F457951

General Info

Members Datasets Scaffolds Average Seq Length
516 312 511 128

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1005085|Ga0055526_10050854
Length 129
Sequence MKRVTGIGGIFFNAKEPAALRDWYRTHLGVDVQAWGGAAFSWTDEAGQPTGGSTIWSIGAAEGGDGFGPNKAPFMINYRVADLTALLKALRDEGCNVLEKSDDSEYGKFGWVIDPEGNKVELWEPPAGQ

Samples

Sample ID Description Type Environment
1 2818991457 Xanthomonas translucens 569 Isolate Unclassified
2 2831864461 Roseateles noduli HZ7 Isolate Nodule
3 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
4 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
5 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
166 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
198 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
199 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
212 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
213 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
218 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
219 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
223 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
224 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
225 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
226 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
227 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
231 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
232 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
236 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
239 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
240 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
244 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
245 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
246 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
250 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
253 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
254 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
255 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
264 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
281 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
282 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
283 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
284 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
285 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
286 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
289 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
290 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
291 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
292 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
293 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
294 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
304 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
305 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
306 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
307 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
308 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
309 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
310 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.84
Metatranscriptomes 0.19
Isolates 0.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 0.19
Rhizoplane 1.74
Rhizosphere 93.99
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1005085 3300003771 Bacteria 7677
2 Ga0055528_1063016 3300003790 Bacteria 693
3 Ga0058692_1000081 3300003856 Bacteria 69376
4 Ga0055543_1004678 3300004625 Bacteria 3663
5 Ga0065165_1000562 3300005262 Bacteria 55318
6 Ga0065165_1000675 3300005262 Bacteria 49121
7 Ga0065704_10757879 3300005289 Bacteria 539
8 Ga0065715_10313755 3300005293 Bacteria 1015
9 Ga0065707_10133447 3300005295 Unclassified 1881
10 Ga0070658_10892076 3300005327 Bacteria 773
11 Ga0070676_10335604 3300005328 Bacteria 1035
12 Ga0070690_100134313 3300005330 Bacteria 1674
13 Ga0070670_100240931 3300005331 Bacteria 1574
14 Ga0068869_100466786 3300005334 Bacteria 1049
15 Ga0070680_100365754 3300005336 Bacteria 1227
16 Ga0070660_101046358 3300005339 Bacteria 690
17 Ga0070660_101820069 3300005339 Bacteria 519
18 Ga0070689_100140090 3300005340 Bacteria 1945
19 Ga0070669_100170862 3300005353 Bacteria 1694
20 Ga0070669_100277999 3300005353 Bacteria 1341
21 Ga0070675_100026726 3300005354 Bacteria 4631
22 Ga0070675_100038788 3300005354 Bacteria 3884
23 Ga0070675_101283779 3300005354 Bacteria 674
24 Ga0070674_100182083 3300005356 Bacteria 1610
25 Ga0070674_100505873 3300005356 Bacteria 1007
26 Ga0070674_100858276 3300005356 Bacteria 788
27 Ga0070673_100342165 3300005364 Bacteria 1326
28 Ga0070709_11301665 3300005434 Bacteria 586
29 Ga0070714_102149359 3300005435 Bacteria 544
30 Ga0070701_10138618 3300005438 Unclassified 1389
31 Ga0070705_100000718 3300005440 Bacteria 18884
32 Ga0070705_100043989 3300005440 Unclassified 2563
33 Ga0070705_101238812 3300005440 Bacteria 616
34 Ga0070700_100115975 3300005441 Unclassified 1788
35 Ga0070700_101126551 3300005441 Bacteria 652
36 Ga0070694_101312126 3300005444 Bacteria 609
37 Ga0070708_100000078 3300005445 Bacteria 62606
38 Ga0070708_100023206 3300005445 Bacteria 5272
39 Ga0070708_100324913 3300005445 Bacteria 1449
40 Ga0070708_100636030 3300005445 Bacteria 1005
41 Ga0070708_100863998 3300005445 Bacteria 850
42 Ga0070678_100026865 3300005456 Bacteria 3899
43 Ga0070678_100034945 3300005456 Unclassified 3505
44 Ga0070678_100503071 3300005456 Bacteria 1069
45 Ga0070678_102060593 3300005456 Bacteria 540
46 Ga0070681_10010815 3300005458 Bacteria 9020
47 Ga0068867_100094406 3300005459 Bacteria 2274
48 Ga0068867_100236755 3300005459 Bacteria 1478
49 Ga0068867_100553859 3300005459 Bacteria 996
50 Ga0068867_100725189 3300005459 Bacteria 879
51 Ga0068867_101300241 3300005459 Bacteria 671
52 Ga0070685_10035100 3300005466 Unclassified 2828
53 Ga0070685_10041751 3300005466 Bacteria 2615
54 Ga0070685_11181247 3300005466 Bacteria 581
55 Ga0070706_100042015 3300005467 Bacteria 4222
56 Ga0070707_100033592 3300005468 Bacteria 4891
57 Ga0070707_100416603 3300005468 Bacteria 1304
58 Ga0070707_100533546 3300005468 Bacteria 1136
59 Ga0070698_100018518 3300005471 Bacteria 7332
60 Ga0070698_100071572 3300005471 Unclassified 3477
61 Ga0070699_100040647 3300005518 Bacteria 4026
62 Ga0070699_100091588 3300005518 Bacteria 2658
63 Ga0070699_100178852 3300005518 Bacteria 1882
64 Ga0070699_100766762 3300005518 Bacteria 882
65 Ga0070684_100154559 3300005535 Bacteria 2080
66 Ga0070697_100192285 3300005536 Bacteria 1732
67 Ga0068853_100713367 3300005539 Bacteria 957
68 Ga0068853_100765646 3300005539 Unclassified 923
69 Ga0070672_100060846 3300005543 Bacteria 2975
70 Ga0070672_100094859 3300005543 Bacteria 2412
71 Ga0070686_100008690 3300005544 Bacteria 5691
72 Ga0070686_101400481 3300005544 Bacteria 587
73 Ga0070695_100059282 3300005545 Bacteria 2477
74 Ga0070695_100127274 3300005545 Bacteria 1751
75 Ga0070695_100207432 3300005545 Bacteria 1404
76 Ga0070695_100845600 3300005545 Bacteria 736
77 Ga0070696_100010988 3300005546 Bacteria 6062
78 Ga0070696_100652021 3300005546 Unclassified 853
79 Ga0070665_100000499 3300005548 Bacteria 56184
80 Ga0070665_100366702 3300005548 Bacteria 1447
81 Ga0070665_100559933 3300005548 Bacteria 1155
82 Ga0070665_102097869 3300005548 Bacteria 570
83 Ga0070704_100399258 3300005549 Bacteria 1173
84 Ga0070704_100575617 3300005549 Bacteria 987
85 Ga0070704_100717826 3300005549 Unclassified 888
86 Ga0070704_100825521 3300005549 Bacteria 830
87 Ga0068855_101124685 3300005563 Bacteria 820
88 Ga0070664_100121327 3300005564 Bacteria 2289
89 Ga0068857_100537621 3300005577 Bacteria 1100
90 Ga0068854_100817233 3300005578 Bacteria 814
91 Ga0068856_100179369 3300005614 Bacteria 2131
92 Ga0068856_101589282 3300005614 Bacteria 667
93 Ga0070702_100168942 3300005615 Bacteria 1421
94 Ga0070702_100897048 3300005615 Unclassified 694
95 Ga0068852_100701542 3300005616 Bacteria 1022
96 Ga0068859_100052428 3300005617 Bacteria 4101
97 Ga0068859_100672800 3300005617 Bacteria 1126
98 Ga0068859_100882011 3300005617 Bacteria 980
99 Ga0068864_101275252 3300005618 Unclassified 735
100 Ga0068864_101436148 3300005618 Bacteria 692
101 Ga0068866_10055557 3300005718 Unclassified 2034
102 Ga0068866_10278197 3300005718 Bacteria 1036
103 Ga0068861_101678787 3300005719 Bacteria 628
104 Ga0068870_10034054 3300005840 Bacteria 2604
105 Ga0068863_100058667 3300005841 Bacteria 3642
106 Ga0068863_100231723 3300005841 Unclassified 1781
107 Ga0068863_101264317 3300005841 Bacteria 744
108 Ga0068863_102107509 3300005841 Bacteria 574
109 Ga0068858_100301503 3300005842 Bacteria 1529
110 Ga0068860_100002637 3300005843 Bacteria 18660
111 Ga0068860_100064311 3300005843 Bacteria 3484
112 Ga0068862_100253578 3300005844 Bacteria 1604
113 Ga0068862_101823050 3300005844 Bacteria 618
114 Ga0070717_10952275 3300006028 Bacteria 782
115 Ga0070716_100666559 3300006173 Bacteria 791
116 Ga0070712_100647586 3300006175 Bacteria 897
117 Ga0097621_100015090 3300006237 Bacteria 5801
118 Ga0097621_100089420 3300006237 Bacteria 2575
119 Ga0097621_100255859 3300006237 Bacteria 1535
120 Ga0068871_100014244 3300006358 Bacteria 5922
121 Ga0068871_100090445 3300006358 Bacteria 2549
122 Ga0068871_100224958 3300006358 Bacteria 1627
123 Ga0075428_100098862 3300006844 Bacteria 3181
124 Ga0075430_100033032 3300006846 Unclassified 4392
125 Ga0075431_100003665 3300006847 Bacteria 14905
126 Ga0075431_100004025 3300006847 Bacteria 14322
127 Ga0075431_100018322 3300006847 Bacteria 7127
128 Ga0075433_10085628 3300006852 Bacteria 2782
129 Ga0075433_10158271 3300006852 Bacteria 2015
130 Ga0075434_100084878 3300006871 Bacteria 3165
131 Ga0075434_100286982 3300006871 Unclassified 1666
132 Ga0075429_100095842 3300006880 Bacteria 2588
133 Ga0075429_100142895 3300006880 Bacteria 2095
134 Ga0075429_101719823 3300006880 Bacteria 545
135 Ga0068865_100092024 3300006881 Bacteria 2202
136 Ga0068865_100140056 3300006881 Unclassified 1823
137 Ga0068865_100588818 3300006881 Bacteria 939
138 Ga0075436_100077371 3300006914 Bacteria 2304
139 Ga0097620_100052428 3300006931 Bacteria 4101
140 Ga0097620_100672803 3300006931 Bacteria 1126
141 Ga0097620_100881931 3300006931 Bacteria 980
142 Ga0075435_100487008 3300007076 Bacteria 1066
143 Ga0105240_10472276 3300009093 Bacteria 1399
144 Ga0111539_10129073 3300009094 Unclassified 2961
145 Ga0111539_10200742 3300009094 Bacteria 2325
146 Ga0111539_11016618 3300009094 Bacteria 964
147 Ga0111539_11201424 3300009094 Unclassified 881
148 Ga0111539_11677189 3300009094 Bacteria 737
149 Ga0111539_12648813 3300009094 Bacteria 581
150 Ga0105245_11596906 3300009098 Bacteria 704
151 Ga0105247_10113466 3300009101 Bacteria 1747
152 Ga0114129_10062076 3300009147 Bacteria 5221
153 Ga0114129_10141807 3300009147 Bacteria 3293
154 Ga0114129_10874785 3300009147 Bacteria 1140
155 Ga0114129_11445981 3300009147 Bacteria 847
156 Ga0105243_10000250 3300009148 Bacteria 61801
157 Ga0105243_10078161 3300009148 Bacteria 2693
158 Ga0105243_10193467 3300009148 Bacteria 1778
159 Ga0105243_11519105 3300009148 Bacteria 694
160 Ga0105243_12559050 3300009148 Bacteria 550
161 Ga0105241_12170488 3300009174 Bacteria 550
162 Ga0105242_10034795 3300009176 Bacteria 4039
163 Ga0105248_11281977 3300009177 Unclassified 829
164 Ga0105237_10376777 3300009545 Bacteria 1424
165 Ga0105238_10564414 3300009551 Bacteria 1143
166 Ga0105238_11246246 3300009551 Bacteria 769
167 Ga0105249_11786181 3300009553 Bacteria 687
168 Ga0105249_12064831 3300009553 Bacteria 643
169 Ga0099796_10484406 3300010159 Bacteria 553
170 Ga0105239_10052137 3300010375 Bacteria 4486
171 Ga0105239_10799974 3300010375 Bacteria 1080
172 Ga0105246_11046552 3300011119 Bacteria 742
173 Ga0157370_10430119 3300013104 Bacteria 1214
174 Ga0157369_11023043 3300013105 Bacteria 845
175 Ga0157374_10057349 3300013296 Bacteria 3637
176 Ga0157378_10077730 3300013297 Bacteria 2992
177 Ga0157378_10343666 3300013297 Bacteria 1456
178 Ga0157378_11359060 3300013297 Unclassified 753
179 Ga0157378_12196052 3300013297 Bacteria 603
180 Ga0163162_10431032 3300013306 Bacteria 1450
181 Ga0163162_11372356 3300013306 Bacteria 804
182 Ga0163162_12419590 3300013306 Bacteria 604
183 Ga0157375_10177865 3300013308 Unclassified 2278
184 Ga0157375_10495530 3300013308 Bacteria 1386
185 Ga0157375_10971522 3300013308 Bacteria 990
186 Ga0157375_12439133 3300013308 Bacteria 624
187 Ga0163163_10030013 3300014325 Bacteria 5234
188 Ga0163163_10094087 3300014325 Unclassified 3014
189 Ga0163163_10101311 3300014325 Bacteria 2902
190 Ga0157380_10076579 3300014326 Bacteria 2723
191 Ga0157380_10397704 3300014326 Bacteria 1306
192 Ga0157380_11379906 3300014326 Bacteria 754
193 Ga0157379_10014279 3300014968 Bacteria 6966
194 Ga0157379_10306373 3300014968 Bacteria 1448
195 Ga0157376_10002050 3300014969 Bacteria 13514
196 Ga0157376_10040411 3300014969 Bacteria 3812
197 Ga0157376_10508596 3300014969 Bacteria 1185
198 Ga0157376_10548487 3300014969 Bacteria 1144
199 Ga0157376_12132332 3300014969 Bacteria 599
200 Ga0157376_12571743 3300014969 Bacteria 549
201 Ga0182005_1000690 3300015265 Bacteria 15757
202 Ga0209564_1000005 3300025295 Bacteria 1147192
203 Ga0207697_10063028 3300025315 Bacteria 1545
204 Ga0207697_10455741 3300025315 Bacteria 567
205 Ga0207656_10005521 3300025321 Bacteria 4475
206 Ga0207653_10000070 3300025885 Bacteria 76652
207 Ga0207710_10022834 3300025900 Bacteria 2685
208 Ga0207710_10051836 3300025900 Bacteria 1843
209 Ga0207688_10192874 3300025901 Bacteria 1219
210 Ga0207680_10916142 3300025903 Bacteria 628
211 Ga0207699_11109372 3300025906 Bacteria 586
212 Ga0207645_10489306 3300025907 Bacteria 832
213 Ga0207645_10553389 3300025907 Bacteria 780
214 Ga0207643_10031742 3300025908 Bacteria 2947
215 Ga0207684_10000102 3300025910 Bacteria 162120
216 Ga0207684_10037157 3300025910 Bacteria 4133
217 Ga0207684_10037711 3300025910 Bacteria 4101
218 Ga0207654_11304248 3300025911 Unclassified 529
219 Ga0207707_10008117 3300025912 Bacteria 9115
220 Ga0207695_10110949 3300025913 Bacteria 2722
221 Ga0207695_10407322 3300025913 Bacteria 1244
222 Ga0207693_10012040 3300025915 Bacteria 6994
223 Ga0207693_10055658 3300025915 Unclassified 3103
224 Ga0207693_10553794 3300025915 Bacteria 897
225 Ga0207663_10998413 3300025916 Bacteria 671
226 Ga0207660_10343104 3300025917 Bacteria 1196
227 Ga0207662_10203903 3300025918 Bacteria 1281
228 Ga0207662_10407683 3300025918 Unclassified 923
229 Ga0207662_11217346 3300025918 Unclassified 535
230 Ga0207652_11129162 3300025921 Bacteria 684
231 Ga0207646_10263972 3300025922 Bacteria 1556
232 Ga0207646_10404835 3300025922 Unclassified 1232
233 Ga0207646_10944643 3300025922 Bacteria 764
234 Ga0207694_10387287 3300025924 Bacteria 1161
235 Ga0207650_10004372 3300025925 Bacteria 9655
236 Ga0207650_10867204 3300025925 Unclassified 766
237 Ga0207659_10147378 3300025926 Unclassified 1834
238 Ga0207659_10426668 3300025926 Bacteria 1113
239 Ga0207687_10474521 3300025927 Bacteria 1041
240 Ga0207687_11196214 3300025927 Bacteria 653
241 Ga0207664_10454521 3300025929 Bacteria 1143
242 Ga0207664_10458772 3300025929 Bacteria 1138
243 Ga0207706_10158868 3300025933 Bacteria 1988
244 Ga0207706_10165553 3300025933 Bacteria 1943
245 Ga0207686_10053140 3300025934 Bacteria 2531
246 Ga0207686_10313366 3300025934 Bacteria 1169
247 Ga0207686_10548191 3300025934 Unclassified 904
248 Ga0207709_10000384 3300025935 Bacteria 43883
249 Ga0207709_10229821 3300025935 Bacteria 1343
250 Ga0207670_10080414 3300025936 Unclassified 2278
251 Ga0207670_10146068 3300025936 Bacteria 1749
252 Ga0207669_10036771 3300025937 Bacteria 2802
253 Ga0207669_10438499 3300025937 Bacteria 1032
254 Ga0207704_10061725 3300025938 Bacteria 2327
255 Ga0207665_10031582 3300025939 Bacteria 3504
256 Ga0207691_10068187 3300025940 Bacteria 3214
257 Ga0207691_10115797 3300025940 Bacteria 2380
258 Ga0207691_10277660 3300025940 Bacteria 1442
259 Ga0207691_11203300 3300025940 Bacteria 628
260 Ga0207711_10229694 3300025941 Bacteria 1699
261 Ga0207711_11167802 3300025941 Bacteria 711
262 Ga0207689_10002806 3300025942 Bacteria 16095
263 Ga0207689_10022817 3300025942 Bacteria 5257
264 Ga0207689_10871423 3300025942 Bacteria 760
265 Ga0207661_11453807 3300025944 Bacteria 629
266 Ga0207679_10143027 3300025945 Bacteria 1936
267 Ga0207679_11395070 3300025945 Bacteria 643
268 Ga0207651_10919011 3300025960 Bacteria 780
269 Ga0207651_11567362 3300025960 Bacteria 593
270 Ga0207712_10444186 3300025961 Bacteria 1099
271 Ga0207712_11989349 3300025961 Unclassified 520
272 Ga0207668_10134726 3300025972 Bacteria 1891
273 Ga0207640_10362779 3300025981 Bacteria 1168
274 Ga0207658_10575014 3300025986 Bacteria 1010
275 Ga0207677_10120283 3300026023 Bacteria 1974
276 Ga0207677_11395596 3300026023 Bacteria 645
277 Ga0207703_10140223 3300026035 Unclassified 2097
278 Ga0207703_10386899 3300026035 Bacteria 1295
279 Ga0207703_10577649 3300026035 Bacteria 1062
280 Ga0207708_10018326 3300026075 Bacteria 5272
281 Ga0207708_11147446 3300026075 Bacteria 678
282 Ga0207641_10143864 3300026088 Unclassified 2154
283 Ga0207641_11342098 3300026088 Bacteria 716
284 Ga0207641_11548768 3300026088 Bacteria 665
285 Ga0207648_10033310 3300026089 Bacteria 4545
286 Ga0207648_10281588 3300026089 Unclassified 1487
287 Ga0207648_10600128 3300026089 Bacteria 1015
288 Ga0207676_10023208 3300026095 Bacteria 4573
289 Ga0207676_10652568 3300026095 Bacteria 1016
290 Ga0207674_10278575 3300026116 Bacteria 1620
291 Ga0207675_100059731 3300026118 Bacteria 3558
292 Ga0207675_101150076 3300026118 Bacteria 796
293 Ga0207683_10034872 3300026121 Bacteria 4376
294 Ga0207683_10075628 3300026121 Bacteria 2981
295 Ga0207683_10208043 3300026121 Bacteria 1780
296 Ga0207698_10002020 3300026142 Bacteria 11972
297 Ga0207698_11143971 3300026142 Bacteria 792
298 Ga0207698_12550896 3300026142 Bacteria 521
299 Ga0209371_1000235 3300027312 Bacteria 69492
300 Ga0207428_10125573 3300027907 Bacteria 1965
301 Ga0268266_10002770 3300028379 Bacteria 18315
302 Ga0268266_10302602 3300028379 Bacteria 1492
303 Ga0268265_10171080 3300028380 Bacteria 1857
304 Ga0268265_10408164 3300028380 Bacteria 1258
305 Ga0268264_10547074 3300028381 Bacteria 1135
306 Ga0268264_10756768 3300028381 Bacteria 968
307 Ga0265334_10072901 3300028573 Bacteria 1276
308 Ga0268256_1000196 3300030500 Bacteria 69428
309 Ga0265760_10020955 3300031090 Bacteria 1888
310 Ga0265332_10078422 3300031238 Bacteria 1402
311 Ga0265320_10087029 3300031240 Bacteria 1452
312 Ga0265331_10106009 3300031250 Bacteria 1291
313 Ga0265331_10185062 3300031250 Bacteria 940
314 Ga0307513_10056883 3300031456 Bacteria 4172
315 Ga0307513_10094905 3300031456 Bacteria 3026
316 Ga0307408_100043021 3300031548 Bacteria 3212
317 Ga0307408_102159753 3300031548 Bacteria 538
318 Ga0307508_10616201 3300031616 Unclassified 688
319 Ga0307413_10242983 3300031824 Bacteria 1330
320 Ga0307407_10027913 3300031903 Bacteria 3010
321 Ga0307409_100433279 3300031995 Bacteria 1264
322 Ga0307416_100038365 3300032002 Bacteria 3695
323 Ga0307411_10116924 3300032005 Bacteria 1920
324 Ga0307415_100012888 3300032126 Bacteria 4854
325 Ga0316583_10015352 3300032133 Bacteria 2756
326 Ga0373929_0018753 3300035085 Unclassified 1378
327 Ga0373934_0097455 3300035086 Bacteria 1188
328 Ga0373940_0144746 3300035088 Unclassified 753
329 Ga0373944_0233874 3300035089 Bacteria 674
330 Ga0373923_0678794 3300035111 Bacteria 511
331 Ga0373936_0376962 3300035113 Bacteria 649
332 Ga0373939_0114394 3300035114 Bacteria 944
333 Ga0373953_0107254 3300035117 Bacteria 1179
334 Ga0373954_0112614 3300035118 Bacteria 1317
335 Ga0373957_0294327 3300035120 Bacteria 688
336 Ga0373957_0313291 3300035120 Bacteria 667
337 Ga0373943_0028572 3300035170 Bacteria 2629
338 Ga0373946_0650681 3300035171 Bacteria 549
339 Ga0373955_0193986 3300035172 Bacteria 1208
340 Ga0373955_0445267 3300035172 Unclassified 789
341 Ga0373927_0072579 3300035695 Bacteria 2228
342 Ga0373933_0104595 3300035724 Bacteria 1760
343 Ga0373937_0022201 3300036401 Bacteria 5703
344 Ga0373937_0087289 3300036401 Bacteria 2887
345 Ga0373937_0548240 3300036401 Bacteria 1098
346 Ga0373937_0702157 3300036401 Bacteria 958
347 Ga0373925_0108206 3300037068 Bacteria 2145
348 Ga0451795_0779968 3300041456 Bacteria 750
349 Ga0451802_1076870 3300041460 Bacteria 1075
350 Ga0451807_2761694 3300041486 Bacteria 545
351 Ga0451843_0878626 3300041509 Bacteria 675
352 Ga0450896_039961 3300042133 Bacteria 728
353 Ga0451577_1376966 3300042876 Bacteria 626
354 Ga0451576_0139834 3300045051 Unclassified 2525
355 Ga0495617_001438 3300046452 Bacteria 10458
356 Ga0495592_0458152 3300046454 Bacteria 798
357 Ga0495603_0313874 3300046455 Bacteria 900
358 Ga0495603_0902032 3300046455 Unclassified 502
359 Ga0495629_0000008 3300046459 Bacteria 352138
360 Ga0495638_0000007 3300046460 Bacteria 602783
361 Ga0495638_0349486 3300046460 Bacteria 781
362 Ga0495641_0289871 3300046461 Bacteria 737
363 Ga0495650_0000912 3300046471 Bacteria 34832
364 Ga0495580_0003075 3300046472 Bacteria 14293
365 Ga0495580_0022792 3300046472 Bacteria 4603
366 Ga0495580_0040899 3300046472 Bacteria 3309
367 Ga0495580_0043850 3300046472 Bacteria 3182
368 Ga0495582_0011566 3300046473 Bacteria 4862
369 Ga0495639_0014066 3300046475 Bacteria 3461
370 Ga0495664_0080660 3300046477 Bacteria 1950
371 Ga0495594_0034655 3300046499 Bacteria 2747
372 Ga0495606_0009282 3300046507 Bacteria 8347
373 Ga0495610_0001742 3300046512 Bacteria 19057
374 Ga0495610_0014431 3300046512 Bacteria 4639
375 Ga0495610_0358385 3300046512 Unclassified 547
376 Ga0495618_0003758 3300046514 Bacteria 9392
377 Ga0495618_0061641 3300046514 Bacteria 2379
378 Ga0495620_0017760 3300046515 Bacteria 3538
379 Ga0495628_0149176 3300046516 Bacteria 1782
380 Ga0495628_0459542 3300046516 Bacteria 924
381 Ga0495630_0051811 3300046517 Bacteria 3072
382 Ga0495630_0361441 3300046517 Bacteria 1111
383 Ga0495631_0009252 3300046518 Bacteria 4929
384 Ga0495632_0025468 3300046519 Bacteria 3128
385 Ga0495632_0303073 3300046519 Bacteria 708
386 Ga0495643_0000346 3300046522 Bacteria 63025
387 Ga0495648_0009496 3300046524 Bacteria 7523
388 Ga0495648_0020499 3300046524 Bacteria 4608
389 Ga0495666_0072430 3300046526 Bacteria 1636
390 Ga0495665_0204781 3300046531 Bacteria 1022
391 Ga0495640_0040344 3300046533 Bacteria 3269
392 Ga0495640_0147206 3300046533 Bacteria 1514
393 Ga0495586_0000802 3300046535 Bacteria 18042
394 Ga0495586_0015731 3300046535 Bacteria 4024
395 Ga0495587_0497854 3300046536 Bacteria 674
396 Ga0495598_0389375 3300046537 Bacteria 543
397 Ga0495609_0004783 3300046538 Bacteria 7311
398 Ga0495621_0327354 3300046539 Bacteria 639
399 Ga0495622_0356522 3300046557 Bacteria 633
400 Ga0495667_0432197 3300046559 Bacteria 828
401 Ga0495656_0336830 3300046615 Bacteria 780
402 Ga0495668_0000093 3300046616 Bacteria 142565
403 Ga0495634_0032709 3300046642 Bacteria 3575
404 Ga0495611_0000008 3300046648 Bacteria 218134
405 Ga0495625_0144387 3300046660 Bacteria 1603
406 Ga0495635_0859786 3300046663 Unclassified 582
407 Ga0495599_0644613 3300046678 Bacteria 614
408 Ga0495647_0048950 3300046681 Bacteria 1636
409 Ga0495658_0049611 3300046683 Bacteria 2371
410 Ga0495658_0309809 3300046683 Bacteria 999
411 Ga0495649_0014911 3300046694 Bacteria 4441
412 Ga0495581_0265383 3300047315 Bacteria 1004
413 Ga0495581_0635929 3300047315 Bacteria 617
414 Ga0495581_0792324 3300047315 Bacteria 544
415 Ga0495604_0549170 3300047317 Bacteria 745
416 Ga0495674_0138543 3300047319 Bacteria 2046
417 Ga0495674_0145628 3300047319 Bacteria 1989
418 Ga0495672_0000215 3300047320 Bacteria 82448
419 Ga0495676_0117618 3300047321 Bacteria 1939
420 Ga0495680_0023526 3300047322 Bacteria 5121
421 Ga0495680_0466461 3300047322 Bacteria 862
422 Ga0495683_0191937 3300047323 Bacteria 926
423 Ga0495677_0143527 3300047445 Bacteria 917
424 Ga0495673_0000030 3300047469 Bacteria 468915
425 Ga0495684_0085434 3300047471 Bacteria 2393
426 Ga0495684_0121470 3300047471 Bacteria 1967
427 Ga0495684_0147632 3300047471 Unclassified 1760
428 Ga0495686_0000077 3300047472 Bacteria 205924
429 Ga0495686_0001944 3300047472 Bacteria 20572
430 Ga0495602_0423636 3300048088 Bacteria 945
431 Ga0495602_0712976 3300048088 Bacteria 680
432 Ga0496102_0318597 3300048905 Bacteria 1465
433 Ga0496104_0079377 3300048907 Bacteria 3128
434 Ga0496104_0207477 3300048907 Bacteria 1871
435 Ga0496107_0313961 3300048910 Bacteria 1167
436 Ga0496110_0318364 3300048913 Bacteria 1417
437 Ga0496111_0090559 3300048914 Bacteria 2241
438 Ga0496118_0022321 3300048921 Bacteria 5539
439 Ga0496120_0000015 3300048923 Bacteria 310795
440 Ga0496121_0043517 3300048924 Bacteria 3888
441 Ga0496123_0497240 3300048926 Bacteria 533
442 Ga0496126_0006217 3300048929 Bacteria 13357
443 Ga0495678_000645 3300049459 Bacteria 32069
444 Ga0495678_175128 3300049459 Bacteria 676
445 Ga0501031_0205231 3300049568 Bacteria 1285
446 Ga0501031_0794755 3300049568 Bacteria 607
447 Ga0501036_0004752 3300049572 Bacteria 10966
448 Ga0501037_0037340 3300049573 Bacteria 3581
449 Ga0501038_0002784 3300049574 Bacteria 16268
450 Ga0501039_0054599 3300049575 Bacteria 3092
451 Ga0501040_0005087 3300049576 Bacteria 8500
452 Ga0501041_0003565 3300049577 Bacteria 8957
453 Ga0501042_0005091 3300049578 Bacteria 8433
454 Ga0501042_0088796 3300049578 Bacteria 2218
455 Ga0501043_0051201 3300049579 Bacteria 3245
456 Ga0501046_0072302 3300049580 Bacteria 2678
457 Ga0501048_0019632 3300049582 Bacteria 4957
458 Ga0501070_0433649 3300049586 Bacteria 1061
459 Ga0501071_0072836 3300049587 Bacteria 2505
460 Ga0501071_0560980 3300049587 Bacteria 877
461 Ga0501072_0020219 3300049588 Bacteria 5156
462 Ga0501073_0190000 3300049589 Bacteria 1421
463 Ga0501074_0041690 3300049590 Bacteria 3323
464 Ga0501075_0002432 3300049591 Bacteria 12396
465 Ga0501075_1477883 3300049591 Bacteria 514
466 Ga0501076_0005418 3300049592 Bacteria 9173
467 Ga0501077_0022657 3300049593 Bacteria 3980
468 Ga0501243_040130 3300049675 Bacteria 821
469 Ga0501221_130047 3300049704 Bacteria 651
470 Ga0501080_0012374 3300049742 Bacteria 7821
471 Ga0501081_0006637 3300049743 Bacteria 7523
472 Ga0501081_0135205 3300049743 Bacteria 1764
473 Ga0501083_0036988 3300049744 Bacteria 3327
474 Ga0501272_027864 3300049769 Bacteria 706
475 Ga0501035_0022819 3300049822 Bacteria 5747
476 Ga0501044_0666409 3300049823 Bacteria 928
477 Ga0501045_0003227 3300049824 Bacteria 11142
478 Ga0501045_0232060 3300049824 Bacteria 1374
479 Ga0501045_1230633 3300049824 Bacteria 546
480 nmdc:mga05p37_19044_c2 3300050507 Bacteria 5185
481 nmdc:mga05p37_220747_c1 3300050507 Bacteria 2287
482 nmdc:mga05p37_75960_c1 3300050507 Unclassified 4136
483 nmdc:mga09592_125595_c1 3300050508 Bacteria 2205
484 nmdc:mga09592_71206_c1 3300050508 Bacteria 2951
485 nmdc:mga09592_89786_c1 3300050508 Bacteria 2625
486 nmdc:mga0qj67_1575905_c1 3300050509 Bacteria 504
487 nmdc:mga0qj67_232211_c1 3300050509 Bacteria 1497
488 nmdc:mga0qj67_38053_c1 3300050509 Bacteria 3773
489 nmdc:mga06r32_17679_c1 3300050510 Bacteria 6513
490 nmdc:mga06r32_5368_c1 3300050510 Bacteria 11529
491 nmdc:mga06r32_722469_c1 3300050510 Bacteria 961
492 nmdc:mga06r32_9997_c1 3300050510 Bacteria 8560
493 nmdc:mga08y16_1224728_c1 3300050511 Unclassified 720
494 nmdc:mga08y16_458222_c1 3300050511 Bacteria 1300
495 nmdc:mga08y16_532746_c1 3300050511 Bacteria 1190
496 nmdc:mga08y16_733578_c1 3300050511 Bacteria 985
497 nmdc:mga0n895_339457_c1 3300050512 Bacteria 1522
498 nmdc:mga0n895_412980_c1 3300050512 Unclassified 1365
499 nmdc:mga0a205_50749_c1 3300050515 Bacteria 4005
500 nmdc:mga0a205_6975_c1 3300050515 Bacteria 10216
501 Ga0495595_0160614 3300053084 Bacteria 1109
502 Ga0495595_0369745 3300053084 Bacteria 725
503 Ga0495619_0539439 3300053085 Bacteria 801
504 Ga0500583_0168721 3300053092 Bacteria 1090
505 Ga0500566_0109284 3300053094 Bacteria 1505
506 Ga0500622_0014599 3300053156 Bacteria 4214
507 Ga0500633_0000581 3300053160 Bacteria 5993
508 Ga0501084_0002853 3300054114 Bacteria 13968
509 Ga0501082_0034399 3300060353 Bacteria 4369
510 Ga0501082_0530113 3300060353 Bacteria 1030
511 Ga0530510_0006773 3300061734 Bacteria 7983

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2818991457 2819661812 124
2 iso_pu_bacteria 2852684882 2852688465 124
3 iso_pu_bacteria 2919130084 2919133891 124
4 iso_pu_bacteria 2929195423 2929199818 124
5 iso_pu_bacteria 2831864461 2831868246 125
6 3300005434 Ga0070709_11301665 Ga0070709_113016652 126
7 3300005262 Ga0065165_1000562 Ga0065165_100056243 127
8 3300005548 Ga0070665_102097869 Ga0070665_1020978692 127
9 3300003856 Ga0058692_1000081 Ga0058692_100008127 128
10 3300005289 Ga0065704_10757879 Ga0065704_107578792 128
11 3300005293 Ga0065715_10313755 Ga0065715_103137552 128
12 3300005295 Ga0065707_10133447 Ga0065707_101334472 128
13 3300005327 Ga0070658_10892076 Ga0070658_108920761 128
14 3300005328 Ga0070676_10335604 Ga0070676_103356042 128
15 3300005330 Ga0070690_100134313 Ga0070690_1001343133 128
16 3300005331 Ga0070670_100240931 Ga0070670_1002409312 128
17 3300005334 Ga0068869_100466786 Ga0068869_1004667862 128
18 3300005336 Ga0070680_100365754 Ga0070680_1003657542 128
19 3300005339 Ga0070660_101046358 Ga0070660_1010463581 128
20 3300005339 Ga0070660_101820069 Ga0070660_1018200691 128
21 3300005340 Ga0070689_100140090 Ga0070689_1001400904 128
22 3300005353 Ga0070669_100170862 Ga0070669_1001708622 128
23 3300005353 Ga0070669_100277999 Ga0070669_1002779992 128
24 3300005354 Ga0070675_100026726 Ga0070675_1000267263 128
25 3300005354 Ga0070675_100038788 Ga0070675_1000387882 128
26 3300005354 Ga0070675_101283779 Ga0070675_1012837792 128
27 3300005356 Ga0070674_100182083 Ga0070674_1001820833 128
28 3300005356 Ga0070674_100505873 Ga0070674_1005058732 128
29 3300005356 Ga0070674_100858276 Ga0070674_1008582761 128
30 3300005364 Ga0070673_100342165 Ga0070673_1003421651 128
31 3300005435 Ga0070714_102149359 Ga0070714_1021493591 128
32 3300005438 Ga0070701_10138618 Ga0070701_101386182 128
33 3300005440 Ga0070705_100000718 Ga0070705_10000071811 128
34 3300005440 Ga0070705_100043989 Ga0070705_1000439892 128
35 3300005440 Ga0070705_101238812 Ga0070705_1012388121 128
36 3300005441 Ga0070700_100115975 Ga0070700_1001159751 128
37 3300005441 Ga0070700_101126551 Ga0070700_1011265512 128
38 3300005444 Ga0070694_101312126 Ga0070694_1013121261 128
39 3300005445 Ga0070708_100000078 Ga0070708_10000007836 128
40 3300005445 Ga0070708_100023206 Ga0070708_1000232066 128
41 3300005445 Ga0070708_100324913 Ga0070708_1003249133 128
42 3300005445 Ga0070708_100636030 Ga0070708_1006360302 128
43 3300005445 Ga0070708_100863998 Ga0070708_1008639982 128
44 3300005456 Ga0070678_100026865 Ga0070678_1000268653 128
45 3300005456 Ga0070678_100034945 Ga0070678_1000349454 128
46 3300005456 Ga0070678_100503071 Ga0070678_1005030711 128
47 3300005456 Ga0070678_102060593 Ga0070678_1020605931 128
48 3300005458 Ga0070681_10010815 Ga0070681_1001081513 128
49 3300005459 Ga0068867_100094406 Ga0068867_1000944064 128
50 3300005459 Ga0068867_100236755 Ga0068867_1002367552 128
51 3300005459 Ga0068867_100553859 Ga0068867_1005538591 128
52 3300005459 Ga0068867_100725189 Ga0068867_1007251892 128
53 3300005459 Ga0068867_101300241 Ga0068867_1013002411 128
54 3300005466 Ga0070685_10035100 Ga0070685_100351003 128
55 3300005466 Ga0070685_10041751 Ga0070685_100417514 128
56 3300005466 Ga0070685_11181247 Ga0070685_111812471 128
57 3300005467 Ga0070706_100042015 Ga0070706_1000420156 128
58 3300005468 Ga0070707_100033592 Ga0070707_1000335922 128
59 3300005468 Ga0070707_100416603 Ga0070707_1004166031 128
60 3300005468 Ga0070707_100533546 Ga0070707_1005335462 128
61 3300005471 Ga0070698_100018518 Ga0070698_1000185184 128
62 3300005471 Ga0070698_100071572 Ga0070698_1000715722 128
63 3300005518 Ga0070699_100040647 Ga0070699_1000406471 128
64 3300005518 Ga0070699_100091588 Ga0070699_1000915882 128
65 3300005518 Ga0070699_100178852 Ga0070699_1001788522 128
66 3300005518 Ga0070699_100766762 Ga0070699_1007667622 128
67 3300005535 Ga0070684_100154559 Ga0070684_1001545592 128
68 3300005536 Ga0070697_100192285 Ga0070697_1001922854 128
69 3300005539 Ga0068853_100713367 Ga0068853_1007133672 128
70 3300005539 Ga0068853_100765646 Ga0068853_1007656461 128
71 3300005543 Ga0070672_100060846 Ga0070672_1000608462 128
72 3300005543 Ga0070672_100094859 Ga0070672_1000948591 128
73 3300005544 Ga0070686_100008690 Ga0070686_1000086903 128
74 3300005544 Ga0070686_101400481 Ga0070686_1014004811 128
75 3300005545 Ga0070695_100059282 Ga0070695_1000592822 128
76 3300005545 Ga0070695_100127274 Ga0070695_1001272742 128
77 3300005545 Ga0070695_100207432 Ga0070695_1002074322 128
78 3300005545 Ga0070695_100845600 Ga0070695_1008456002 128
79 3300005546 Ga0070696_100010988 Ga0070696_1000109882 128
80 3300005546 Ga0070696_100652021 Ga0070696_1006520212 128
81 3300005548 Ga0070665_100000499 Ga0070665_10000049927 128
82 3300005548 Ga0070665_100366702 Ga0070665_1003667022 128
83 3300005548 Ga0070665_100559933 Ga0070665_1005599331 128
84 3300005549 Ga0070704_100399258 Ga0070704_1003992582 128
85 3300005549 Ga0070704_100575617 Ga0070704_1005756172 128
86 3300005549 Ga0070704_100717826 Ga0070704_1007178261 128
87 3300005549 Ga0070704_100825521 Ga0070704_1008255212 128
88 3300005563 Ga0068855_101124685 Ga0068855_1011246852 128
89 3300005564 Ga0070664_100121327 Ga0070664_1001213274 128
90 3300005577 Ga0068857_100537621 Ga0068857_1005376212 128
91 3300005578 Ga0068854_100817233 Ga0068854_1008172331 128
92 3300005614 Ga0068856_100179369 Ga0068856_1001793693 128
93 3300005614 Ga0068856_101589282 Ga0068856_1015892821 128
94 3300005615 Ga0070702_100168942 Ga0070702_1001689422 128
95 3300005615 Ga0070702_100897048 Ga0070702_1008970481 128
96 3300005616 Ga0068852_100701542 Ga0068852_1007015422 128
97 3300005617 Ga0068859_100052428 Ga0068859_1000524285 128
98 3300005617 Ga0068859_100672800 Ga0068859_1006728002 128
99 3300005617 Ga0068859_100882011 Ga0068859_1008820111 128
100 3300005618 Ga0068864_101275252 Ga0068864_1012752521 128
101 3300005618 Ga0068864_101436148 Ga0068864_1014361482 128
102 3300005718 Ga0068866_10055557 Ga0068866_100555572 128
103 3300005718 Ga0068866_10278197 Ga0068866_102781973 128
104 3300005719 Ga0068861_101678787 Ga0068861_1016787871 128
105 3300005840 Ga0068870_10034054 Ga0068870_100340546 128
106 3300005841 Ga0068863_100058667 Ga0068863_1000586674 128
107 3300005841 Ga0068863_100231723 Ga0068863_1002317232 128
108 3300005841 Ga0068863_101264317 Ga0068863_1012643172 128
109 3300005841 Ga0068863_102107509 Ga0068863_1021075092 128
110 3300005842 Ga0068858_100301503 Ga0068858_1003015031 128
111 3300005843 Ga0068860_100002637 Ga0068860_1000026372 128
112 3300005843 Ga0068860_100064311 Ga0068860_1000643117 128
113 3300005844 Ga0068862_100253578 Ga0068862_1002535783 128
114 3300005844 Ga0068862_101823050 Ga0068862_1018230502 128
115 3300006028 Ga0070717_10952275 Ga0070717_109522752 128
116 3300006173 Ga0070716_100666559 Ga0070716_1006665592 128
117 3300006175 Ga0070712_100647586 Ga0070712_1006475861 128
118 3300006237 Ga0097621_100015090 Ga0097621_1000150909 128
119 3300006237 Ga0097621_100089420 Ga0097621_1000894205 128
120 3300006237 Ga0097621_100255859 Ga0097621_1002558593 128
121 3300006358 Ga0068871_100014244 Ga0068871_1000142449 128
122 3300006358 Ga0068871_100090445 Ga0068871_1000904452 128
123 3300006358 Ga0068871_100224958 Ga0068871_1002249581 128
124 3300006844 Ga0075428_100098862 Ga0075428_1000988626 128
125 3300006846 Ga0075430_100033032 Ga0075430_1000330325 128
126 3300006847 Ga0075431_100003665 Ga0075431_1000036652 128
127 3300006847 Ga0075431_100004025 Ga0075431_1000040259 128
128 3300006847 Ga0075431_100018322 Ga0075431_1000183226 128
129 3300006852 Ga0075433_10085628 Ga0075433_100856282 128
130 3300006852 Ga0075433_10158271 Ga0075433_101582712 128
131 3300006871 Ga0075434_100084878 Ga0075434_1000848786 128
132 3300006871 Ga0075434_100286982 Ga0075434_1002869822 128
133 3300006880 Ga0075429_100095842 Ga0075429_1000958423 128
134 3300006880 Ga0075429_100142895 Ga0075429_1001428954 128
135 3300006880 Ga0075429_101719823 Ga0075429_1017198231 128
136 3300006881 Ga0068865_100092024 Ga0068865_1000920243 128
137 3300006881 Ga0068865_100140056 Ga0068865_1001400563 128
138 3300006881 Ga0068865_100588818 Ga0068865_1005888182 128
139 3300006914 Ga0075436_100077371 Ga0075436_1000773712 128
140 3300006931 Ga0097620_100052428 Ga0097620_1000524285 128
141 3300006931 Ga0097620_100672803 Ga0097620_1006728032 128
142 3300006931 Ga0097620_100881931 Ga0097620_1008819312 128
143 3300007076 Ga0075435_100487008 Ga0075435_1004870082 128
144 3300009093 Ga0105240_10472276 Ga0105240_104722762 128
145 3300009094 Ga0111539_10129073 Ga0111539_101290731 128
146 3300009094 Ga0111539_10200742 Ga0111539_102007424 128
147 3300009094 Ga0111539_11016618 Ga0111539_110166181 128
148 3300009094 Ga0111539_11201424 Ga0111539_112014242 128
149 3300009094 Ga0111539_11677189 Ga0111539_116771892 128
150 3300009094 Ga0111539_12648813 Ga0111539_126488132 128
151 3300009098 Ga0105245_11596906 Ga0105245_115969062 128
152 3300009101 Ga0105247_10113466 Ga0105247_101134662 128
153 3300009147 Ga0114129_10062076 Ga0114129_100620762 128
154 3300009147 Ga0114129_10141807 Ga0114129_101418073 128
155 3300009147 Ga0114129_10874785 Ga0114129_108747853 128
156 3300009147 Ga0114129_11445981 Ga0114129_114459812 128
157 3300009148 Ga0105243_10000250 Ga0105243_1000025022 128
158 3300009148 Ga0105243_10078161 Ga0105243_100781612 128
159 3300009148 Ga0105243_10193467 Ga0105243_101934673 128
160 3300009148 Ga0105243_11519105 Ga0105243_115191052 128
161 3300009148 Ga0105243_12559050 Ga0105243_125590501 128
162 3300009174 Ga0105241_12170488 Ga0105241_121704882 128
163 3300009176 Ga0105242_10034795 Ga0105242_100347956 128
164 3300009177 Ga0105248_11281977 Ga0105248_112819772 128
165 3300009545 Ga0105237_10376777 Ga0105237_103767771 128
166 3300009551 Ga0105238_10564414 Ga0105238_105644141 128
167 3300009551 Ga0105238_11246246 Ga0105238_112462461 128
168 3300009553 Ga0105249_11786181 Ga0105249_117861811 128
169 3300009553 Ga0105249_12064831 Ga0105249_120648312 128
170 3300010159 Ga0099796_10484406 Ga0099796_104844061 128
171 3300010375 Ga0105239_10052137 Ga0105239_100521378 128
172 3300010375 Ga0105239_10799974 Ga0105239_107999742 128
173 3300011119 Ga0105246_11046552 Ga0105246_110465521 128
174 3300013104 Ga0157370_10430119 Ga0157370_104301192 128
175 3300013105 Ga0157369_11023043 Ga0157369_110230432 128
176 3300013296 Ga0157374_10057349 Ga0157374_100573491 128
177 3300013297 Ga0157378_10077730 Ga0157378_100777304 128
178 3300013297 Ga0157378_10343666 Ga0157378_103436662 128
179 3300013297 Ga0157378_11359060 Ga0157378_113590601 128
180 3300013297 Ga0157378_12196052 Ga0157378_121960521 128
181 3300013306 Ga0163162_10431032 Ga0163162_104310322 128
182 3300013306 Ga0163162_11372356 Ga0163162_113723562 128
183 3300013306 Ga0163162_12419590 Ga0163162_124195901 128
184 3300013308 Ga0157375_10177865 Ga0157375_101778653 128
185 3300013308 Ga0157375_10495530 Ga0157375_104955302 128
186 3300013308 Ga0157375_10971522 Ga0157375_109715222 128
187 3300013308 Ga0157375_12439133 Ga0157375_124391331 128
188 3300014325 Ga0163163_10030013 Ga0163163_100300133 128
189 3300014325 Ga0163163_10094087 Ga0163163_100940873 128
190 3300014325 Ga0163163_10101311 Ga0163163_101013114 128
191 3300014326 Ga0157380_10076579 Ga0157380_100765792 128
192 3300014326 Ga0157380_10397704 Ga0157380_103977042 128
193 3300014326 Ga0157380_11379906 Ga0157380_113799061 128
194 3300014968 Ga0157379_10014279 Ga0157379_100142794 128
195 3300014968 Ga0157379_10306373 Ga0157379_103063731 128
196 3300014969 Ga0157376_10002050 Ga0157376_1000205017 128
197 3300014969 Ga0157376_10040411 Ga0157376_100404114 128
198 3300014969 Ga0157376_10508596 Ga0157376_105085961 128
199 3300014969 Ga0157376_10548487 Ga0157376_105484873 128
200 3300014969 Ga0157376_12132332 Ga0157376_121323321 128
201 3300014969 Ga0157376_12571743 Ga0157376_125717431 128
202 3300015265 Ga0182005_1000690 Ga0182005_10006908 128
203 3300025315 Ga0207697_10063028 Ga0207697_100630282 128
204 3300025315 Ga0207697_10455741 Ga0207697_104557412 128
205 3300025321 Ga0207656_10005521 Ga0207656_100055217 128
206 3300025885 Ga0207653_10000070 Ga0207653_1000007069 128
207 3300025900 Ga0207710_10022834 Ga0207710_100228344 128
208 3300025900 Ga0207710_10051836 Ga0207710_100518363 128
209 3300025901 Ga0207688_10192874 Ga0207688_101928742 128
210 3300025903 Ga0207680_10916142 Ga0207680_109161421 128
211 3300025906 Ga0207699_11109372 Ga0207699_111093721 128
212 3300025907 Ga0207645_10489306 Ga0207645_104893061 128
213 3300025907 Ga0207645_10553389 Ga0207645_105533891 128
214 3300025908 Ga0207643_10031742 Ga0207643_100317422 128
215 3300025910 Ga0207684_10000102 Ga0207684_10000102116 128
216 3300025910 Ga0207684_10037157 Ga0207684_100371573 128
217 3300025910 Ga0207684_10037711 Ga0207684_100377113 128
218 3300025911 Ga0207654_11304248 Ga0207654_113042481 128
219 3300025912 Ga0207707_10008117 Ga0207707_1000811712 128
220 3300025913 Ga0207695_10110949 Ga0207695_101109492 128
221 3300025913 Ga0207695_10407322 Ga0207695_104073221 128
222 3300025915 Ga0207693_10012040 Ga0207693_100120406 128
223 3300025915 Ga0207693_10055658 Ga0207693_100556581 128
224 3300025915 Ga0207693_10553794 Ga0207693_105537941 128
225 3300025916 Ga0207663_10998413 Ga0207663_109984131 128
226 3300025917 Ga0207660_10343104 Ga0207660_103431042 128
227 3300025918 Ga0207662_10203903 Ga0207662_102039032 128
228 3300025918 Ga0207662_10407683 Ga0207662_104076831 128
229 3300025918 Ga0207662_11217346 Ga0207662_112173461 128
230 3300025921 Ga0207652_11129162 Ga0207652_111291621 128
231 3300025922 Ga0207646_10263972 Ga0207646_102639722 128
232 3300025922 Ga0207646_10404835 Ga0207646_104048352 128
233 3300025922 Ga0207646_10944643 Ga0207646_109446432 128
234 3300025924 Ga0207694_10387287 Ga0207694_103872872 128
235 3300025925 Ga0207650_10004372 Ga0207650_1000437211 128
236 3300025925 Ga0207650_10867204 Ga0207650_108672042 128
237 3300025926 Ga0207659_10147378 Ga0207659_101473782 128
238 3300025926 Ga0207659_10426668 Ga0207659_104266683 128
239 3300025927 Ga0207687_10474521 Ga0207687_104745212 128
240 3300025927 Ga0207687_11196214 Ga0207687_111962141 128
241 3300025929 Ga0207664_10454521 Ga0207664_104545212 128
242 3300025929 Ga0207664_10458772 Ga0207664_104587722 128
243 3300025933 Ga0207706_10158868 Ga0207706_101588683 128
244 3300025933 Ga0207706_10165553 Ga0207706_101655535 128
245 3300025934 Ga0207686_10053140 Ga0207686_100531405 128
246 3300025934 Ga0207686_10313366 Ga0207686_103133662 128
247 3300025934 Ga0207686_10548191 Ga0207686_105481911 128
248 3300025935 Ga0207709_10000384 Ga0207709_100003847 128
249 3300025935 Ga0207709_10229821 Ga0207709_102298212 128
250 3300025936 Ga0207670_10080414 Ga0207670_100804142 128
251 3300025936 Ga0207670_10146068 Ga0207670_101460683 128
252 3300025937 Ga0207669_10036771 Ga0207669_100367712 128
253 3300025937 Ga0207669_10438499 Ga0207669_104384993 128
254 3300025938 Ga0207704_10061725 Ga0207704_100617256 128
255 3300025939 Ga0207665_10031582 Ga0207665_100315826 128
256 3300025940 Ga0207691_10068187 Ga0207691_100681873 128
257 3300025940 Ga0207691_10115797 Ga0207691_101157972 128
258 3300025940 Ga0207691_10277660 Ga0207691_102776602 128
259 3300025940 Ga0207691_11203300 Ga0207691_112033002 128
260 3300025941 Ga0207711_10229694 Ga0207711_102296942 128
261 3300025941 Ga0207711_11167802 Ga0207711_111678022 128
262 3300025942 Ga0207689_10002806 Ga0207689_1000280614 128
263 3300025942 Ga0207689_10022817 Ga0207689_100228171 128
264 3300025942 Ga0207689_10871423 Ga0207689_108714232 128
265 3300025944 Ga0207661_11453807 Ga0207661_114538071 128
266 3300025945 Ga0207679_10143027 Ga0207679_101430271 128
267 3300025945 Ga0207679_11395070 Ga0207679_113950701 128
268 3300025960 Ga0207651_10919011 Ga0207651_109190112 128
269 3300025960 Ga0207651_11567362 Ga0207651_115673621 128
270 3300025961 Ga0207712_10444186 Ga0207712_104441863 128
271 3300025961 Ga0207712_11989349 Ga0207712_119893491 128
272 3300025972 Ga0207668_10134726 Ga0207668_101347263 128
273 3300025981 Ga0207640_10362779 Ga0207640_103627793 128
274 3300025986 Ga0207658_10575014 Ga0207658_105750141 128
275 3300026023 Ga0207677_10120283 Ga0207677_101202832 128
276 3300026023 Ga0207677_11395596 Ga0207677_113955961 128
277 3300026035 Ga0207703_10140223 Ga0207703_101402232 128
278 3300026035 Ga0207703_10386899 Ga0207703_103868992 128
279 3300026035 Ga0207703_10577649 Ga0207703_105776491 128
280 3300026075 Ga0207708_10018326 Ga0207708_100183264 128
281 3300026075 Ga0207708_11147446 Ga0207708_111474462 128
282 3300026088 Ga0207641_10143864 Ga0207641_101438642 128
283 3300026088 Ga0207641_11342098 Ga0207641_113420982 128
284 3300026088 Ga0207641_11548768 Ga0207641_115487681 128
285 3300026089 Ga0207648_10033310 Ga0207648_1003331010 128
286 3300026089 Ga0207648_10281588 Ga0207648_102815883 128
287 3300026089 Ga0207648_10600128 Ga0207648_106001282 128
288 3300026095 Ga0207676_10023208 Ga0207676_100232089 128
289 3300026095 Ga0207676_10652568 Ga0207676_106525682 128
290 3300026116 Ga0207674_10278575 Ga0207674_102785752 128
291 3300026118 Ga0207675_100059731 Ga0207675_1000597317 128
292 3300026118 Ga0207675_101150076 Ga0207675_1011500762 128
293 3300026121 Ga0207683_10034872 Ga0207683_100348726 128
294 3300026121 Ga0207683_10075628 Ga0207683_100756281 128
295 3300026121 Ga0207683_10208043 Ga0207683_102080432 128
296 3300026142 Ga0207698_10002020 Ga0207698_100020201 128
297 3300026142 Ga0207698_11143971 Ga0207698_111439711 128
298 3300026142 Ga0207698_12550896 Ga0207698_125508961 128
299 3300027312 Ga0209371_1000235 Ga0209371_100023527 128
300 3300027907 Ga0207428_10125573 Ga0207428_101255733 128
301 3300028379 Ga0268266_10002770 Ga0268266_100027703 128
302 3300028379 Ga0268266_10302602 Ga0268266_103026022 128
303 3300028380 Ga0268265_10171080 Ga0268265_101710802 128
304 3300028380 Ga0268265_10408164 Ga0268265_104081642 128
305 3300028381 Ga0268264_10547074 Ga0268264_105470742 128
306 3300028381 Ga0268264_10756768 Ga0268264_107567681 128
307 3300028573 Ga0265334_10072901 Ga0265334_100729013 128
308 3300030500 Ga0268256_1000196 Ga0268256_100019636 128
309 3300031090 Ga0265760_10020955 Ga0265760_100209552 128
310 3300031238 Ga0265332_10078422 Ga0265332_100784222 128
311 3300031240 Ga0265320_10087029 Ga0265320_100870291 128
312 3300031250 Ga0265331_10106009 Ga0265331_101060093 128
313 3300031250 Ga0265331_10185062 Ga0265331_101850622 128
314 3300031456 Ga0307513_10056883 Ga0307513_100568835 128
315 3300031456 Ga0307513_10094905 Ga0307513_100949052 128
316 3300031548 Ga0307408_100043021 Ga0307408_1000430216 128
317 3300031548 Ga0307408_102159753 Ga0307408_1021597531 128
318 3300031616 Ga0307508_10616201 Ga0307508_106162011 128
319 3300031824 Ga0307413_10242983 Ga0307413_102429832 128
320 3300031903 Ga0307407_10027913 Ga0307407_100279132 128
321 3300031995 Ga0307409_100433279 Ga0307409_1004332792 128
322 3300032002 Ga0307416_100038365 Ga0307416_1000383652 128
323 3300032005 Ga0307411_10116924 Ga0307411_101169241 128
324 3300032126 Ga0307415_100012888 Ga0307415_1000128887 128
325 3300032133 Ga0316583_10015352 Ga0316583_100153523 128
326 3300035085 Ga0373929_0018753 Ga0373929_0018753_849_1235 128
327 3300035086 Ga0373934_0097455 Ga0373934_0097455_623_1009 128
328 3300035088 Ga0373940_0144746 Ga0373940_0144746_114_500 128
329 3300035089 Ga0373944_0233874 Ga0373944_0233874_232_618 128
330 3300035111 Ga0373923_0678794 Ga0373923_0678794_40_426 128
331 3300035113 Ga0373936_0376962 Ga0373936_0376962_22_408 128
332 3300035114 Ga0373939_0114394 Ga0373939_0114394_121_507 128
333 3300035117 Ga0373953_0107254 Ga0373953_0107254_330_716 128
334 3300035118 Ga0373954_0112614 Ga0373954_0112614_113_499 128
335 3300035120 Ga0373957_0294327 Ga0373957_0294327_52_438 128
336 3300035120 Ga0373957_0313291 Ga0373957_0313291_166_552 128
337 3300035170 Ga0373943_0028572 Ga0373943_0028572_1457_1843 128
338 3300035171 Ga0373946_0650681 Ga0373946_0650681_113_499 128
339 3300035172 Ga0373955_0193986 Ga0373955_0193986_449_835 128
340 3300035172 Ga0373955_0445267 Ga0373955_0445267_359_745 128
341 3300035695 Ga0373927_0072579 Ga0373927_0072579_1407_1793 128
342 3300035724 Ga0373933_0104595 Ga0373933_0104595_813_1199 128
343 3300036401 Ga0373937_0022201 Ga0373937_0022201_3771_4157 128
344 3300036401 Ga0373937_0087289 Ga0373937_0087289_1766_2152 128
345 3300036401 Ga0373937_0548240 Ga0373937_0548240_536_922 128
346 3300036401 Ga0373937_0702157 Ga0373937_0702157_130_516 128
347 3300037068 Ga0373925_0108206 Ga0373925_0108206_270_656 128
348 3300041456 Ga0451795_0779968 Ga0451795_0779968_354_740 128
349 3300041460 Ga0451802_1076870 Ga0451802_1076870_402_788 128
350 3300041486 Ga0451807_2761694 Ga0451807_2761694_110_496 128
351 3300041509 Ga0451843_0878626 Ga0451843_0878626_53_439 128
352 3300042133 Ga0450896_039961 Ga0450896_039961_263_649 128
353 3300042876 Ga0451577_1376966 Ga0451577_1376966_133_519 128
354 3300045051 Ga0451576_0139834 Ga0451576_0139834_1703_2089 128
355 3300046452 Ga0495617_001438 Ga0495617_001438_8975_9361 128
356 3300046454 Ga0495592_0458152 Ga0495592_0458152_282_668 128
357 3300046455 Ga0495603_0313874 Ga0495603_0313874_46_432 128
358 3300046455 Ga0495603_0902032 Ga0495603_0902032_54_440 128
359 3300046459 Ga0495629_0000008 Ga0495629_0000008_8090_8476 128
360 3300046460 Ga0495638_0000007 Ga0495638_0000007_309608_309994 128
361 3300046460 Ga0495638_0349486 Ga0495638_0349486_54_440 128
362 3300046461 Ga0495641_0289871 Ga0495641_0289871_188_574 128
363 3300046471 Ga0495650_0000912 Ga0495650_0000912_14693_15079 128
364 3300046472 Ga0495580_0003075 Ga0495580_0003075_13843_14229 128
365 3300046472 Ga0495580_0022792 Ga0495580_0022792_2651_3037 128
366 3300046472 Ga0495580_0040899 Ga0495580_0040899_601_987 128
367 3300046472 Ga0495580_0043850 Ga0495580_0043850_210_596 128
368 3300046473 Ga0495582_0011566 Ga0495582_0011566_1965_2351 128
369 3300046475 Ga0495639_0014066 Ga0495639_0014066_2209_2595 128
370 3300046477 Ga0495664_0080660 Ga0495664_0080660_195_581 128
371 3300046499 Ga0495594_0034655 Ga0495594_0034655_1594_1980 128
372 3300046507 Ga0495606_0009282 Ga0495606_0009282_548_934 128
373 3300046512 Ga0495610_0001742 Ga0495610_0001742_15883_16269 128
374 3300046512 Ga0495610_0014431 Ga0495610_0014431_4092_4478 128
375 3300046512 Ga0495610_0358385 Ga0495610_0358385_13_399 128
376 3300046514 Ga0495618_0003758 Ga0495618_0003758_8549_8935 128
377 3300046514 Ga0495618_0061641 Ga0495618_0061641_766_1152 128
378 3300046515 Ga0495620_0017760 Ga0495620_0017760_3063_3449 128
379 3300046516 Ga0495628_0149176 Ga0495628_0149176_1310_1696 128
380 3300046516 Ga0495628_0459542 Ga0495628_0459542_157_543 128
381 3300046517 Ga0495630_0051811 Ga0495630_0051811_2527_2913 128
382 3300046517 Ga0495630_0361441 Ga0495630_0361441_186_572 128
383 3300046518 Ga0495631_0009252 Ga0495631_0009252_4025_4411 128
384 3300046519 Ga0495632_0025468 Ga0495632_0025468_2001_2387 128
385 3300046519 Ga0495632_0303073 Ga0495632_0303073_25_411 128
386 3300046522 Ga0495643_0000346 Ga0495643_0000346_58012_58398 128
387 3300046524 Ga0495648_0009496 Ga0495648_0009496_86_472 128
388 3300046524 Ga0495648_0020499 Ga0495648_0020499_880_1266 128
389 3300046526 Ga0495666_0072430 Ga0495666_0072430_665_1051 128
390 3300046531 Ga0495665_0204781 Ga0495665_0204781_617_1003 128
391 3300046533 Ga0495640_0040344 Ga0495640_0040344_2280_2666 128
392 3300046533 Ga0495640_0147206 Ga0495640_0147206_919_1305 128
393 3300046535 Ga0495586_0000802 Ga0495586_0000802_10839_11225 128
394 3300046535 Ga0495586_0015731 Ga0495586_0015731_631_1017 128
395 3300046536 Ga0495587_0497854 Ga0495587_0497854_49_435 128
396 3300046537 Ga0495598_0389375 Ga0495598_0389375_88_474 128
397 3300046538 Ga0495609_0004783 Ga0495609_0004783_6553_6939 128
398 3300046539 Ga0495621_0327354 Ga0495621_0327354_177_563 128
399 3300046557 Ga0495622_0356522 Ga0495622_0356522_94_480 128
400 3300046559 Ga0495667_0432197 Ga0495667_0432197_17_403 128
401 3300046615 Ga0495656_0336830 Ga0495656_0336830_33_419 128
402 3300046616 Ga0495668_0000093 Ga0495668_0000093_130747_131133 128
403 3300046642 Ga0495634_0032709 Ga0495634_0032709_2616_3002 128
404 3300046648 Ga0495611_0000008 Ga0495611_0000008_41867_42253 128
405 3300046660 Ga0495625_0144387 Ga0495625_0144387_76_462 128
406 3300046663 Ga0495635_0859786 Ga0495635_0859786_172_558 128
407 3300046678 Ga0495599_0644613 Ga0495599_0644613_118_504 128
408 3300046681 Ga0495647_0048950 Ga0495647_0048950_665_1051 128
409 3300046683 Ga0495658_0049611 Ga0495658_0049611_1507_1893 128
410 3300046683 Ga0495658_0309809 Ga0495658_0309809_514_900 128
411 3300046694 Ga0495649_0014911 Ga0495649_0014911_2163_2549 128
412 3300047315 Ga0495581_0265383 Ga0495581_0265383_287_673 128
413 3300047315 Ga0495581_0635929 Ga0495581_0635929_143_529 128
414 3300047315 Ga0495581_0792324 Ga0495581_0792324_111_497 128
415 3300047317 Ga0495604_0549170 Ga0495604_0549170_244_630 128
416 3300047319 Ga0495674_0138543 Ga0495674_0138543_791_1177 128
417 3300047319 Ga0495674_0145628 Ga0495674_0145628_709_1095 128
418 3300047320 Ga0495672_0000215 Ga0495672_0000215_14080_14466 128
419 3300047321 Ga0495676_0117618 Ga0495676_0117618_72_458 128
420 3300047322 Ga0495680_0023526 Ga0495680_0023526_797_1183 128
421 3300047322 Ga0495680_0466461 Ga0495680_0466461_63_449 128
422 3300047323 Ga0495683_0191937 Ga0495683_0191937_492_878 128
423 3300047445 Ga0495677_0143527 Ga0495677_0143527_299_685 128
424 3300047469 Ga0495673_0000030 Ga0495673_0000030_300741_301127 128
425 3300047471 Ga0495684_0085434 Ga0495684_0085434_1064_1450 128
426 3300047471 Ga0495684_0121470 Ga0495684_0121470_85_471 128
427 3300047471 Ga0495684_0147632 Ga0495684_0147632_976_1362 128
428 3300047472 Ga0495686_0000077 Ga0495686_0000077_198158_198547 128
429 3300047472 Ga0495686_0001944 Ga0495686_0001944_8998_9384 128
430 3300048088 Ga0495602_0423636 Ga0495602_0423636_42_428 128
431 3300048088 Ga0495602_0712976 Ga0495602_0712976_65_451 128
432 3300048905 Ga0496102_0318597 Ga0496102_0318597_1027_1413 128
433 3300048907 Ga0496104_0079377 Ga0496104_0079377_1412_1798 128
434 3300048907 Ga0496104_0207477 Ga0496104_0207477_686_1072 128
435 3300048910 Ga0496107_0313961 Ga0496107_0313961_572_958 128
436 3300048913 Ga0496110_0318364 Ga0496110_0318364_1001_1387 128
437 3300048914 Ga0496111_0090559 Ga0496111_0090559_1816_2202 128
438 3300048921 Ga0496118_0022321 Ga0496118_0022321_3707_4093 128
439 3300048923 Ga0496120_0000015 Ga0496120_0000015_60010_60396 128
440 3300048924 Ga0496121_0043517 Ga0496121_0043517_1983_2369 128
441 3300048929 Ga0496126_0006217 Ga0496126_0006217_7738_8124 128
442 3300049459 Ga0495678_000645 Ga0495678_000645_3299_3685 128
443 3300049459 Ga0495678_175128 Ga0495678_175128_123_509 128
444 3300049568 Ga0501031_0205231 Ga0501031_0205231_70_456 128
445 3300049568 Ga0501031_0794755 Ga0501031_0794755_36_422 128
446 3300049572 Ga0501036_0004752 Ga0501036_0004752_1054_1440 128
447 3300049573 Ga0501037_0037340 Ga0501037_0037340_2613_2999 128
448 3300049574 Ga0501038_0002784 Ga0501038_0002784_4956_5342 128
449 3300049575 Ga0501039_0054599 Ga0501039_0054599_1038_1424 128
450 3300049576 Ga0501040_0005087 Ga0501040_0005087_5880_6266 128
451 3300049577 Ga0501041_0003565 Ga0501041_0003565_6847_7233 128
452 3300049578 Ga0501042_0005091 Ga0501042_0005091_1179_1565 128
453 3300049578 Ga0501042_0088796 Ga0501042_0088796_1347_1733 128
454 3300049579 Ga0501043_0051201 Ga0501043_0051201_835_1221 128
455 3300049580 Ga0501046_0072302 Ga0501046_0072302_1628_2014 128
456 3300049582 Ga0501048_0019632 Ga0501048_0019632_796_1182 128
457 3300049586 Ga0501070_0433649 Ga0501070_0433649_243_629 128
458 3300049587 Ga0501071_0072836 Ga0501071_0072836_1764_2150 128
459 3300049587 Ga0501071_0560980 Ga0501071_0560980_370_756 128
460 3300049588 Ga0501072_0020219 Ga0501072_0020219_377_763 128
461 3300049589 Ga0501073_0190000 Ga0501073_0190000_374_760 128
462 3300049590 Ga0501074_0041690 Ga0501074_0041690_2664_3050 128
463 3300049591 Ga0501075_0002432 Ga0501075_0002432_3883_4269 128
464 3300049591 Ga0501075_1477883 Ga0501075_1477883_68_454 128
465 3300049592 Ga0501076_0005418 Ga0501076_0005418_4749_5135 128
466 3300049593 Ga0501077_0022657 Ga0501077_0022657_756_1142 128
467 3300049675 Ga0501243_040130 Ga0501243_040130_402_788 128
468 3300049704 Ga0501221_130047 Ga0501221_130047_33_419 128
469 3300049742 Ga0501080_0012374 Ga0501080_0012374_707_1093 128
470 3300049743 Ga0501081_0006637 Ga0501081_0006637_899_1285 128
471 3300049743 Ga0501081_0135205 Ga0501081_0135205_157_543 128
472 3300049744 Ga0501083_0036988 Ga0501083_0036988_720_1106 128
473 3300049769 Ga0501272_027864 Ga0501272_027864_28_414 128
474 3300049822 Ga0501035_0022819 Ga0501035_0022819_4066_4452 128
475 3300049823 Ga0501044_0666409 Ga0501044_0666409_427_813 128
476 3300049824 Ga0501045_0003227 Ga0501045_0003227_6417_6803 128
477 3300049824 Ga0501045_0232060 Ga0501045_0232060_794_1180 128
478 3300049824 Ga0501045_1230633 Ga0501045_1230633_99_485 128
479 3300050507 nmdc:mga05p37_19044_c2 nmdc:mga05p37_19044_c2_4176_4562 128
480 3300050507 nmdc:mga05p37_220747_c1 nmdc:mga05p37_220747_c1_357_743 128
481 3300050507 nmdc:mga05p37_75960_c1 nmdc:mga05p37_75960_c1_357_743 128
482 3300050508 nmdc:mga09592_125595_c1 nmdc:mga09592_125595_c1_237_623 128
483 3300050508 nmdc:mga09592_71206_c1 nmdc:mga09592_71206_c1_1407_1793 128
484 3300050508 nmdc:mga09592_89786_c1 nmdc:mga09592_89786_c1_381_767 128
485 3300050509 nmdc:mga0qj67_1575905_c1 nmdc:mga0qj67_1575905_c1_59_445 128
486 3300050509 nmdc:mga0qj67_232211_c1 nmdc:mga0qj67_232211_c1_785_1171 128
487 3300050509 nmdc:mga0qj67_38053_c1 nmdc:mga0qj67_38053_c1_3126_3512 128
488 3300050510 nmdc:mga06r32_17679_c1 nmdc:mga06r32_17679_c1_4963_5349 128
489 3300050510 nmdc:mga06r32_5368_c1 nmdc:mga06r32_5368_c1_1787_2173 128
490 3300050510 nmdc:mga06r32_722469_c1 nmdc:mga06r32_722469_c1_241_627 128
491 3300050510 nmdc:mga06r32_9997_c1 nmdc:mga06r32_9997_c1_2601_2987 128
492 3300050511 nmdc:mga08y16_1224728_c1 nmdc:mga08y16_1224728_c1_255_641 128
493 3300050511 nmdc:mga08y16_458222_c1 nmdc:mga08y16_458222_c1_141_527 128
494 3300050511 nmdc:mga08y16_532746_c1 nmdc:mga08y16_532746_c1_75_461 128
495 3300050511 nmdc:mga08y16_733578_c1 nmdc:mga08y16_733578_c1_561_947 128
496 3300050512 nmdc:mga0n895_339457_c1 nmdc:mga0n895_339457_c1_324_710 128
497 3300050512 nmdc:mga0n895_412980_c1 nmdc:mga0n895_412980_c1_576_962 128
498 3300050515 nmdc:mga0a205_50749_c1 nmdc:mga0a205_50749_c1_2194_2580 128
499 3300050515 nmdc:mga0a205_6975_c1 nmdc:mga0a205_6975_c1_4101_4487 128
500 3300053084 Ga0495595_0160614 Ga0495595_0160614_391_777 128
501 3300053084 Ga0495595_0369745 Ga0495595_0369745_177_563 128
502 3300053085 Ga0495619_0539439 Ga0495619_0539439_294_680 128
503 3300053092 Ga0500583_0168721 Ga0500583_0168721_159_545 128
504 3300053094 Ga0500566_0109284 Ga0500566_0109284_171_557 128
505 3300053160 Ga0500633_0000581 Ga0500633_0000581_94_480 128
506 3300054114 Ga0501084_0002853 Ga0501084_0002853_9470_9856 128
507 3300060353 Ga0501082_0034399 Ga0501082_0034399_3607_3993 128
508 3300060353 Ga0501082_0530113 Ga0501082_0530113_110_496 128
509 3300061734 Ga0530510_0006773 Ga0530510_0006773_948_1334 128
510 3300003771 Ga0055526_1005085 Ga0055526_10050854 129
511 3300003790 Ga0055528_1063016 Ga0055528_10630161 129
512 3300004625 Ga0055543_1004678 Ga0055543_10046781 129
513 3300005262 Ga0065165_1000675 Ga0065165_10006751 129
514 3300025295 Ga0209564_1000005 Ga0209564_100000536 129
515 3300048926 Ga0496123_0497240 Ga0496123_0497240_96_485 129
516 3300053156 Ga0500622_0014599 Ga0500622_0014599_1517_1906 129

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18029

Glyoxalase_6

Glyoxalase-like domain

9

123

0.87

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

6

122

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iuz-assembly1.cif.gz_A crystal structure of putative glyoxalase superfamily protein (yp_299723.1) from ralstonia eutropha jmp134 at 1.90 a resolution 0.8261 75 124
2i5x-assembly1.cif.gz_A engineering the ptpbeta catalytic domain with improved crystallization properties 0.7287 95 125
2i5x-assembly2.cif.gz_B engineering the ptpbeta catalytic domain with improved crystallization properties 0.7258 95 125
1yfo-assembly2.cif.gz_B receptor protein tyrosine phosphatase alpha, domain 1 from mouse 0.7218 95 127
1z47-assembly1.cif.gz_B-2 structure of the atpase subunit cysa of the putative sulfate atp-binding cassette (abc) transporter from alicyclobacillus acidocaldarius 0.7217 95 125
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8946 75 123 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8457 75 126 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8308 75 123 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.817 75 125 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7973 74 126 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A5J4E851-F1-model_v4 VOC domain-containing protein 1.006 77 129
AF-A0A7W8EAH5-F1-model_v4 Putative enzyme related to lactoylglutathione lyase 0.9751 77 129 GO:0016829
AF-A0A7V9PWX8-F1-model_v4 VOC family protein 0.973 75 127
AF-A0A136M9B9-F1-model_v4 Glyoxalase 0.9574 77 125
AF-A0A5J4E851-F1-model_v4 VOC domain-containing protein 0.9516 77 129

Feature Viewer

pLDDT pTM Quality
79.27 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map