ga0070714_1000121192	268
239	3300005435	Ga0070714_100237125	Ga0070714_1002371252	268
240	3300005436	Ga0070713_100025971	Ga0070713_1000259712	268
241	3300005437	Ga0070710_10159434	Ga0070710_101594342	268
242	3300005937	Ga0081455_10099944	Ga0081455_100999443	268
243	3300006038	Ga0075365_10144433	Ga0075365_101444332	268
244	3300006051	Ga0075364_10207327	Ga0075364_102073272	268
245	3300021384	Ga0213876_10004047	Ga0213876_100040476	268
246	3300021384	Ga0213876_10036298	Ga0213876_100362983	268
247	3300025273	Ga0209673_1034700	Ga0209673_10347002	268
248	3300025303	Ga0209051_1006674	Ga0209051_10066747	268
249	3300025303	Ga0209051_1029166	Ga0209051_10291663	268
250	3300025906	Ga0207699_10284834	Ga0207699_102848342	268
251	3300025915	Ga0207693_10135267	Ga0207693_101352672	268
252	3300025928	Ga0207700_10035047	Ga0207700_100350472	268
253	3300025928	Ga0207700_10170971	Ga0207700_101709712	268
254	3300039437	Ga0436365_1857005	Ga0436365_1857005_1441_2271	268
255	3300044706	Ga0466964_0093399	Ga0466964_0093399_395_1213	268
256	3300044719	Ga0466971_0037047	Ga0466971_0037047_836_1654	268
257	3300044842	Ga0466957_0212193	Ga0466957_0212193_340_1170	268
258	3300044901	Ga0466960_0001664	Ga0466960_0001664_2394_3212	268
259	3300045976	Ga0466967_0026481	Ga0466967_0026481_1788_2606	268
260	3300045976	Ga0466967_0050945	Ga0466967_0050945_1742_2560	268
261	3300048929	Ga0496126_0012005	Ga0496126_0012005_4483_5313	268
262	3300049570	Ga0501033_0026456	Ga0501033_0026456_1104_1931	268
263	3300049571	Ga0501034_0109097	Ga0501034_0109097_25_855	268
264	3300049571	Ga0501034_0285534	Ga0501034_0285534_107_934	268
265	3300049579	Ga0501043_0358031	Ga0501043_0358031_269_1096	268
266	3300049822	Ga0501035_0016343	Ga0501035_0016343_2319_3146	268
267	3300049823	Ga0501044_0000376	Ga0501044_0000376_3416_4243	268
268	3300049823	Ga0501044_0534231	Ga0501044_0534231_150_980	268
269	3300050492	nmdc:mga0yw44_355687_c1	nmdc:mga0yw44_355687_c1_157_972	268
270	iso_pu_bacteria	2929212328	2929214700	268
271	3300006048	Ga0075363_100005241	Ga0075363_1000052414	269
272	3300006186	Ga0075369_10001130	Ga0075369_100011302	269
273	3300049571	Ga0501034_0001093	Ga0501034_0001093_7572_8399	269
274	3300049572	Ga0501036_0029007	Ga0501036_0029007_197_1024	269
275	3300049573	Ga0501037_0000319	Ga0501037_0000319_14320_15147	269
276	3300049574	Ga0501038_0005689	Ga0501038_0005689_3799_4626	269
277	3300049575	Ga0501039_0003256	Ga0501039_0003256_11039_11866	269
278	3300049579	Ga0501043_0004437	Ga0501043_0004437_6269_7096	269
279	3300049586	Ga0501070_0000458	Ga0501070_0000458_19268_20095	269
280	3300050490	nmdc:mga03n38_2900_c1	nmdc:mga03n38_2900_c1_4397_5206	269
281	3300050496	nmdc:mga07m45_16897_c1	nmdc:mga07m45_16897_c1_154_963	269
282	iso_pu_bacteria	2902799365	2902801842	269
283	3300005347	Ga0070668_100011153	Ga0070668_1000111537	270
284	3300025972	Ga0207668_10004729	Ga0207668_100047295	270
285	3300036712	Ga0316584_0217052	Ga0316584_0217052_392_1249	270
286	3300048929	Ga0496126_0011832	Ga0496126_0011832_3223_4047	270
287	3300049823	Ga0501044_0015686	Ga0501044_0015686_2727_3548	270
288	3300053730	Ga0500645_000431	Ga0500645_000431_3201_4025	270
289	iso_pu_bacteria	2643221715	2644634865	270
290	iso_pu_bacteria	2738541274	2738705459	270
291	iso_pu_bacteria	2738543028	2739332248	270
292	iso_pu_bacteria	2902810491	2902817087	270
293	3300044684	Ga0466966_0014326	Ga0466966_0014326_4368_5195	271
294	3300044719	Ga0466971_0032453	Ga0466971_0032453_1079_1906	271
295	3300044735	Ga0466968_0097135	Ga0466968_0097135_141_968	271
296	3300045049	Ga0466959_0014801	Ga0466959_0014801_4246_5073	271
297	3300048924	Ga0496121_0140830	Ga0496121_0140830_525_1352	271
298	3300053087	Ga0500643_013841	Ga0500643_013841_565_1398	271
299	3300053158	Ga0500627_0043242	Ga0500627_0043242_769_1596	271
300	3300061719	Ga0466962_0021671	Ga0466962_0021671_150_977	271
301	iso_pu_bacteria	2902792274	2902798266	271
302	3300031824	Ga0307413_10056993	Ga0307413_100569932	272
303	3300031901	Ga0307406_10102921	Ga0307406_101029212	272
304	3300050491	nmdc:mga00v17_4635_c1	nmdc:mga00v17_4635_c1_4505_5347	272
305	3300003792	Ga0055540_1009731	Ga0055540_10097314	273
306	3300003792	Ga0055540_1017077	Ga0055540_10170772	273
307	3300005355	Ga0070671_100001509	Ga0070671_10000150912	273
308	3300005367	Ga0070667_100094829	Ga0070667_1000948292	273
309	3300005548	Ga0070665_100007320	Ga0070665_1000073202	273
310	3300005841	Ga0068863_100006121	Ga0068863_1000061216	273
311	3300005841	Ga0068863_100052510	Ga0068863_1000525104	273
312	3300006038	Ga0075365_10232264	Ga0075365_102322642	273
313	3300006051	Ga0075364_10060600	Ga0075364_100606003	273
314	3300006353	Ga0075370_10208101	Ga0075370_102081012	273
315	3300009092	Ga0105250_10122895	Ga0105250_101228952	273
316	3300009147	Ga0114129_10538137	Ga0114129_105381372	273
317	3300013308	Ga0157375_10455788	Ga0157375_104557882	273
318	3300014325	Ga0163163_10018241	Ga0163163_100182418	273
319	3300025303	Ga0209051_1000812	Ga0209051_100081216	273
320	3300025303	Ga0209051_1001824	Ga0209051_100182418	273
321	3300025986	Ga0207658_10039308	Ga0207658_100393082	273
322	3300028379	Ga0268266_10002500	Ga0268266_1000250015	273
323	3300045976	Ga0466967_0244341	Ga0466967_0244341_729_1553	273
324	3300048905	Ga0496102_0002893	Ga0496102_0002893_6577_7401	273
325	3300048911	Ga0496108_0025579	Ga0496108_0025579_1615_2448	273
326	3300048913	Ga0496110_0030444	Ga0496110_0030444_1509_2333	273
327	3300050492	nmdc:mga0yw44_58439_c1	nmdc:mga0yw44_58439_c1_1010_1834	273
328	3300050516	nmdc:mga0sz30_129229_c1	nmdc:mga0sz30_129229_c1_261_1085	273
329	iso_pu_bacteria	2643221687	2644486575	273
330	iso_pu_bacteria	2902837492	2902840009	273
331	3300005456	Ga0070678_100075485	Ga0070678_1000754851	274
332	3300025922	Ga0207646_10369046	Ga0207646_103690462	274
333	3300025931	Ga0207644_10205758	Ga0207644_102057582	274
334	3300025937	Ga0207669_10050648	Ga0207669_100506483	274
335	3300025941	Ga0207711_10036775	Ga0207711_100367753	274
336	3300044658	Ga0466972_0061243	Ga0466972_0061243_53_901	274
337	3300048926	Ga0496123_0036938	Ga0496123_0036938_1897_2727	274
338	3300005435	Ga0070714_100232453	Ga0070714_1002324532	275
339	3300006042	Ga0075368_10148708	Ga0075368_101487081	275
340	3300006048	Ga0075363_100002132	Ga0075363_1000021323	275
341	3300006353	Ga0075370_10030437	Ga0075370_100304374	275
342	3300013308	Ga0157375_10337757	Ga0157375_103377572	275
343	3300017792	Ga0163161_10296208	Ga0163161_102962082	275
344	3300025929	Ga0207664_10127392	Ga0207664_101273923	275
345	3300026118	Ga0207675_100078383	Ga0207675_1000783833	275
346	3300031824	Ga0307413_10011921	Ga0307413_100119215	275
347	3300031852	Ga0307410_10067405	Ga0307410_100674052	275
348	3300031995	Ga0307409_100026673	Ga0307409_1000266735	275
349	3300032002	Ga0307416_100038454	Ga0307416_1000384542	275
350	3300032005	Ga0307411_10058732	Ga0307411_100587323	275
351	3300032126	Ga0307415_100126006	Ga0307415_1001260063	275
352	3300045976	Ga0466967_0034810	Ga0466967_0034810_2809_3648	275
353	3300046506	Ga0495583_0075816	Ga0495583_0075816_115_966	275
354	3300046616	Ga0495668_0055090	Ga0495668_0055090_995_1846	275
355	3300047469	Ga0495673_0001511	Ga0495673_0001511_15585_16436	275
356	3300006844	Ga0075428_100006651	Ga0075428_1000066516	276
357	3300006847	Ga0075431_100020973	Ga0075431_1000209733	276
358	3300025711	Ga0207696_1065658	Ga0207696_10656582	276
359	3300049571	Ga0501034_0097001	Ga0501034_0097001_445_1275	276
360	3300002244	JGI24742J22300_10000851	JGI24742J22300_100008516	277
361	3300005328	Ga0070676_10048920	Ga0070676_100489203	277
362	3300005330	Ga0070690_100015214	Ga0070690_1000152142	277
363	3300005335	Ga0070666_10034345	Ga0070666_100343452	277
364	3300005337	Ga0070682_100005653	Ga0070682_1000056533	277
365	3300005338	Ga0068868_100007656	Ga0068868_1000076562	277
366	3300005340	Ga0070689_100118500	Ga0070689_1001185002	277
367	3300005343	Ga0070687_100075682	Ga0070687_1000756822	277
368	3300005347	Ga0070668_100002256	Ga0070668_1000022566	277
369	3300005353	Ga0070669_100004872	Ga0070669_1000048727	277
370	3300005356	Ga0070674_100000330	Ga0070674_10000033014	277
371	3300005367	Ga0070667_100032397	Ga0070667_1000323975	277
372	3300005439	Ga0070711_100006569	Ga0070711_1000065697	277
373	3300005439	Ga0070711_100107019	Ga0070711_1001070192	277
374	3300005441	Ga0070700_100037630	Ga0070700_1000376302	277
375	3300005441	Ga0070700_100128994	Ga0070700_1001289942	277
376	3300005444	Ga0070694_100022792	Ga0070694_1000227922	277
377	3300005455	Ga0070663_100004199	Ga0070663_1000041999	277
378	3300005456	Ga0070678_100011778	Ga0070678_1000117783	277
379	3300005456	Ga0070678_100182466	Ga0070678_1001824662	277
380	3300005457	Ga0070662_100009566	Ga0070662_1000095667	277
381	3300005457	Ga0070662_100030403	Ga0070662_1000304034	277
382	3300005459	Ga0068867_100001083	Ga0068867_10000108312	277
383	3300005536	Ga0070697_100106914	Ga0070697_1001069142	277
384	3300005539	Ga0068853_100024319	Ga0068853_1000243193	277
385	3300005539	Ga0068853_100123585	Ga0068853_1001235852	277
386	3300005539	Ga0068853_100452496	Ga0068853_1004524962	277
387	3300005546	Ga0070696_100012136	Ga0070696_1000121362	277
388	3300005546	Ga0070696_100043984	Ga0070696_1000439844	277
389	3300005547	Ga0070693_100118233	Ga0070693_1001182332	277
390	3300005548	Ga0070665_100013740	Ga0070665_1000137402	277
391	3300005549	Ga0070704_100000296	Ga0070704_1000002962	277
392	3300005563	Ga0068855_100154075	Ga0068855_1001540753	277
393	3300005578	Ga0068854_100004078	Ga0068854_1000040786	277
394	3300005615	Ga0070702_100002214	Ga0070702_1000022146	277
395	3300005615	Ga0070702_100028014	Ga0070702_1000280143	277
396	3300005616	Ga0068852_100090959	Ga0068852_1000909592	277
397	3300005617	Ga0068859_100008137	Ga0068859_1000081376	277
398	3300005718	Ga0068866_10000928	Ga0068866_100009287	277
399	3300005719	Ga0068861_100001249	Ga0068861_1000012499	277
400	3300005842	Ga0068858_100002786	Ga0068858_1000027866	277
401	3300005843	Ga0068860_100003649	Ga0068860_1000036499	277
402	3300005843	Ga0068860_100351050	Ga0068860_1003510502	277
403	3300005844	Ga0068862_100013205	Ga0068862_1000132052	277
404	3300005844	Ga0068862_100238909	Ga0068862_1002389092	277
405	3300005983	Ga0081540_1113684	Ga0081540_11136842	277
406	3300006038	Ga0075365_10120171	Ga0075365_101201712	277
407	3300006038	Ga0075365_10141596	Ga0075365_101415962	277
408	3300006042	Ga0075368_10017358	Ga0075368_100173582	277
409	3300006048	Ga0075363_100000083	Ga0075363_1000000836	277
410	3300006048	Ga0075363_100073808	Ga0075363_1000738083	277
411	3300006048	Ga0075363_100121519	Ga0075363_1001215192	277
412	3300006051	Ga0075364_10005547	Ga0075364_100055473	277
413	3300006051	Ga0075364_10036019	Ga0075364_100360193	277
414	3300006051	Ga0075364_10126412	Ga0075364_101264122	277
415	3300006163	Ga0070715_10014934	Ga0070715_100149343	277
416	3300006173	Ga0070716_100002757	Ga0070716_1000027576	277
417	3300006175	Ga0070712_100003355	Ga0070712_1000033552	277
418	3300006175	Ga0070712_100061330	Ga0070712_1000613303	277
419	3300006178	Ga0075367_10007896	Ga0075367_100078965	277
420	3300006178	Ga0075367_10159293	Ga0075367_101592932	277
421	3300006186	Ga0075369_10000536	Ga0075369_100005363	277
422	3300006237	Ga0097621_100018722	Ga0097621_1000187223	277
423	3300006353	Ga0075370_10006858	Ga0075370_100068586	277
424	3300006353	Ga0075370_10018527	Ga0075370_100185274	277
425	3300006881	Ga0068865_100003823	Ga0068865_1000038232	277
426	3300006931	Ga0097620_100008137	Ga0097620_1000081378	277
427	3300009098	Ga0105245_10000730	Ga0105245_1000073023	277
428	3300009098	Ga0105245_10062713	Ga0105245_100627132	277
429	3300009101	Ga0105247_10001224	Ga0105247_1000122415	277
430	3300009101	Ga0105247_10065572	Ga0105247_100655722	277
431	3300009148	Ga0105243_10001353	Ga0105243_1000135329	277
432	3300009176	Ga0105242_10000385	Ga0105242_1000038529	277
433	3300009176	Ga0105242_10144720	Ga0105242_101447202	277
434	3300009177	Ga0105248_10003351	Ga0105248_1000335115	277
435	3300009551	Ga0105238_10366690	Ga0105238_103666901	277
436	3300009553	Ga0105249_10001770	Ga0105249_100017709	277
437	3300010375	Ga0105239_10020239	Ga0105239_100202393	277
438	3300013297	Ga0157378_10024489	Ga0157378_100244896	277
439	3300013297	Ga0157378_10187871	Ga0157378_101878712	277
440	3300013306	Ga0163162_10016281	Ga0163162_100162818	277
441	3300013306	Ga0163162_10191545	Ga0163162_101915453	277
442	3300013308	Ga0157375_10001319	Ga0157375_100013198	277
443	3300014326	Ga0157380_10090966	Ga0157380_100909662	277
444	3300014968	Ga0157379_10039874	Ga0157379_100398743	277
445	3300014968	Ga0157379_10213114	Ga0157379_102131142	277
446	3300017792	Ga0163161_10049216	Ga0163161_100492163	277
447	3300025898	Ga0207692_10005824	Ga0207692_100058243	277
448	3300025899	Ga0207642_10000590	Ga0207642_100005906	277
449	3300025900	Ga0207710_10001059	Ga0207710_100010596	277
450	3300025900	Ga0207710_10024575	Ga0207710_100245753	277
451	3300025901	Ga0207688_10002391	Ga0207688_100023918	277
452	3300025901	Ga0207688_10049631	Ga0207688_100496312	277
453	3300025903	Ga0207680_10041277	Ga0207680_100412773	277
454	3300025906	Ga0207699_10123446	Ga0207699_101234462	277
455	3300025907	Ga0207645_10005501	Ga0207645_100055013	277
456	3300025908	Ga0207643_10064892	Ga0207643_100648922	277
457	3300025915	Ga0207693_10001329	Ga0207693_100013299	277
458	3300025915	Ga0207693_10002647	Ga0207693_100026479	277
459	3300025916	Ga0207663_10055365	Ga0207663_100553653	277
460	3300025918	Ga0207662_10024941	Ga0207662_100249413	277
461	3300025924	Ga0207694_10264098	Ga0207694_102640982	277
462	3300025927	Ga0207687_10027158	Ga0207687_100271584	277
463	3300025933	Ga0207706_10049965	Ga0207706_100499655	277
464	3300025934	Ga0207686_10011365	Ga0207686_100113652	277
465	3300025935	Ga0207709_10007873	Ga0207709_100078732	277
466	3300025935	Ga0207709_10027057	Ga0207709_100270572	277
467	3300025937	Ga0207669_10010812	Ga0207669_100108123	277
468	3300025938	Ga0207704_10000575	Ga0207704_100005756	277
469	3300025938	Ga0207704_10064853	Ga0207704_100648532	277
470	3300025938	Ga0207704_10241117	Ga0207704_102411171	277
471	3300025939	Ga0207665_10015923	Ga0207665_100159233	277
472	3300025940	Ga0207691_10074607	Ga0207691_100746073	277
473	3300025941	Ga0207711_10021949	Ga0207711_100219496	277
474	3300025942	Ga0207689_10039102	Ga0207689_100391022	277
475	3300025949	Ga0207667_10028239	Ga0207667_100282396	277
476	3300025961	Ga0207712_10007933	Ga0207712_100079336	277
477	3300025972	Ga0207668_10007232	Ga0207668_100072326	277
478	3300026023	Ga0207677_10016784	Ga0207677_100167842	277
479	3300026023	Ga0207677_10158931	Ga0207677_101589312	277
480	3300026035	Ga0207703_10008835	Ga0207703_100088356	277
481	3300026041	Ga0207639_10007133	Ga0207639_100071336	277
482	3300026067	Ga0207678_10002463	Ga0207678_100024636	277
483	3300026067	Ga0207678_10213601	Ga0207678_102136012	277
484	3300026075	Ga0207708_10011301	Ga0207708_100113016	277
485	3300026075	Ga0207708_10018971	Ga0207708_100189713	277
486	3300026078	Ga0207702_10153984	Ga0207702_101539842	277
487	3300026089	Ga0207648_10002808	Ga0207648_1000280812	277
488	3300026089	Ga0207648_10004552	Ga0207648_1000455210	277
489	3300026095	Ga0207676_10034282	Ga0207676_100342823	277
490	3300026118	Ga0207675_100004496	Ga0207675_1000044969	277
491	3300026118	Ga0207675_100042325	Ga0207675_1000423252	277
492	3300026121	Ga0207683_10001396	Ga0207683_1000139614	277
493	3300026142	Ga0207698_10063906	Ga0207698_100639062	277
494	3300028379	Ga0268266_10025338	Ga0268266_100253386	277
495	3300028380	Ga0268265_10052093	Ga0268265_100520934	277
496	3300028380	Ga0268265_10303369	Ga0268265_103033692	277
497	3300028381	Ga0268264_10007533	Ga0268264_100075339	277
498	3300031852	Ga0307410_10120997	Ga0307410_101209972	277
499	3300031903	Ga0307407_10105546	Ga0307407_101055462	277
500	3300032126	Ga0307415_100591866	Ga0307415_1005918661	277
501	3300035121	Ga0373960_0017210	Ga0373960_0017210_89_925	277
502	3300035242	Ga0373962_0022842	Ga0373962_0022842_102_938	277
503	3300041411	Ga0439466_0072931	Ga0439466_0072931_64_897	277
504	3300041413	Ga0439465_0002699	Ga0439465_0002699_65_898	277
505	3300042004	Ga0439445_0009046	Ga0439445_0009046_834_1667	277
506	3300042436	Ga0439435_0008559	Ga0439435_0008559_1483_2316	277
507	3300045976	Ga0466967_0109953	Ga0466967_0109953_400_1245	277
508	3300048904	Ga0496101_0053350	Ga0496101_0053350_250_1086	277
509	3300048909	Ga0496106_0343578	Ga0496106_0343578_96_932	277
510	3300048910	Ga0496107_0152057	Ga0496107_0152057_88_924	277
511	3300048917	Ga0496114_0048962	Ga0496114_0048962_2129_2965	277
512	3300048918	Ga0496115_0031904	Ga0496115_0031904_2974_3810	277
513	3300050490	nmdc:mga03n38_2876_c1	nmdc:mga03n38_2876_c1_2642_3475	277
514	3300050492	nmdc:mga0yw44_127066_c1	nmdc:mga0yw44_127066_c1_249_1085	277
515	3300050494	nmdc:mga06z11_146811_c1	nmdc:mga06z11_146811_c1_285_1118	277
516	3300050496	nmdc:mga07m45_30683_c1	nmdc:mga07m45_30683_c1_2101_2934	277

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3qsj-assembly1.cif.gz_A	crystal structure of nudix hydrolase from alicyclobacillus acidocaldarius	0.8303	7	230
3qsj-assembly1.cif.gz_A	crystal structure of nudix hydrolase from alicyclobacillus acidocaldarius	0.8093	7	230
5gg6-assembly2.cif.gz_B	crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp	0.809	7	219
6m6y-assembly1.cif.gz_A	crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp	0.8072	7	214
6m72-assembly1.cif.gz_A	crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgdp	0.806	7	214

ID	Description	Score	Start	End	Superfamily
af_O53287_11_257_3.90.79.10	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.9771	5	238	3.90.79.10
af_O53287_11_257_3.90.79.10	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.9223	5	238	3.90.79.10
3qsjA00	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.8227	7	230	3.90.79.10
af_P91148_5_207_3.90.79.10	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.8222	3	232	3.90.79.10
af_P91148_5_207_3.90.79.10	Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase	0.8184	3	232	3.90.79.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2S8KVN2-F1-model_v4	deleted	0.9894	1	228
AF-A0A1X1XGN1-F1-model_v4	NUDIX hydrolase	0.9891	2	266	GO:0016818 GO:0046872
AF-A0A853M186-F1-model_v4	NUDIX hydrolase	0.9882	3	171	GO:0016818 GO:0046872
AF-A0A1X1XGN1-F1-model_v4	NUDIX hydrolase	0.9854	2	266	GO:0016818 GO:0046872
AF-A0A1A1XIA9-F1-model_v4	deleted	0.9819	1	266

Feature Viewer

pLDDT	pTM	Quality
88.19	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F457979

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map