F457951
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 516 | 312 | 511 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300003771|Ga0055526_1005085|Ga0055526_10050854 |
| Length | 129 |
| Sequence | MKRVTGIGGIFFNAKEPAALRDWYRTHLGVDVQAWGGAAFSWTDEAGQPTGGSTIWSIGAAEGGDGFGPNKAPFMINYRVADLTALLKALRDEGCNVLEKSDDSEYGKFGWVIDPEGNKVELWEPPAGQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2818991457 | Xanthomonas translucens 569 | Isolate | Unclassified |
| 2 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 3 | 2852684882 | Xanthomonas sp. JAI131 | Isolate | Rhizosphere |
| 4 | 2919130084 | Xanthomonas sp. 1678 | Isolate | Rhizosphere |
| 5 | 2929195423 | Xanthomonas sp. R-73098 Hybrid assembly | Isolate | Unclassified |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 8 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 9 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 79 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 94 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 107 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 166 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 167 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 173 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 180 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 182 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 198 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 201 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 202 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 260 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 261 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 262 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 263 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 264 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 265 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 266 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 289 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 290 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 294 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 307 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 308 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 309 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 310 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 311 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.84 |
| Metatranscriptomes | 0.19 |
| Isolates | 0.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 0.19 |
| Rhizoplane | 1.74 |
| Rhizosphere | 93.99 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.13 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055526_1005085 | 3300003771 | Bacteria | 7677 |
| 2 | Ga0055528_1063016 | 3300003790 | Bacteria | 693 |
| 3 | Ga0058692_1000081 | 3300003856 | Bacteria | 69376 |
| 4 | Ga0055543_1004678 | 3300004625 | Bacteria | 3663 |
| 5 | Ga0065165_1000562 | 3300005262 | Bacteria | 55318 |
| 6 | Ga0065165_1000675 | 3300005262 | Bacteria | 49121 |
| 7 | Ga0065704_10757879 | 3300005289 | Bacteria | 539 |
| 8 | Ga0065715_10313755 | 3300005293 | Bacteria | 1015 |
| 9 | Ga0065707_10133447 | 3300005295 | Unclassified | 1881 |
| 10 | Ga0070658_10892076 | 3300005327 | Bacteria | 773 |
| 11 | Ga0070676_10335604 | 3300005328 | Bacteria | 1035 |
| 12 | Ga0070690_100134313 | 3300005330 | Bacteria | 1674 |
| 13 | Ga0070670_100240931 | 3300005331 | Bacteria | 1574 |
| 14 | Ga0068869_100466786 | 3300005334 | Bacteria | 1049 |
| 15 | Ga0070680_100365754 | 3300005336 | Bacteria | 1227 |
| 16 | Ga0070660_101046358 | 3300005339 | Bacteria | 690 |
| 17 | Ga0070660_101820069 | 3300005339 | Bacteria | 519 |
| 18 | Ga0070689_100140090 | 3300005340 | Bacteria | 1945 |
| 19 | Ga0070669_100170862 | 3300005353 | Bacteria | 1694 |
| 20 | Ga0070669_100277999 | 3300005353 | Bacteria | 1341 |
| 21 | Ga0070675_100026726 | 3300005354 | Bacteria | 4631 |
| 22 | Ga0070675_100038788 | 3300005354 | Bacteria | 3884 |
| 23 | Ga0070675_101283779 | 3300005354 | Bacteria | 674 |
| 24 | Ga0070674_100182083 | 3300005356 | Bacteria | 1610 |
| 25 | Ga0070674_100505873 | 3300005356 | Bacteria | 1007 |
| 26 | Ga0070674_100858276 | 3300005356 | Bacteria | 788 |
| 27 | Ga0070673_100342165 | 3300005364 | Bacteria | 1326 |
| 28 | Ga0070709_11301665 | 3300005434 | Bacteria | 586 |
| 29 | Ga0070714_102149359 | 3300005435 | Bacteria | 544 |
| 30 | Ga0070701_10138618 | 3300005438 | Unclassified | 1389 |
| 31 | Ga0070705_100000718 | 3300005440 | Bacteria | 18884 |
| 32 | Ga0070705_100043989 | 3300005440 | Unclassified | 2563 |
| 33 | Ga0070705_101238812 | 3300005440 | Bacteria | 616 |
| 34 | Ga0070700_100115975 | 3300005441 | Unclassified | 1788 |
| 35 | Ga0070700_101126551 | 3300005441 | Bacteria | 652 |
| 36 | Ga0070694_101312126 | 3300005444 | Bacteria | 609 |
| 37 | Ga0070708_100000078 | 3300005445 | Bacteria | 62606 |
| 38 | Ga0070708_100023206 | 3300005445 | Bacteria | 5272 |
| 39 | Ga0070708_100324913 | 3300005445 | Bacteria | 1449 |
| 40 | Ga0070708_100636030 | 3300005445 | Bacteria | 1005 |
| 41 | Ga0070708_100863998 | 3300005445 | Bacteria | 850 |
| 42 | Ga0070678_100026865 | 3300005456 | Bacteria | 3899 |
| 43 | Ga0070678_100034945 | 3300005456 | Unclassified | 3505 |
| 44 | Ga0070678_100503071 | 3300005456 | Bacteria | 1069 |
| 45 | Ga0070678_102060593 | 3300005456 | Bacteria | 540 |
| 46 | Ga0070681_10010815 | 3300005458 | Bacteria | 9020 |
| 47 | Ga0068867_100094406 | 3300005459 | Bacteria | 2274 |
| 48 | Ga0068867_100236755 | 3300005459 | Bacteria | 1478 |
| 49 | Ga0068867_100553859 | 3300005459 | Bacteria | 996 |
| 50 | Ga0068867_100725189 | 3300005459 | Bacteria | 879 |
| 51 | Ga0068867_101300241 | 3300005459 | Bacteria | 671 |
| 52 | Ga0070685_10035100 | 3300005466 | Unclassified | 2828 |
| 53 | Ga0070685_10041751 | 3300005466 | Bacteria | 2615 |
| 54 | Ga0070685_11181247 | 3300005466 | Bacteria | 581 |
| 55 | Ga0070706_100042015 | 3300005467 | Bacteria | 4222 |
| 56 | Ga0070707_100033592 | 3300005468 | Bacteria | 4891 |
| 57 | Ga0070707_100416603 | 3300005468 | Bacteria | 1304 |
| 58 | Ga0070707_100533546 | 3300005468 | Bacteria | 1136 |
| 59 | Ga0070698_100018518 | 3300005471 | Bacteria | 7332 |
| 60 | Ga0070698_100071572 | 3300005471 | Unclassified | 3477 |
| 61 | Ga0070699_100040647 | 3300005518 | Bacteria | 4026 |
| 62 | Ga0070699_100091588 | 3300005518 | Bacteria | 2658 |
| 63 | Ga0070699_100178852 | 3300005518 | Bacteria | 1882 |
| 64 | Ga0070699_100766762 | 3300005518 | Bacteria | 882 |
| 65 | Ga0070684_100154559 | 3300005535 | Bacteria | 2080 |
| 66 | Ga0070697_100192285 | 3300005536 | Bacteria | 1732 |
| 67 | Ga0068853_100713367 | 3300005539 | Bacteria | 957 |
| 68 | Ga0068853_100765646 | 3300005539 | Unclassified | 923 |
| 69 | Ga0070672_100060846 | 3300005543 | Bacteria | 2975 |
| 70 | Ga0070672_100094859 | 3300005543 | Bacteria | 2412 |
| 71 | Ga0070686_100008690 | 3300005544 | Bacteria | 5691 |
| 72 | Ga0070686_101400481 | 3300005544 | Bacteria | 587 |
| 73 | Ga0070695_100059282 | 3300005545 | Bacteria | 2477 |
| 74 | Ga0070695_100127274 | 3300005545 | Bacteria | 1751 |
| 75 | Ga0070695_100207432 | 3300005545 | Bacteria | 1404 |
| 76 | Ga0070695_100845600 | 3300005545 | Bacteria | 736 |
| 77 | Ga0070696_100010988 | 3300005546 | Bacteria | 6062 |
| 78 | Ga0070696_100652021 | 3300005546 | Unclassified | 853 |
| 79 | Ga0070665_100000499 | 3300005548 | Bacteria | 56184 |
| 80 | Ga0070665_100366702 | 3300005548 | Bacteria | 1447 |
| 81 | Ga0070665_100559933 | 3300005548 | Bacteria | 1155 |
| 82 | Ga0070665_102097869 | 3300005548 | Bacteria | 570 |
| 83 | Ga0070704_100399258 | 3300005549 | Bacteria | 1173 |
| 84 | Ga0070704_100575617 | 3300005549 | Bacteria | 987 |
| 85 | Ga0070704_100717826 | 3300005549 | Unclassified | 888 |
| 86 | Ga0070704_100825521 | 3300005549 | Bacteria | 830 |
| 87 | Ga0068855_101124685 | 3300005563 | Bacteria | 820 |
| 88 | Ga0070664_100121327 | 3300005564 | Bacteria | 2289 |
| 89 | Ga0068857_100537621 | 3300005577 | Bacteria | 1100 |
| 90 | Ga0068854_100817233 | 3300005578 | Bacteria | 814 |
| 91 | Ga0068856_100179369 | 3300005614 | Bacteria | 2131 |
| 92 | Ga0068856_101589282 | 3300005614 | Bacteria | 667 |
| 93 | Ga0070702_100168942 | 3300005615 | Bacteria | 1421 |
| 94 | Ga0070702_100897048 | 3300005615 | Unclassified | 694 |
| 95 | Ga0068852_100701542 | 3300005616 | Bacteria | 1022 |
| 96 | Ga0068859_100052428 | 3300005617 | Bacteria | 4101 |
| 97 | Ga0068859_100672800 | 3300005617 | Bacteria | 1126 |
| 98 | Ga0068859_100882011 | 3300005617 | Bacteria | 980 |
| 99 | Ga0068864_101275252 | 3300005618 | Unclassified | 735 |
| 100 | Ga0068864_101436148 | 3300005618 | Bacteria | 692 |
| 101 | Ga0068866_10055557 | 3300005718 | Unclassified | 2034 |
| 102 | Ga0068866_10278197 | 3300005718 | Bacteria | 1036 |
| 103 | Ga0068861_101678787 | 3300005719 | Bacteria | 628 |
| 104 | Ga0068870_10034054 | 3300005840 | Bacteria | 2604 |
| 105 | Ga0068863_100058667 | 3300005841 | Bacteria | 3642 |
| 106 | Ga0068863_100231723 | 3300005841 | Unclassified | 1781 |
| 107 | Ga0068863_101264317 | 3300005841 | Bacteria | 744 |
| 108 | Ga0068863_102107509 | 3300005841 | Bacteria | 574 |
| 109 | Ga0068858_100301503 | 3300005842 | Bacteria | 1529 |
| 110 | Ga0068860_100002637 | 3300005843 | Bacteria | 18660 |
| 111 | Ga0068860_100064311 | 3300005843 | Bacteria | 3484 |
| 112 | Ga0068862_100253578 | 3300005844 | Bacteria | 1604 |
| 113 | Ga0068862_101823050 | 3300005844 | Bacteria | 618 |
| 114 | Ga0070717_10952275 | 3300006028 | Bacteria | 782 |
| 115 | Ga0070716_100666559 | 3300006173 | Bacteria | 791 |
| 116 | Ga0070712_100647586 | 3300006175 | Bacteria | 897 |
| 117 | Ga0097621_100015090 | 3300006237 | Bacteria | 5801 |
| 118 | Ga0097621_100089420 | 3300006237 | Bacteria | 2575 |
| 119 | Ga0097621_100255859 | 3300006237 | Bacteria | 1535 |
| 120 | Ga0068871_100014244 | 3300006358 | Bacteria | 5922 |
| 121 | Ga0068871_100090445 | 3300006358 | Bacteria | 2549 |
| 122 | Ga0068871_100224958 | 3300006358 | Bacteria | 1627 |
| 123 | Ga0075428_100098862 | 3300006844 | Bacteria | 3181 |
| 124 | Ga0075430_100033032 | 3300006846 | Unclassified | 4392 |
| 125 | Ga0075431_100003665 | 3300006847 | Bacteria | 14905 |
| 126 | Ga0075431_100004025 | 3300006847 | Bacteria | 14322 |
| 127 | Ga0075431_100018322 | 3300006847 | Bacteria | 7127 |
| 128 | Ga0075433_10085628 | 3300006852 | Bacteria | 2782 |
| 129 | Ga0075433_10158271 | 3300006852 | Bacteria | 2015 |
| 130 | Ga0075434_100084878 | 3300006871 | Bacteria | 3165 |
| 131 | Ga0075434_100286982 | 3300006871 | Unclassified | 1666 |
| 132 | Ga0075429_100095842 | 3300006880 | Bacteria | 2588 |
| 133 | Ga0075429_100142895 | 3300006880 | Bacteria | 2095 |
| 134 | Ga0075429_101719823 | 3300006880 | Bacteria | 545 |
| 135 | Ga0068865_100092024 | 3300006881 | Bacteria | 2202 |
| 136 | Ga0068865_100140056 | 3300006881 | Unclassified | 1823 |
| 137 | Ga0068865_100588818 | 3300006881 | Bacteria | 939 |
| 138 | Ga0075436_100077371 | 3300006914 | Bacteria | 2304 |
| 139 | Ga0097620_100052428 | 3300006931 | Bacteria | 4101 |
| 140 | Ga0097620_100672803 | 3300006931 | Bacteria | 1126 |
| 141 | Ga0097620_100881931 | 3300006931 | Bacteria | 980 |
| 142 | Ga0075435_100487008 | 3300007076 | Bacteria | 1066 |
| 143 | Ga0105240_10472276 | 3300009093 | Bacteria | 1399 |
| 144 | Ga0111539_10129073 | 3300009094 | Unclassified | 2961 |
| 145 | Ga0111539_10200742 | 3300009094 | Bacteria | 2325 |
| 146 | Ga0111539_11016618 | 3300009094 | Bacteria | 964 |
| 147 | Ga0111539_11201424 | 3300009094 | Unclassified | 881 |
| 148 | Ga0111539_11677189 | 3300009094 | Bacteria | 737 |
| 149 | Ga0111539_12648813 | 3300009094 | Bacteria | 581 |
| 150 | Ga0105245_11596906 | 3300009098 | Bacteria | 704 |
| 151 | Ga0105247_10113466 | 3300009101 | Bacteria | 1747 |
| 152 | Ga0114129_10062076 | 3300009147 | Bacteria | 5221 |
| 153 | Ga0114129_10141807 | 3300009147 | Bacteria | 3293 |
| 154 | Ga0114129_10874785 | 3300009147 | Bacteria | 1140 |
| 155 | Ga0114129_11445981 | 3300009147 | Bacteria | 847 |
| 156 | Ga0105243_10000250 | 3300009148 | Bacteria | 61801 |
| 157 | Ga0105243_10078161 | 3300009148 | Bacteria | 2693 |
| 158 | Ga0105243_10193467 | 3300009148 | Bacteria | 1778 |
| 159 | Ga0105243_11519105 | 3300009148 | Bacteria | 694 |
| 160 | Ga0105243_12559050 | 3300009148 | Bacteria | 550 |
| 161 | Ga0105241_12170488 | 3300009174 | Bacteria | 550 |
| 162 | Ga0105242_10034795 | 3300009176 | Bacteria | 4039 |
| 163 | Ga0105248_11281977 | 3300009177 | Unclassified | 829 |
| 164 | Ga0105237_10376777 | 3300009545 | Bacteria | 1424 |
| 165 | Ga0105238_10564414 | 3300009551 | Bacteria | 1143 |
| 166 | Ga0105238_11246246 | 3300009551 | Bacteria | 769 |
| 167 | Ga0105249_11786181 | 3300009553 | Bacteria | 687 |
| 168 | Ga0105249_12064831 | 3300009553 | Bacteria | 643 |
| 169 | Ga0099796_10484406 | 3300010159 | Bacteria | 553 |
| 170 | Ga0105239_10052137 | 3300010375 | Bacteria | 4486 |
| 171 | Ga0105239_10799974 | 3300010375 | Bacteria | 1080 |
| 172 | Ga0105246_11046552 | 3300011119 | Bacteria | 742 |
| 173 | Ga0157370_10430119 | 3300013104 | Bacteria | 1214 |
| 174 | Ga0157369_11023043 | 3300013105 | Bacteria | 845 |
| 175 | Ga0157374_10057349 | 3300013296 | Bacteria | 3637 |
| 176 | Ga0157378_10077730 | 3300013297 | Bacteria | 2992 |
| 177 | Ga0157378_10343666 | 3300013297 | Bacteria | 1456 |
| 178 | Ga0157378_11359060 | 3300013297 | Unclassified | 753 |
| 179 | Ga0157378_12196052 | 3300013297 | Bacteria | 603 |
| 180 | Ga0163162_10431032 | 3300013306 | Bacteria | 1450 |
| 181 | Ga0163162_11372356 | 3300013306 | Bacteria | 804 |
| 182 | Ga0163162_12419590 | 3300013306 | Bacteria | 604 |
| 183 | Ga0157375_10177865 | 3300013308 | Unclassified | 2278 |
| 184 | Ga0157375_10495530 | 3300013308 | Bacteria | 1386 |
| 185 | Ga0157375_10971522 | 3300013308 | Bacteria | 990 |
| 186 | Ga0157375_12439133 | 3300013308 | Bacteria | 624 |
| 187 | Ga0163163_10030013 | 3300014325 | Bacteria | 5234 |
| 188 | Ga0163163_10094087 | 3300014325 | Unclassified | 3014 |
| 189 | Ga0163163_10101311 | 3300014325 | Bacteria | 2902 |
| 190 | Ga0157380_10076579 | 3300014326 | Bacteria | 2723 |
| 191 | Ga0157380_10397704 | 3300014326 | Bacteria | 1306 |
| 192 | Ga0157380_11379906 | 3300014326 | Bacteria | 754 |
| 193 | Ga0157379_10014279 | 3300014968 | Bacteria | 6966 |
| 194 | Ga0157379_10306373 | 3300014968 | Bacteria | 1448 |
| 195 | Ga0157376_10002050 | 3300014969 | Bacteria | 13514 |
| 196 | Ga0157376_10040411 | 3300014969 | Bacteria | 3812 |
| 197 | Ga0157376_10508596 | 3300014969 | Bacteria | 1185 |
| 198 | Ga0157376_10548487 | 3300014969 | Bacteria | 1144 |
| 199 | Ga0157376_12132332 | 3300014969 | Bacteria | 599 |
| 200 | Ga0157376_12571743 | 3300014969 | Bacteria | 549 |
| 201 | Ga0182005_1000690 | 3300015265 | Bacteria | 15757 |
| 202 | Ga0209564_1000005 | 3300025295 | Bacteria | 1147192 |
| 203 | Ga0207697_10063028 | 3300025315 | Bacteria | 1545 |
| 204 | Ga0207697_10455741 | 3300025315 | Bacteria | 567 |
| 205 | Ga0207656_10005521 | 3300025321 | Bacteria | 4475 |
| 206 | Ga0207653_10000070 | 3300025885 | Bacteria | 76652 |
| 207 | Ga0207710_10022834 | 3300025900 | Bacteria | 2685 |
| 208 | Ga0207710_10051836 | 3300025900 | Bacteria | 1843 |
| 209 | Ga0207688_10192874 | 3300025901 | Bacteria | 1219 |
| 210 | Ga0207680_10916142 | 3300025903 | Bacteria | 628 |
| 211 | Ga0207699_11109372 | 3300025906 | Bacteria | 586 |
| 212 | Ga0207645_10489306 | 3300025907 | Bacteria | 832 |
| 213 | Ga0207645_10553389 | 3300025907 | Bacteria | 780 |
| 214 | Ga0207643_10031742 | 3300025908 | Bacteria | 2947 |
| 215 | Ga0207684_10000102 | 3300025910 | Bacteria | 162120 |
| 216 | Ga0207684_10037157 | 3300025910 | Bacteria | 4133 |
| 217 | Ga0207684_10037711 | 3300025910 | Bacteria | 4101 |
| 218 | Ga0207654_11304248 | 3300025911 | Unclassified | 529 |
| 219 | Ga0207707_10008117 | 3300025912 | Bacteria | 9115 |
| 220 | Ga0207695_10110949 | 3300025913 | Bacteria | 2722 |
| 221 | Ga0207695_10407322 | 3300025913 | Bacteria | 1244 |
| 222 | Ga0207693_10012040 | 3300025915 | Bacteria | 6994 |
| 223 | Ga0207693_10055658 | 3300025915 | Unclassified | 3103 |
| 224 | Ga0207693_10553794 | 3300025915 | Bacteria | 897 |
| 225 | Ga0207663_10998413 | 3300025916 | Bacteria | 671 |
| 226 | Ga0207660_10343104 | 3300025917 | Bacteria | 1196 |
| 227 | Ga0207662_10203903 | 3300025918 | Bacteria | 1281 |
| 228 | Ga0207662_10407683 | 3300025918 | Unclassified | 923 |
| 229 | Ga0207662_11217346 | 3300025918 | Unclassified | 535 |
| 230 | Ga0207652_11129162 | 3300025921 | Bacteria | 684 |
| 231 | Ga0207646_10263972 | 3300025922 | Bacteria | 1556 |
| 232 | Ga0207646_10404835 | 3300025922 | Unclassified | 1232 |
| 233 | Ga0207646_10944643 | 3300025922 | Bacteria | 764 |
| 234 | Ga0207694_10387287 | 3300025924 | Bacteria | 1161 |
| 235 | Ga0207650_10004372 | 3300025925 | Bacteria | 9655 |
| 236 | Ga0207650_10867204 | 3300025925 | Unclassified | 766 |
| 237 | Ga0207659_10147378 | 3300025926 | Unclassified | 1834 |
| 238 | Ga0207659_10426668 | 3300025926 | Bacteria | 1113 |
| 239 | Ga0207687_10474521 | 3300025927 | Bacteria | 1041 |
| 240 | Ga0207687_11196214 | 3300025927 | Bacteria | 653 |
| 241 | Ga0207664_10454521 | 3300025929 | Bacteria | 1143 |
| 242 | Ga0207664_10458772 | 3300025929 | Bacteria | 1138 |
| 243 | Ga0207706_10158868 | 3300025933 | Bacteria | 1988 |
| 244 | Ga0207706_10165553 | 3300025933 | Bacteria | 1943 |
| 245 | Ga0207686_10053140 | 3300025934 | Bacteria | 2531 |
| 246 | Ga0207686_10313366 | 3300025934 | Bacteria | 1169 |
| 247 | Ga0207686_10548191 | 3300025934 | Unclassified | 904 |
| 248 | Ga0207709_10000384 | 3300025935 | Bacteria | 43883 |
| 249 | Ga0207709_10229821 | 3300025935 | Bacteria | 1343 |
| 250 | Ga0207670_10080414 | 3300025936 | Unclassified | 2278 |
| 251 | Ga0207670_10146068 | 3300025936 | Bacteria | 1749 |
| 252 | Ga0207669_10036771 | 3300025937 | Bacteria | 2802 |
| 253 | Ga0207669_10438499 | 3300025937 | Bacteria | 1032 |
| 254 | Ga0207704_10061725 | 3300025938 | Bacteria | 2327 |
| 255 | Ga0207665_10031582 | 3300025939 | Bacteria | 3504 |
| 256 | Ga0207691_10068187 | 3300025940 | Bacteria | 3214 |
| 257 | Ga0207691_10115797 | 3300025940 | Bacteria | 2380 |
| 258 | Ga0207691_10277660 | 3300025940 | Bacteria | 1442 |
| 259 | Ga0207691_11203300 | 3300025940 | Bacteria | 628 |
| 260 | Ga0207711_10229694 | 3300025941 | Bacteria | 1699 |
| 261 | Ga0207711_11167802 | 3300025941 | Bacteria | 711 |
| 262 | Ga0207689_10002806 | 3300025942 | Bacteria | 16095 |
| 263 | Ga0207689_10022817 | 3300025942 | Bacteria | 5257 |
| 264 | Ga0207689_10871423 | 3300025942 | Bacteria | 760 |
| 265 | Ga0207661_11453807 | 3300025944 | Bacteria | 629 |
| 266 | Ga0207679_10143027 | 3300025945 | Bacteria | 1936 |
| 267 | Ga0207679_11395070 | 3300025945 | Bacteria | 643 |
| 268 | Ga0207651_10919011 | 3300025960 | Bacteria | 780 |
| 269 | Ga0207651_11567362 | 3300025960 | Bacteria | 593 |
| 270 | Ga0207712_10444186 | 3300025961 | Bacteria | 1099 |
| 271 | Ga0207712_11989349 | 3300025961 | Unclassified | 520 |
| 272 | Ga0207668_10134726 | 3300025972 | Bacteria | 1891 |
| 273 | Ga0207640_10362779 | 3300025981 | Bacteria | 1168 |
| 274 | Ga0207658_10575014 | 3300025986 | Bacteria | 1010 |
| 275 | Ga0207677_10120283 | 3300026023 | Bacteria | 1974 |
| 276 | Ga0207677_11395596 | 3300026023 | Bacteria | 645 |
| 277 | Ga0207703_10140223 | 3300026035 | Unclassified | 2097 |
| 278 | Ga0207703_10386899 | 3300026035 | Bacteria | 1295 |
| 279 | Ga0207703_10577649 | 3300026035 | Bacteria | 1062 |
| 280 | Ga0207708_10018326 | 3300026075 | Bacteria | 5272 |
| 281 | Ga0207708_11147446 | 3300026075 | Bacteria | 678 |
| 282 | Ga0207641_10143864 | 3300026088 | Unclassified | 2154 |
| 283 | Ga0207641_11342098 | 3300026088 | Bacteria | 716 |
| 284 | Ga0207641_11548768 | 3300026088 | Bacteria | 665 |
| 285 | Ga0207648_10033310 | 3300026089 | Bacteria | 4545 |
| 286 | Ga0207648_10281588 | 3300026089 | Unclassified | 1487 |
| 287 | Ga0207648_10600128 | 3300026089 | Bacteria | 1015 |
| 288 | Ga0207676_10023208 | 3300026095 | Bacteria | 4573 |
| 289 | Ga0207676_10652568 | 3300026095 | Bacteria | 1016 |
| 290 | Ga0207674_10278575 | 3300026116 | Bacteria | 1620 |
| 291 | Ga0207675_100059731 | 3300026118 | Bacteria | 3558 |
| 292 | Ga0207675_101150076 | 3300026118 | Bacteria | 796 |
| 293 | Ga0207683_10034872 | 3300026121 | Bacteria | 4376 |
| 294 | Ga0207683_10075628 | 3300026121 | Bacteria | 2981 |
| 295 | Ga0207683_10208043 | 3300026121 | Bacteria | 1780 |
| 296 | Ga0207698_10002020 | 3300026142 | Bacteria | 11972 |
| 297 | Ga0207698_11143971 | 3300026142 | Bacteria | 792 |
| 298 | Ga0207698_12550896 | 3300026142 | Bacteria | 521 |
| 299 | Ga0209371_1000235 | 3300027312 | Bacteria | 69492 |
| 300 | Ga0207428_10125573 | 3300027907 | Bacteria | 1965 |
| 301 | Ga0268266_10002770 | 3300028379 | Bacteria | 18315 |
| 302 | Ga0268266_10302602 | 3300028379 | Bacteria | 1492 |
| 303 | Ga0268265_10171080 | 3300028380 | Bacteria | 1857 |
| 304 | Ga0268265_10408164 | 3300028380 | Bacteria | 1258 |
| 305 | Ga0268264_10547074 | 3300028381 | Bacteria | 1135 |
| 306 | Ga0268264_10756768 | 3300028381 | Bacteria | 968 |
| 307 | Ga0265334_10072901 | 3300028573 | Bacteria | 1276 |
| 308 | Ga0268256_1000196 | 3300030500 | Bacteria | 69428 |
| 309 | Ga0265760_10020955 | 3300031090 | Bacteria | 1888 |
| 310 | Ga0265332_10078422 | 3300031238 | Bacteria | 1402 |
| 311 | Ga0265320_10087029 | 3300031240 | Bacteria | 1452 |
| 312 | Ga0265331_10106009 | 3300031250 | Bacteria | 1291 |
| 313 | Ga0265331_10185062 | 3300031250 | Bacteria | 940 |
| 314 | Ga0307513_10056883 | 3300031456 | Bacteria | 4172 |
| 315 | Ga0307513_10094905 | 3300031456 | Bacteria | 3026 |
| 316 | Ga0307408_100043021 | 3300031548 | Bacteria | 3212 |
| 317 | Ga0307408_102159753 | 3300031548 | Bacteria | 538 |
| 318 | Ga0307508_10616201 | 3300031616 | Unclassified | 688 |
| 319 | Ga0307413_10242983 | 3300031824 | Bacteria | 1330 |
| 320 | Ga0307407_10027913 | 3300031903 | Bacteria | 3010 |
| 321 | Ga0307409_100433279 | 3300031995 | Bacteria | 1264 |
| 322 | Ga0307416_100038365 | 3300032002 | Bacteria | 3695 |
| 323 | Ga0307411_10116924 | 3300032005 | Bacteria | 1920 |
| 324 | Ga0307415_100012888 | 3300032126 | Bacteria | 4854 |
| 325 | Ga0316583_10015352 | 3300032133 | Bacteria | 2756 |
| 326 | Ga0373929_0018753 | 3300035085 | Unclassified | 1378 |
| 327 | Ga0373934_0097455 | 3300035086 | Bacteria | 1188 |
| 328 | Ga0373940_0144746 | 3300035088 | Unclassified | 753 |
| 329 | Ga0373944_0233874 | 3300035089 | Bacteria | 674 |
| 330 | Ga0373923_0678794 | 3300035111 | Bacteria | 511 |
| 331 | Ga0373936_0376962 | 3300035113 | Bacteria | 649 |
| 332 | Ga0373939_0114394 | 3300035114 | Bacteria | 944 |
| 333 | Ga0373953_0107254 | 3300035117 | Bacteria | 1179 |
| 334 | Ga0373954_0112614 | 3300035118 | Bacteria | 1317 |
| 335 | Ga0373957_0294327 | 3300035120 | Bacteria | 688 |
| 336 | Ga0373957_0313291 | 3300035120 | Bacteria | 667 |
| 337 | Ga0373943_0028572 | 3300035170 | Bacteria | 2629 |
| 338 | Ga0373946_0650681 | 3300035171 | Bacteria | 549 |
| 339 | Ga0373955_0193986 | 3300035172 | Bacteria | 1208 |
| 340 | Ga0373955_0445267 | 3300035172 | Unclassified | 789 |
| 341 | Ga0373927_0072579 | 3300035695 | Bacteria | 2228 |
| 342 | Ga0373933_0104595 | 3300035724 | Bacteria | 1760 |
| 343 | Ga0373937_0022201 | 3300036401 | Bacteria | 5703 |
| 344 | Ga0373937_0087289 | 3300036401 | Bacteria | 2887 |
| 345 | Ga0373937_0548240 | 3300036401 | Bacteria | 1098 |
| 346 | Ga0373937_0702157 | 3300036401 | Bacteria | 958 |
| 347 | Ga0373925_0108206 | 3300037068 | Bacteria | 2145 |
| 348 | Ga0451795_0779968 | 3300041456 | Bacteria | 750 |
| 349 | Ga0451802_1076870 | 3300041460 | Bacteria | 1075 |
| 350 | Ga0451807_2761694 | 3300041486 | Bacteria | 545 |
| 351 | Ga0451843_0878626 | 3300041509 | Bacteria | 675 |
| 352 | Ga0450896_039961 | 3300042133 | Bacteria | 728 |
| 353 | Ga0451577_1376966 | 3300042876 | Bacteria | 626 |
| 354 | Ga0451576_0139834 | 3300045051 | Unclassified | 2525 |
| 355 | Ga0495617_001438 | 3300046452 | Bacteria | 10458 |
| 356 | Ga0495592_0458152 | 3300046454 | Bacteria | 798 |
| 357 | Ga0495603_0313874 | 3300046455 | Bacteria | 900 |
| 358 | Ga0495603_0902032 | 3300046455 | Unclassified | 502 |
| 359 | Ga0495629_0000008 | 3300046459 | Bacteria | 352138 |
| 360 | Ga0495638_0000007 | 3300046460 | Bacteria | 602783 |
| 361 | Ga0495638_0349486 | 3300046460 | Bacteria | 781 |
| 362 | Ga0495641_0289871 | 3300046461 | Bacteria | 737 |
| 363 | Ga0495650_0000912 | 3300046471 | Bacteria | 34832 |
| 364 | Ga0495580_0003075 | 3300046472 | Bacteria | 14293 |
| 365 | Ga0495580_0022792 | 3300046472 | Bacteria | 4603 |
| 366 | Ga0495580_0040899 | 3300046472 | Bacteria | 3309 |
| 367 | Ga0495580_0043850 | 3300046472 | Bacteria | 3182 |
| 368 | Ga0495582_0011566 | 3300046473 | Bacteria | 4862 |
| 369 | Ga0495639_0014066 | 3300046475 | Bacteria | 3461 |
| 370 | Ga0495664_0080660 | 3300046477 | Bacteria | 1950 |
| 371 | Ga0495594_0034655 | 3300046499 | Bacteria | 2747 |
| 372 | Ga0495606_0009282 | 3300046507 | Bacteria | 8347 |
| 373 | Ga0495610_0001742 | 3300046512 | Bacteria | 19057 |
| 374 | Ga0495610_0014431 | 3300046512 | Bacteria | 4639 |
| 375 | Ga0495610_0358385 | 3300046512 | Unclassified | 547 |
| 376 | Ga0495618_0003758 | 3300046514 | Bacteria | 9392 |
| 377 | Ga0495618_0061641 | 3300046514 | Bacteria | 2379 |
| 378 | Ga0495620_0017760 | 3300046515 | Bacteria | 3538 |
| 379 | Ga0495628_0149176 | 3300046516 | Bacteria | 1782 |
| 380 | Ga0495628_0459542 | 3300046516 | Bacteria | 924 |
| 381 | Ga0495630_0051811 | 3300046517 | Bacteria | 3072 |
| 382 | Ga0495630_0361441 | 3300046517 | Bacteria | 1111 |
| 383 | Ga0495631_0009252 | 3300046518 | Bacteria | 4929 |
| 384 | Ga0495632_0025468 | 3300046519 | Bacteria | 3128 |
| 385 | Ga0495632_0303073 | 3300046519 | Bacteria | 708 |
| 386 | Ga0495643_0000346 | 3300046522 | Bacteria | 63025 |
| 387 | Ga0495648_0009496 | 3300046524 | Bacteria | 7523 |
| 388 | Ga0495648_0020499 | 3300046524 | Bacteria | 4608 |
| 389 | Ga0495666_0072430 | 3300046526 | Bacteria | 1636 |
| 390 | Ga0495665_0204781 | 3300046531 | Bacteria | 1022 |
| 391 | Ga0495640_0040344 | 3300046533 | Bacteria | 3269 |
| 392 | Ga0495640_0147206 | 3300046533 | Bacteria | 1514 |
| 393 | Ga0495586_0000802 | 3300046535 | Bacteria | 18042 |
| 394 | Ga0495586_0015731 | 3300046535 | Bacteria | 4024 |
| 395 | Ga0495587_0497854 | 3300046536 | Bacteria | 674 |
| 396 | Ga0495598_0389375 | 3300046537 | Bacteria | 543 |
| 397 | Ga0495609_0004783 | 3300046538 | Bacteria | 7311 |
| 398 | Ga0495621_0327354 | 3300046539 | Bacteria | 639 |
| 399 | Ga0495622_0356522 | 3300046557 | Bacteria | 633 |
| 400 | Ga0495667_0432197 | 3300046559 | Bacteria | 828 |
| 401 | Ga0495656_0336830 | 3300046615 | Bacteria | 780 |
| 402 | Ga0495668_0000093 | 3300046616 | Bacteria | 142565 |
| 403 | Ga0495634_0032709 | 3300046642 | Bacteria | 3575 |
| 404 | Ga0495611_0000008 | 3300046648 | Bacteria | 218134 |
| 405 | Ga0495625_0144387 | 3300046660 | Bacteria | 1603 |
| 406 | Ga0495635_0859786 | 3300046663 | Unclassified | 582 |
| 407 | Ga0495599_0644613 | 3300046678 | Bacteria | 614 |
| 408 | Ga0495647_0048950 | 3300046681 | Bacteria | 1636 |
| 409 | Ga0495658_0049611 | 3300046683 | Bacteria | 2371 |
| 410 | Ga0495658_0309809 | 3300046683 | Bacteria | 999 |
| 411 | Ga0495649_0014911 | 3300046694 | Bacteria | 4441 |
| 412 | Ga0495581_0265383 | 3300047315 | Bacteria | 1004 |
| 413 | Ga0495581_0635929 | 3300047315 | Bacteria | 617 |
| 414 | Ga0495581_0792324 | 3300047315 | Bacteria | 544 |
| 415 | Ga0495604_0549170 | 3300047317 | Bacteria | 745 |
| 416 | Ga0495674_0138543 | 3300047319 | Bacteria | 2046 |
| 417 | Ga0495674_0145628 | 3300047319 | Bacteria | 1989 |
| 418 | Ga0495672_0000215 | 3300047320 | Bacteria | 82448 |
| 419 | Ga0495676_0117618 | 3300047321 | Bacteria | 1939 |
| 420 | Ga0495680_0023526 | 3300047322 | Bacteria | 5121 |
| 421 | Ga0495680_0466461 | 3300047322 | Bacteria | 862 |
| 422 | Ga0495683_0191937 | 3300047323 | Bacteria | 926 |
| 423 | Ga0495677_0143527 | 3300047445 | Bacteria | 917 |
| 424 | Ga0495673_0000030 | 3300047469 | Bacteria | 468915 |
| 425 | Ga0495684_0085434 | 3300047471 | Bacteria | 2393 |
| 426 | Ga0495684_0121470 | 3300047471 | Bacteria | 1967 |
| 427 | Ga0495684_0147632 | 3300047471 | Unclassified | 1760 |
| 428 | Ga0495686_0000077 | 3300047472 | Bacteria | 205924 |
| 429 | Ga0495686_0001944 | 3300047472 | Bacteria | 20572 |
| 430 | Ga0495602_0423636 | 3300048088 | Bacteria | 945 |
| 431 | Ga0495602_0712976 | 3300048088 | Bacteria | 680 |
| 432 | Ga0496102_0318597 | 3300048905 | Bacteria | 1465 |
| 433 | Ga0496104_0079377 | 3300048907 | Bacteria | 3128 |
| 434 | Ga0496104_0207477 | 3300048907 | Bacteria | 1871 |
| 435 | Ga0496107_0313961 | 3300048910 | Bacteria | 1167 |
| 436 | Ga0496110_0318364 | 3300048913 | Bacteria | 1417 |
| 437 | Ga0496111_0090559 | 3300048914 | Bacteria | 2241 |
| 438 | Ga0496118_0022321 | 3300048921 | Bacteria | 5539 |
| 439 | Ga0496120_0000015 | 3300048923 | Bacteria | 310795 |
| 440 | Ga0496121_0043517 | 3300048924 | Bacteria | 3888 |
| 441 | Ga0496123_0497240 | 3300048926 | Bacteria | 533 |
| 442 | Ga0496126_0006217 | 3300048929 | Bacteria | 13357 |
| 443 | Ga0495678_000645 | 3300049459 | Bacteria | 32069 |
| 444 | Ga0495678_175128 | 3300049459 | Bacteria | 676 |
| 445 | Ga0501031_0205231 | 3300049568 | Bacteria | 1285 |
| 446 | Ga0501031_0794755 | 3300049568 | Bacteria | 607 |
| 447 | Ga0501036_0004752 | 3300049572 | Bacteria | 10966 |
| 448 | Ga0501037_0037340 | 3300049573 | Bacteria | 3581 |
| 449 | Ga0501038_0002784 | 3300049574 | Bacteria | 16268 |
| 450 | Ga0501039_0054599 | 3300049575 | Bacteria | 3092 |
| 451 | Ga0501040_0005087 | 3300049576 | Bacteria | 8500 |
| 452 | Ga0501041_0003565 | 3300049577 | Bacteria | 8957 |
| 453 | Ga0501042_0005091 | 3300049578 | Bacteria | 8433 |
| 454 | Ga0501042_0088796 | 3300049578 | Bacteria | 2218 |
| 455 | Ga0501043_0051201 | 3300049579 | Bacteria | 3245 |
| 456 | Ga0501046_0072302 | 3300049580 | Bacteria | 2678 |
| 457 | Ga0501048_0019632 | 3300049582 | Bacteria | 4957 |
| 458 | Ga0501070_0433649 | 3300049586 | Bacteria | 1061 |
| 459 | Ga0501071_0072836 | 3300049587 | Bacteria | 2505 |
| 460 | Ga0501071_0560980 | 3300049587 | Bacteria | 877 |
| 461 | Ga0501072_0020219 | 3300049588 | Bacteria | 5156 |
| 462 | Ga0501073_0190000 | 3300049589 | Bacteria | 1421 |
| 463 | Ga0501074_0041690 | 3300049590 | Bacteria | 3323 |
| 464 | Ga0501075_0002432 | 3300049591 | Bacteria | 12396 |
| 465 | Ga0501075_1477883 | 3300049591 | Bacteria | 514 |
| 466 | Ga0501076_0005418 | 3300049592 | Bacteria | 9173 |
| 467 | Ga0501077_0022657 | 3300049593 | Bacteria | 3980 |
| 468 | Ga0501243_040130 | 3300049675 | Bacteria | 821 |
| 469 | Ga0501221_130047 | 3300049704 | Bacteria | 651 |
| 470 | Ga0501080_0012374 | 3300049742 | Bacteria | 7821 |
| 471 | Ga0501081_0006637 | 3300049743 | Bacteria | 7523 |
| 472 | Ga0501081_0135205 | 3300049743 | Bacteria | 1764 |
| 473 | Ga0501083_0036988 | 3300049744 | Bacteria | 3327 |
| 474 | Ga0501272_027864 | 3300049769 | Bacteria | 706 |
| 475 | Ga0501035_0022819 | 3300049822 | Bacteria | 5747 |
| 476 | Ga0501044_0666409 | 3300049823 | Bacteria | 928 |
| 477 | Ga0501045_0003227 | 3300049824 | Bacteria | 11142 |
| 478 | Ga0501045_0232060 | 3300049824 | Bacteria | 1374 |
| 479 | Ga0501045_1230633 | 3300049824 | Bacteria | 546 |
| 480 | nmdc:mga05p37_19044_c2 | 3300050507 | Bacteria | 5185 |
| 481 | nmdc:mga05p37_220747_c1 | 3300050507 | Bacteria | 2287 |
| 482 | nmdc:mga05p37_75960_c1 | 3300050507 | Unclassified | 4136 |
| 483 | nmdc:mga09592_125595_c1 | 3300050508 | Bacteria | 2205 |
| 484 | nmdc:mga09592_71206_c1 | 3300050508 | Bacteria | 2951 |
| 485 | nmdc:mga09592_89786_c1 | 3300050508 | Bacteria | 2625 |
| 486 | nmdc:mga0qj67_1575905_c1 | 3300050509 | Bacteria | 504 |
| 487 | nmdc:mga0qj67_232211_c1 | 3300050509 | Bacteria | 1497 |
| 488 | nmdc:mga0qj67_38053_c1 | 3300050509 | Bacteria | 3773 |
| 489 | nmdc:mga06r32_17679_c1 | 3300050510 | Bacteria | 6513 |
| 490 | nmdc:mga06r32_5368_c1 | 3300050510 | Bacteria | 11529 |
| 491 | nmdc:mga06r32_722469_c1 | 3300050510 | Bacteria | 961 |
| 492 | nmdc:mga06r32_9997_c1 | 3300050510 | Bacteria | 8560 |
| 493 | nmdc:mga08y16_1224728_c1 | 3300050511 | Unclassified | 720 |
| 494 | nmdc:mga08y16_458222_c1 | 3300050511 | Bacteria | 1300 |
| 495 | nmdc:mga08y16_532746_c1 | 3300050511 | Bacteria | 1190 |
| 496 | nmdc:mga08y16_733578_c1 | 3300050511 | Bacteria | 985 |
| 497 | nmdc:mga0n895_339457_c1 | 3300050512 | Bacteria | 1522 |
| 498 | nmdc:mga0n895_412980_c1 | 3300050512 | Unclassified | 1365 |
| 499 | nmdc:mga0a205_50749_c1 | 3300050515 | Bacteria | 4005 |
| 500 | nmdc:mga0a205_6975_c1 | 3300050515 | Bacteria | 10216 |
| 501 | Ga0495595_0160614 | 3300053084 | Bacteria | 1109 |
| 502 | Ga0495595_0369745 | 3300053084 | Bacteria | 725 |
| 503 | Ga0495619_0539439 | 3300053085 | Bacteria | 801 |
| 504 | Ga0500583_0168721 | 3300053092 | Bacteria | 1090 |
| 505 | Ga0500566_0109284 | 3300053094 | Bacteria | 1505 |
| 506 | Ga0500622_0014599 | 3300053156 | Bacteria | 4214 |
| 507 | Ga0500633_0000581 | 3300053160 | Bacteria | 5993 |
| 508 | Ga0501084_0002853 | 3300054114 | Bacteria | 13968 |
| 509 | Ga0501082_0034399 | 3300060353 | Bacteria | 4369 |
| 510 | Ga0501082_0530113 | 3300060353 | Bacteria | 1030 |
| 511 | Ga0530510_0006773 | 3300061734 | Bacteria | 7983 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2818991457 | 2819661812 | 124 |
| 2 | iso_pu_bacteria | 2852684882 | 2852688465 | 124 |
| 3 | iso_pu_bacteria | 2919130084 | 2919133891 | 124 |
| 4 | iso_pu_bacteria | 2929195423 | 2929199818 | 124 |
| 5 | iso_pu_bacteria | 2831864461 | 2831868246 | 125 |
| 6 | 3300005434 | Ga0070709_11301665 | Ga0070709_113016652 | 126 |
| 7 | 3300005262 | Ga0065165_1000562 | Ga0065165_100056243 | 127 |
| 8 | 3300005548 | Ga0070665_102097869 | Ga0070665_1020978692 | 127 |
| 9 | 3300003856 | Ga0058692_1000081 | Ga0058692_100008127 | 128 |
| 10 | 3300005289 | Ga0065704_10757879 | Ga0065704_107578792 | 128 |
| 11 | 3300005293 | Ga0065715_10313755 | Ga0065715_103137552 | 128 |
| 12 | 3300005295 | Ga0065707_10133447 | Ga0065707_101334472 | 128 |
| 13 | 3300005327 | Ga0070658_10892076 | Ga0070658_108920761 | 128 |
| 14 | 3300005328 | Ga0070676_10335604 | Ga0070676_103356042 | 128 |
| 15 | 3300005330 | Ga0070690_100134313 | Ga0070690_1001343133 | 128 |
| 16 | 3300005331 | Ga0070670_100240931 | Ga0070670_1002409312 | 128 |
| 17 | 3300005334 | Ga0068869_100466786 | Ga0068869_1004667862 | 128 |
| 18 | 3300005336 | Ga0070680_100365754 | Ga0070680_1003657542 | 128 |
| 19 | 3300005339 | Ga0070660_101046358 | Ga0070660_1010463581 | 128 |
| 20 | 3300005339 | Ga0070660_101820069 | Ga0070660_1018200691 | 128 |
| 21 | 3300005340 | Ga0070689_100140090 | Ga0070689_1001400904 | 128 |
| 22 | 3300005353 | Ga0070669_100170862 | Ga0070669_1001708622 | 128 |
| 23 | 3300005353 | Ga0070669_100277999 | Ga0070669_1002779992 | 128 |
| 24 | 3300005354 | Ga0070675_100026726 | Ga0070675_1000267263 | 128 |
| 25 | 3300005354 | Ga0070675_100038788 | Ga0070675_1000387882 | 128 |
| 26 | 3300005354 | Ga0070675_101283779 | Ga0070675_1012837792 | 128 |
| 27 | 3300005356 | Ga0070674_100182083 | Ga0070674_1001820833 | 128 |
| 28 | 3300005356 | Ga0070674_100505873 | Ga0070674_1005058732 | 128 |
| 29 | 3300005356 | Ga0070674_100858276 | Ga0070674_1008582761 | 128 |
| 30 | 3300005364 | Ga0070673_100342165 | Ga0070673_1003421651 | 128 |
| 31 | 3300005435 | Ga0070714_102149359 | Ga0070714_1021493591 | 128 |
| 32 | 3300005438 | Ga0070701_10138618 | Ga0070701_101386182 | 128 |
| 33 | 3300005440 | Ga0070705_100000718 | Ga0070705_10000071811 | 128 |
| 34 | 3300005440 | Ga0070705_100043989 | Ga0070705_1000439892 | 128 |
| 35 | 3300005440 | Ga0070705_101238812 | Ga0070705_1012388121 | 128 |
| 36 | 3300005441 | Ga0070700_100115975 | Ga0070700_1001159751 | 128 |
| 37 | 3300005441 | Ga0070700_101126551 | Ga0070700_1011265512 | 128 |
| 38 | 3300005444 | Ga0070694_101312126 | Ga0070694_1013121261 | 128 |
| 39 | 3300005445 | Ga0070708_100000078 | Ga0070708_10000007836 | 128 |
| 40 | 3300005445 | Ga0070708_100023206 | Ga0070708_1000232066 | 128 |
| 41 | 3300005445 | Ga0070708_100324913 | Ga0070708_1003249133 | 128 |
| 42 | 3300005445 | Ga0070708_100636030 | Ga0070708_1006360302 | 128 |
| 43 | 3300005445 | Ga0070708_100863998 | Ga0070708_1008639982 | 128 |
| 44 | 3300005456 | Ga0070678_100026865 | Ga0070678_1000268653 | 128 |
| 45 | 3300005456 | Ga0070678_100034945 | Ga0070678_1000349454 | 128 |
| 46 | 3300005456 | Ga0070678_100503071 | Ga0070678_1005030711 | 128 |
| 47 | 3300005456 | Ga0070678_102060593 | Ga0070678_1020605931 | 128 |
| 48 | 3300005458 | Ga0070681_10010815 | Ga0070681_1001081513 | 128 |
| 49 | 3300005459 | Ga0068867_100094406 | Ga0068867_1000944064 | 128 |
| 50 | 3300005459 | Ga0068867_100236755 | Ga0068867_1002367552 | 128 |
| 51 | 3300005459 | Ga0068867_100553859 | Ga0068867_1005538591 | 128 |
| 52 | 3300005459 | Ga0068867_100725189 | Ga0068867_1007251892 | 128 |
| 53 | 3300005459 | Ga0068867_101300241 | Ga0068867_1013002411 | 128 |
| 54 | 3300005466 | Ga0070685_10035100 | Ga0070685_100351003 | 128 |
| 55 | 3300005466 | Ga0070685_10041751 | Ga0070685_100417514 | 128 |
| 56 | 3300005466 | Ga0070685_11181247 | Ga0070685_111812471 | 128 |
| 57 | 3300005467 | Ga0070706_100042015 | Ga0070706_1000420156 | 128 |
| 58 | 3300005468 | Ga0070707_100033592 | Ga0070707_1000335922 | 128 |
| 59 | 3300005468 | Ga0070707_100416603 | Ga0070707_1004166031 | 128 |
| 60 | 3300005468 | Ga0070707_100533546 | Ga0070707_1005335462 | 128 |
| 61 | 3300005471 | Ga0070698_100018518 | Ga0070698_1000185184 | 128 |
| 62 | 3300005471 | Ga0070698_100071572 | Ga0070698_1000715722 | 128 |
| 63 | 3300005518 | Ga0070699_100040647 | Ga0070699_1000406471 | 128 |
| 64 | 3300005518 | Ga0070699_100091588 | Ga0070699_1000915882 | 128 |
| 65 | 3300005518 | Ga0070699_100178852 | Ga0070699_1001788522 | 128 |
| 66 | 3300005518 | Ga0070699_100766762 | Ga0070699_1007667622 | 128 |
| 67 | 3300005535 | Ga0070684_100154559 | Ga0070684_1001545592 | 128 |
| 68 | 3300005536 | Ga0070697_100192285 | Ga0070697_1001922854 | 128 |
| 69 | 3300005539 | Ga0068853_100713367 | Ga0068853_1007133672 | 128 |
| 70 | 3300005539 | Ga0068853_100765646 | Ga0068853_1007656461 | 128 |
| 71 | 3300005543 | Ga0070672_100060846 | Ga0070672_1000608462 | 128 |
| 72 | 3300005543 | Ga0070672_100094859 | Ga0070672_1000948591 | 128 |
| 73 | 3300005544 | Ga0070686_100008690 | Ga0070686_1000086903 | 128 |
| 74 | 3300005544 | Ga0070686_101400481 | Ga0070686_1014004811 | 128 |
| 75 | 3300005545 | Ga0070695_100059282 | Ga0070695_1000592822 | 128 |
| 76 | 3300005545 | Ga0070695_100127274 | Ga0070695_1001272742 | 128 |
| 77 | 3300005545 | Ga0070695_100207432 | Ga0070695_1002074322 | 128 |
| 78 | 3300005545 | Ga0070695_100845600 | Ga0070695_1008456002 | 128 |
| 79 | 3300005546 | Ga0070696_100010988 | Ga0070696_1000109882 | 128 |
| 80 | 3300005546 | Ga0070696_100652021 | Ga0070696_1006520212 | 128 |
| 81 | 3300005548 | Ga0070665_100000499 | Ga0070665_10000049927 | 128 |
| 82 | 3300005548 | Ga0070665_100366702 | Ga0070665_1003667022 | 128 |
| 83 | 3300005548 | Ga0070665_100559933 | Ga0070665_1005599331 | 128 |
| 84 | 3300005549 | Ga0070704_100399258 | Ga0070704_1003992582 | 128 |
| 85 | 3300005549 | Ga0070704_100575617 | Ga0070704_1005756172 | 128 |
| 86 | 3300005549 | Ga0070704_100717826 | Ga0070704_1007178261 | 128 |
| 87 | 3300005549 | Ga0070704_100825521 | Ga0070704_1008255212 | 128 |
| 88 | 3300005563 | Ga0068855_101124685 | Ga0068855_1011246852 | 128 |
| 89 | 3300005564 | Ga0070664_100121327 | Ga0070664_1001213274 | 128 |
| 90 | 3300005577 | Ga0068857_100537621 | Ga0068857_1005376212 | 128 |
| 91 | 3300005578 | Ga0068854_100817233 | Ga0068854_1008172331 | 128 |
| 92 | 3300005614 | Ga0068856_100179369 | Ga0068856_1001793693 | 128 |
| 93 | 3300005614 | Ga0068856_101589282 | Ga0068856_1015892821 | 128 |
| 94 | 3300005615 | Ga0070702_100168942 | Ga0070702_1001689422 | 128 |
| 95 | 3300005615 | Ga0070702_100897048 | Ga0070702_1008970481 | 128 |
| 96 | 3300005616 | Ga0068852_100701542 | Ga0068852_1007015422 | 128 |
| 97 | 3300005617 | Ga0068859_100052428 | Ga0068859_1000524285 | 128 |
| 98 | 3300005617 | Ga0068859_100672800 | Ga0068859_1006728002 | 128 |
| 99 | 3300005617 | Ga0068859_100882011 | Ga0068859_1008820111 | 128 |
| 100 | 3300005618 | Ga0068864_101275252 | Ga0068864_1012752521 | 128 |
| 101 | 3300005618 | Ga0068864_101436148 | Ga0068864_1014361482 | 128 |
| 102 | 3300005718 | Ga0068866_10055557 | Ga0068866_100555572 | 128 |
| 103 | 3300005718 | Ga0068866_10278197 | Ga0068866_102781973 | 128 |
| 104 | 3300005719 | Ga0068861_101678787 | Ga0068861_1016787871 | 128 |
| 105 | 3300005840 | Ga0068870_10034054 | Ga0068870_100340546 | 128 |
| 106 | 3300005841 | Ga0068863_100058667 | Ga0068863_1000586674 | 128 |
| 107 | 3300005841 | Ga0068863_100231723 | Ga0068863_1002317232 | 128 |
| 108 | 3300005841 | Ga0068863_101264317 | Ga0068863_1012643172 | 128 |
| 109 | 3300005841 | Ga0068863_102107509 | Ga0068863_1021075092 | 128 |
| 110 | 3300005842 | Ga0068858_100301503 | Ga0068858_1003015031 | 128 |
| 111 | 3300005843 | Ga0068860_100002637 | Ga0068860_1000026372 | 128 |
| 112 | 3300005843 | Ga0068860_100064311 | Ga0068860_1000643117 | 128 |
| 113 | 3300005844 | Ga0068862_100253578 | Ga0068862_1002535783 | 128 |
| 114 | 3300005844 | Ga0068862_101823050 | Ga0068862_1018230502 | 128 |
| 115 | 3300006028 | Ga0070717_10952275 | Ga0070717_109522752 | 128 |
| 116 | 3300006173 | Ga0070716_100666559 | Ga0070716_1006665592 | 128 |
| 117 | 3300006175 | Ga0070712_100647586 | Ga0070712_1006475861 | 128 |
| 118 | 3300006237 | Ga0097621_100015090 | Ga0097621_1000150909 | 128 |
| 119 | 3300006237 | Ga0097621_100089420 | Ga0097621_1000894205 | 128 |
| 120 | 3300006237 | Ga0097621_100255859 | Ga0097621_1002558593 | 128 |
| 121 | 3300006358 | Ga0068871_100014244 | Ga0068871_1000142449 | 128 |
| 122 | 3300006358 | Ga0068871_100090445 | Ga0068871_1000904452 | 128 |
| 123 | 3300006358 | Ga0068871_100224958 | Ga0068871_1002249581 | 128 |
| 124 | 3300006844 | Ga0075428_100098862 | Ga0075428_1000988626 | 128 |
| 125 | 3300006846 | Ga0075430_100033032 | Ga0075430_1000330325 | 128 |
| 126 | 3300006847 | Ga0075431_100003665 | Ga0075431_1000036652 | 128 |
| 127 | 3300006847 | Ga0075431_100004025 | Ga0075431_1000040259 | 128 |
| 128 | 3300006847 | Ga0075431_100018322 | Ga0075431_1000183226 | 128 |
| 129 | 3300006852 | Ga0075433_10085628 | Ga0075433_100856282 | 128 |
| 130 | 3300006852 | Ga0075433_10158271 | Ga0075433_101582712 | 128 |
| 131 | 3300006871 | Ga0075434_100084878 | Ga0075434_1000848786 | 128 |
| 132 | 3300006871 | Ga0075434_100286982 | Ga0075434_1002869822 | 128 |
| 133 | 3300006880 | Ga0075429_100095842 | Ga0075429_1000958423 | 128 |
| 134 | 3300006880 | Ga0075429_100142895 | Ga0075429_1001428954 | 128 |
| 135 | 3300006880 | Ga0075429_101719823 | Ga0075429_1017198231 | 128 |
| 136 | 3300006881 | Ga0068865_100092024 | Ga0068865_1000920243 | 128 |
| 137 | 3300006881 | Ga0068865_100140056 | Ga0068865_1001400563 | 128 |
| 138 | 3300006881 | Ga0068865_100588818 | Ga0068865_1005888182 | 128 |
| 139 | 3300006914 | Ga0075436_100077371 | Ga0075436_1000773712 | 128 |
| 140 | 3300006931 | Ga0097620_100052428 | Ga0097620_1000524285 | 128 |
| 141 | 3300006931 | Ga0097620_100672803 | Ga0097620_1006728032 | 128 |
| 142 | 3300006931 | Ga0097620_100881931 | Ga0097620_1008819312 | 128 |
| 143 | 3300007076 | Ga0075435_100487008 | Ga0075435_1004870082 | 128 |
| 144 | 3300009093 | Ga0105240_10472276 | Ga0105240_104722762 | 128 |
| 145 | 3300009094 | Ga0111539_10129073 | Ga0111539_101290731 | 128 |
| 146 | 3300009094 | Ga0111539_10200742 | Ga0111539_102007424 | 128 |
| 147 | 3300009094 | Ga0111539_11016618 | Ga0111539_110166181 | 128 |
| 148 | 3300009094 | Ga0111539_11201424 | Ga0111539_112014242 | 128 |
| 149 | 3300009094 | Ga0111539_11677189 | Ga0111539_116771892 | 128 |
| 150 | 3300009094 | Ga0111539_12648813 | Ga0111539_126488132 | 128 |
| 151 | 3300009098 | Ga0105245_11596906 | Ga0105245_115969062 | 128 |
| 152 | 3300009101 | Ga0105247_10113466 | Ga0105247_101134662 | 128 |
| 153 | 3300009147 | Ga0114129_10062076 | Ga0114129_100620762 | 128 |
| 154 | 3300009147 | Ga0114129_10141807 | Ga0114129_101418073 | 128 |
| 155 | 3300009147 | Ga0114129_10874785 | Ga0114129_108747853 | 128 |
| 156 | 3300009147 | Ga0114129_11445981 | Ga0114129_114459812 | 128 |
| 157 | 3300009148 | Ga0105243_10000250 | Ga0105243_1000025022 | 128 |
| 158 | 3300009148 | Ga0105243_10078161 | Ga0105243_100781612 | 128 |
| 159 | 3300009148 | Ga0105243_10193467 | Ga0105243_101934673 | 128 |
| 160 | 3300009148 | Ga0105243_11519105 | Ga0105243_115191052 | 128 |
| 161 | 3300009148 | Ga0105243_12559050 | Ga0105243_125590501 | 128 |
| 162 | 3300009174 | Ga0105241_12170488 | Ga0105241_121704882 | 128 |
| 163 | 3300009176 | Ga0105242_10034795 | Ga0105242_100347956 | 128 |
| 164 | 3300009177 | Ga0105248_11281977 | Ga0105248_112819772 | 128 |
| 165 | 3300009545 | Ga0105237_10376777 | Ga0105237_103767771 | 128 |
| 166 | 3300009551 | Ga0105238_10564414 | Ga0105238_105644141 | 128 |
| 167 | 3300009551 | Ga0105238_11246246 | Ga0105238_112462461 | 128 |
| 168 | 3300009553 | Ga0105249_11786181 | Ga0105249_117861811 | 128 |
| 169 | 3300009553 | Ga0105249_12064831 | Ga0105249_120648312 | 128 |
| 170 | 3300010159 | Ga0099796_10484406 | Ga0099796_104844061 | 128 |
| 171 | 3300010375 | Ga0105239_10052137 | Ga0105239_100521378 | 128 |
| 172 | 3300010375 | Ga0105239_10799974 | Ga0105239_107999742 | 128 |
| 173 | 3300011119 | Ga0105246_11046552 | Ga0105246_110465521 | 128 |
| 174 | 3300013104 | Ga0157370_10430119 | Ga0157370_104301192 | 128 |
| 175 | 3300013105 | Ga0157369_11023043 | Ga0157369_110230432 | 128 |
| 176 | 3300013296 | Ga0157374_10057349 | Ga0157374_100573491 | 128 |
| 177 | 3300013297 | Ga0157378_10077730 | Ga0157378_100777304 | 128 |
| 178 | 3300013297 | Ga0157378_10343666 | Ga0157378_103436662 | 128 |
| 179 | 3300013297 | Ga0157378_11359060 | Ga0157378_113590601 | 128 |
| 180 | 3300013297 | Ga0157378_12196052 | Ga0157378_121960521 | 128 |
| 181 | 3300013306 | Ga0163162_10431032 | Ga0163162_104310322 | 128 |
| 182 | 3300013306 | Ga0163162_11372356 | Ga0163162_113723562 | 128 |
| 183 | 3300013306 | Ga0163162_12419590 | Ga0163162_124195901 | 128 |
| 184 | 3300013308 | Ga0157375_10177865 | Ga0157375_101778653 | 128 |
| 185 | 3300013308 | Ga0157375_10495530 | Ga0157375_104955302 | 128 |
| 186 | 3300013308 | Ga0157375_10971522 | Ga0157375_109715222 | 128 |
| 187 | 3300013308 | Ga0157375_12439133 | Ga0157375_124391331 | 128 |
| 188 | 3300014325 | Ga0163163_10030013 | Ga0163163_100300133 | 128 |
| 189 | 3300014325 | Ga0163163_10094087 | Ga0163163_100940873 | 128 |
| 190 | 3300014325 | Ga0163163_10101311 | Ga0163163_101013114 | 128 |
| 191 | 3300014326 | Ga0157380_10076579 | Ga0157380_100765792 | 128 |
| 192 | 3300014326 | Ga0157380_10397704 | Ga0157380_103977042 | 128 |
| 193 | 3300014326 | Ga0157380_11379906 | Ga0157380_113799061 | 128 |
| 194 | 3300014968 | Ga0157379_10014279 | Ga0157379_100142794 | 128 |
| 195 | 3300014968 | Ga0157379_10306373 | Ga0157379_103063731 | 128 |
| 196 | 3300014969 | Ga0157376_10002050 | Ga0157376_1000205017 | 128 |
| 197 | 3300014969 | Ga0157376_10040411 | Ga0157376_100404114 | 128 |
| 198 | 3300014969 | Ga0157376_10508596 | Ga0157376_105085961 | 128 |
| 199 | 3300014969 | Ga0157376_10548487 | Ga0157376_105484873 | 128 |
| 200 | 3300014969 | Ga0157376_12132332 | Ga0157376_121323321 | 128 |
| 201 | 3300014969 | Ga0157376_12571743 | Ga0157376_125717431 | 128 |
| 202 | 3300015265 | Ga0182005_1000690 | Ga0182005_10006908 | 128 |
| 203 | 3300025315 | Ga0207697_10063028 | Ga0207697_100630282 | 128 |
| 204 | 3300025315 | Ga0207697_10455741 | Ga0207697_104557412 | 128 |
| 205 | 3300025321 | Ga0207656_10005521 | Ga0207656_100055217 | 128 |
| 206 | 3300025885 | Ga0207653_10000070 | Ga0207653_1000007069 | 128 |
| 207 | 3300025900 | Ga0207710_10022834 | Ga0207710_100228344 | 128 |
| 208 | 3300025900 | Ga0207710_10051836 | Ga0207710_100518363 | 128 |
| 209 | 3300025901 | Ga0207688_10192874 | Ga0207688_101928742 | 128 |
| 210 | 3300025903 | Ga0207680_10916142 | Ga0207680_109161421 | 128 |
| 211 | 3300025906 | Ga0207699_11109372 | Ga0207699_111093721 | 128 |
| 212 | 3300025907 | Ga0207645_10489306 | Ga0207645_104893061 | 128 |
| 213 | 3300025907 | Ga0207645_10553389 | Ga0207645_105533891 | 128 |
| 214 | 3300025908 | Ga0207643_10031742 | Ga0207643_100317422 | 128 |
| 215 | 3300025910 | Ga0207684_10000102 | Ga0207684_10000102116 | 128 |
| 216 | 3300025910 | Ga0207684_10037157 | Ga0207684_100371573 | 128 |
| 217 | 3300025910 | Ga0207684_10037711 | Ga0207684_100377113 | 128 |
| 218 | 3300025911 | Ga0207654_11304248 | Ga0207654_113042481 | 128 |
| 219 | 3300025912 | Ga0207707_10008117 | Ga0207707_1000811712 | 128 |
| 220 | 3300025913 | Ga0207695_10110949 | Ga0207695_101109492 | 128 |
| 221 | 3300025913 | Ga0207695_10407322 | Ga0207695_104073221 | 128 |
| 222 | 3300025915 | Ga0207693_10012040 | Ga0207693_100120406 | 128 |
| 223 | 3300025915 | Ga0207693_10055658 | Ga0207693_100556581 | 128 |
| 224 | 3300025915 | Ga0207693_10553794 | Ga0207693_105537941 | 128 |
| 225 | 3300025916 | Ga0207663_10998413 | Ga0207663_109984131 | 128 |
| 226 | 3300025917 | Ga0207660_10343104 | Ga0207660_103431042 | 128 |
| 227 | 3300025918 | Ga0207662_10203903 | Ga0207662_102039032 | 128 |
| 228 | 3300025918 | Ga0207662_10407683 | Ga0207662_104076831 | 128 |
| 229 | 3300025918 | Ga0207662_11217346 | Ga0207662_112173461 | 128 |
| 230 | 3300025921 | Ga0207652_11129162 | Ga0207652_111291621 | 128 |
| 231 | 3300025922 | Ga0207646_10263972 | Ga0207646_102639722 | 128 |
| 232 | 3300025922 | Ga0207646_10404835 | Ga0207646_104048352 | 128 |
| 233 | 3300025922 | Ga0207646_10944643 | Ga0207646_109446432 | 128 |
| 234 | 3300025924 | Ga0207694_10387287 | Ga0207694_103872872 | 128 |
| 235 | 3300025925 | Ga0207650_10004372 | Ga0207650_1000437211 | 128 |
| 236 | 3300025925 | Ga0207650_10867204 | Ga0207650_108672042 | 128 |
| 237 | 3300025926 | Ga0207659_10147378 | Ga0207659_101473782 | 128 |
| 238 | 3300025926 | Ga0207659_10426668 | Ga0207659_104266683 | 128 |
| 239 | 3300025927 | Ga0207687_10474521 | Ga0207687_104745212 | 128 |
| 240 | 3300025927 | Ga0207687_11196214 | Ga0207687_111962141 | 128 |
| 241 | 3300025929 | Ga0207664_10454521 | Ga0207664_104545212 | 128 |
| 242 | 3300025929 | Ga0207664_10458772 | Ga0207664_104587722 | 128 |
| 243 | 3300025933 | Ga0207706_10158868 | Ga0207706_101588683 | 128 |
| 244 | 3300025933 | Ga0207706_10165553 | Ga0207706_101655535 | 128 |
| 245 | 3300025934 | Ga0207686_10053140 | Ga0207686_100531405 | 128 |
| 246 | 3300025934 | Ga0207686_10313366 | Ga0207686_103133662 | 128 |
| 247 | 3300025934 | Ga0207686_10548191 | Ga0207686_105481911 | 128 |
| 248 | 3300025935 | Ga0207709_10000384 | Ga0207709_100003847 | 128 |
| 249 | 3300025935 | Ga0207709_10229821 | Ga0207709_102298212 | 128 |
| 250 | 3300025936 | Ga0207670_10080414 | Ga0207670_100804142 | 128 |
| 251 | 3300025936 | Ga0207670_10146068 | Ga0207670_101460683 | 128 |
| 252 | 3300025937 | Ga0207669_10036771 | Ga0207669_100367712 | 128 |
| 253 | 3300025937 | Ga0207669_10438499 | Ga0207669_104384993 | 128 |
| 254 | 3300025938 | Ga0207704_10061725 | Ga0207704_100617256 | 128 |
| 255 | 3300025939 | Ga0207665_10031582 | Ga0207665_100315826 | 128 |
| 256 | 3300025940 | Ga0207691_10068187 | Ga0207691_100681873 | 128 |
| 257 | 3300025940 | Ga0207691_10115797 | Ga0207691_101157972 | 128 |
| 258 | 3300025940 | Ga0207691_10277660 | Ga0207691_102776602 | 128 |
| 259 | 3300025940 | Ga0207691_11203300 | Ga0207691_112033002 | 128 |
| 260 | 3300025941 | Ga0207711_10229694 | Ga0207711_102296942 | 128 |
| 261 | 3300025941 | Ga0207711_11167802 | Ga0207711_111678022 | 128 |
| 262 | 3300025942 | Ga0207689_10002806 | Ga0207689_1000280614 | 128 |
| 263 | 3300025942 | Ga0207689_10022817 | Ga0207689_100228171 | 128 |
| 264 | 3300025942 | Ga0207689_10871423 | Ga0207689_108714232 | 128 |
| 265 | 3300025944 | Ga0207661_11453807 | Ga0207661_114538071 | 128 |
| 266 | 3300025945 | Ga0207679_10143027 | Ga0207679_101430271 | 128 |
| 267 | 3300025945 | Ga0207679_11395070 | Ga0207679_113950701 | 128 |
| 268 | 3300025960 | Ga0207651_10919011 | Ga0207651_109190112 | 128 |
| 269 | 3300025960 | Ga0207651_11567362 | Ga0207651_115673621 | 128 |
| 270 | 3300025961 | Ga0207712_10444186 | Ga0207712_104441863 | 128 |
| 271 | 3300025961 | Ga0207712_11989349 | Ga0207712_119893491 | 128 |
| 272 | 3300025972 | Ga0207668_10134726 | Ga0207668_101347263 | 128 |
| 273 | 3300025981 | Ga0207640_10362779 | Ga0207640_103627793 | 128 |
| 274 | 3300025986 | Ga0207658_10575014 | Ga0207658_105750141 | 128 |
| 275 | 3300026023 | Ga0207677_10120283 | Ga0207677_101202832 | 128 |
| 276 | 3300026023 | Ga0207677_11395596 | Ga0207677_113955961 | 128 |
| 277 | 3300026035 | Ga0207703_10140223 | Ga0207703_101402232 | 128 |
| 278 | 3300026035 | Ga0207703_10386899 | Ga0207703_103868992 | 128 |
| 279 | 3300026035 | Ga0207703_10577649 | Ga0207703_105776491 | 128 |
| 280 | 3300026075 | Ga0207708_10018326 | Ga0207708_100183264 | 128 |
| 281 | 3300026075 | Ga0207708_11147446 | Ga0207708_111474462 | 128 |
| 282 | 3300026088 | Ga0207641_10143864 | Ga0207641_101438642 | 128 |
| 283 | 3300026088 | Ga0207641_11342098 | Ga0207641_113420982 | 128 |
| 284 | 3300026088 | Ga0207641_11548768 | Ga0207641_115487681 | 128 |
| 285 | 3300026089 | Ga0207648_10033310 | Ga0207648_1003331010 | 128 |
| 286 | 3300026089 | Ga0207648_10281588 | Ga0207648_102815883 | 128 |
| 287 | 3300026089 | Ga0207648_10600128 | Ga0207648_106001282 | 128 |
| 288 | 3300026095 | Ga0207676_10023208 | Ga0207676_100232089 | 128 |
| 289 | 3300026095 | Ga0207676_10652568 | Ga0207676_106525682 | 128 |
| 290 | 3300026116 | Ga0207674_10278575 | Ga0207674_102785752 | 128 |
| 291 | 3300026118 | Ga0207675_100059731 | Ga0207675_1000597317 | 128 |
| 292 | 3300026118 | Ga0207675_101150076 | Ga0207675_1011500762 | 128 |
| 293 | 3300026121 | Ga0207683_10034872 | Ga0207683_100348726 | 128 |
| 294 | 3300026121 | Ga0207683_10075628 | Ga0207683_100756281 | 128 |
| 295 | 3300026121 | Ga0207683_10208043 | Ga0207683_102080432 | 128 |
| 296 | 3300026142 | Ga0207698_10002020 | Ga0207698_100020201 | 128 |
| 297 | 3300026142 | Ga0207698_11143971 | Ga0207698_111439711 | 128 |
| 298 | 3300026142 | Ga0207698_12550896 | Ga0207698_125508961 | 128 |
| 299 | 3300027312 | Ga0209371_1000235 | Ga0209371_100023527 | 128 |
| 300 | 3300027907 | Ga0207428_10125573 | Ga0207428_101255733 | 128 |
| 301 | 3300028379 | Ga0268266_10002770 | Ga0268266_100027703 | 128 |
| 302 | 3300028379 | Ga0268266_10302602 | Ga0268266_103026022 | 128 |
| 303 | 3300028380 | Ga0268265_10171080 | Ga0268265_101710802 | 128 |
| 304 | 3300028380 | Ga0268265_10408164 | Ga0268265_104081642 | 128 |
| 305 | 3300028381 | Ga0268264_10547074 | Ga0268264_105470742 | 128 |
| 306 | 3300028381 | Ga0268264_10756768 | Ga0268264_107567681 | 128 |
| 307 | 3300028573 | Ga0265334_10072901 | Ga0265334_100729013 | 128 |
| 308 | 3300030500 | Ga0268256_1000196 | Ga0268256_100019636 | 128 |
| 309 | 3300031090 | Ga0265760_10020955 | Ga0265760_100209552 | 128 |
| 310 | 3300031238 | Ga0265332_10078422 | Ga0265332_100784222 | 128 |
| 311 | 3300031240 | Ga0265320_10087029 | Ga0265320_100870291 | 128 |
| 312 | 3300031250 | Ga0265331_10106009 | Ga0265331_101060093 | 128 |
| 313 | 3300031250 | Ga0265331_10185062 | Ga0265331_101850622 | 128 |
| 314 | 3300031456 | Ga0307513_10056883 | Ga0307513_100568835 | 128 |
| 315 | 3300031456 | Ga0307513_10094905 | Ga0307513_100949052 | 128 |
| 316 | 3300031548 | Ga0307408_100043021 | Ga0307408_1000430216 | 128 |
| 317 | 3300031548 | Ga0307408_102159753 | Ga0307408_1021597531 | 128 |
| 318 | 3300031616 | Ga0307508_10616201 | Ga0307508_106162011 | 128 |
| 319 | 3300031824 | Ga0307413_10242983 | Ga0307413_102429832 | 128 |
| 320 | 3300031903 | Ga0307407_10027913 | Ga0307407_100279132 | 128 |
| 321 | 3300031995 | Ga0307409_100433279 | Ga0307409_1004332792 | 128 |
| 322 | 3300032002 | Ga0307416_100038365 | Ga0307416_1000383652 | 128 |
| 323 | 3300032005 | Ga0307411_10116924 | Ga0307411_101169241 | 128 |
| 324 | 3300032126 | Ga0307415_100012888 | Ga0307415_1000128887 | 128 |
| 325 | 3300032133 | Ga0316583_10015352 | Ga0316583_100153523 | 128 |
| 326 | 3300035085 | Ga0373929_0018753 | Ga0373929_0018753_849_1235 | 128 |
| 327 | 3300035086 | Ga0373934_0097455 | Ga0373934_0097455_623_1009 | 128 |
| 328 | 3300035088 | Ga0373940_0144746 | Ga0373940_0144746_114_500 | 128 |
| 329 | 3300035089 | Ga0373944_0233874 | Ga0373944_0233874_232_618 | 128 |
| 330 | 3300035111 | Ga0373923_0678794 | Ga0373923_0678794_40_426 | 128 |
| 331 | 3300035113 | Ga0373936_0376962 | Ga0373936_0376962_22_408 | 128 |
| 332 | 3300035114 | Ga0373939_0114394 | Ga0373939_0114394_121_507 | 128 |
| 333 | 3300035117 | Ga0373953_0107254 | Ga0373953_0107254_330_716 | 128 |
| 334 | 3300035118 | Ga0373954_0112614 | Ga0373954_0112614_113_499 | 128 |
| 335 | 3300035120 | Ga0373957_0294327 | Ga0373957_0294327_52_438 | 128 |
| 336 | 3300035120 | Ga0373957_0313291 | Ga0373957_0313291_166_552 | 128 |
| 337 | 3300035170 | Ga0373943_0028572 | Ga0373943_0028572_1457_1843 | 128 |
| 338 | 3300035171 | Ga0373946_0650681 | Ga0373946_0650681_113_499 | 128 |
| 339 | 3300035172 | Ga0373955_0193986 | Ga0373955_0193986_449_835 | 128 |
| 340 | 3300035172 | Ga0373955_0445267 | Ga0373955_0445267_359_745 | 128 |
| 341 | 3300035695 | Ga0373927_0072579 | Ga0373927_0072579_1407_1793 | 128 |
| 342 | 3300035724 | Ga0373933_0104595 | Ga0373933_0104595_813_1199 | 128 |
| 343 | 3300036401 | Ga0373937_0022201 | Ga0373937_0022201_3771_4157 | 128 |
| 344 | 3300036401 | Ga0373937_0087289 | Ga0373937_0087289_1766_2152 | 128 |
| 345 | 3300036401 | Ga0373937_0548240 | Ga0373937_0548240_536_922 | 128 |
| 346 | 3300036401 | Ga0373937_0702157 | Ga0373937_0702157_130_516 | 128 |
| 347 | 3300037068 | Ga0373925_0108206 | Ga0373925_0108206_270_656 | 128 |
| 348 | 3300041456 | Ga0451795_0779968 | Ga0451795_0779968_354_740 | 128 |
| 349 | 3300041460 | Ga0451802_1076870 | Ga0451802_1076870_402_788 | 128 |
| 350 | 3300041486 | Ga0451807_2761694 | Ga0451807_2761694_110_496 | 128 |
| 351 | 3300041509 | Ga0451843_0878626 | Ga0451843_0878626_53_439 | 128 |
| 352 | 3300042133 | Ga0450896_039961 | Ga0450896_039961_263_649 | 128 |
| 353 | 3300042876 | Ga0451577_1376966 | Ga0451577_1376966_133_519 | 128 |
| 354 | 3300045051 | Ga0451576_0139834 | Ga0451576_0139834_1703_2089 | 128 |
| 355 | 3300046452 | Ga0495617_001438 | Ga0495617_001438_8975_9361 | 128 |
| 356 | 3300046454 | Ga0495592_0458152 | Ga0495592_0458152_282_668 | 128 |
| 357 | 3300046455 | Ga0495603_0313874 | Ga0495603_0313874_46_432 | 128 |
| 358 | 3300046455 | Ga0495603_0902032 | Ga0495603_0902032_54_440 | 128 |
| 359 | 3300046459 | Ga0495629_0000008 | Ga0495629_0000008_8090_8476 | 128 |
| 360 | 3300046460 | Ga0495638_0000007 | Ga0495638_0000007_309608_309994 | 128 |
| 361 | 3300046460 | Ga0495638_0349486 | Ga0495638_0349486_54_440 | 128 |
| 362 | 3300046461 | Ga0495641_0289871 | Ga0495641_0289871_188_574 | 128 |
| 363 | 3300046471 | Ga0495650_0000912 | Ga0495650_0000912_14693_15079 | 128 |
| 364 | 3300046472 | Ga0495580_0003075 | Ga0495580_0003075_13843_14229 | 128 |
| 365 | 3300046472 | Ga0495580_0022792 | Ga0495580_0022792_2651_3037 | 128 |
| 366 | 3300046472 | Ga0495580_0040899 | Ga0495580_0040899_601_987 | 128 |
| 367 | 3300046472 | Ga0495580_0043850 | Ga0495580_0043850_210_596 | 128 |
| 368 | 3300046473 | Ga0495582_0011566 | Ga0495582_0011566_1965_2351 | 128 |
| 369 | 3300046475 | Ga0495639_0014066 | Ga0495639_0014066_2209_2595 | 128 |
| 370 | 3300046477 | Ga0495664_0080660 | Ga0495664_0080660_195_581 | 128 |
| 371 | 3300046499 | Ga0495594_0034655 | Ga0495594_0034655_1594_1980 | 128 |
| 372 | 3300046507 | Ga0495606_0009282 | Ga0495606_0009282_548_934 | 128 |
| 373 | 3300046512 | Ga0495610_0001742 | Ga0495610_0001742_15883_16269 | 128 |
| 374 | 3300046512 | Ga0495610_0014431 | Ga0495610_0014431_4092_4478 | 128 |
| 375 | 3300046512 | Ga0495610_0358385 | Ga0495610_0358385_13_399 | 128 |
| 376 | 3300046514 | Ga0495618_0003758 | Ga0495618_0003758_8549_8935 | 128 |
| 377 | 3300046514 | Ga0495618_0061641 | Ga0495618_0061641_766_1152 | 128 |
| 378 | 3300046515 | Ga0495620_0017760 | Ga0495620_0017760_3063_3449 | 128 |
| 379 | 3300046516 | Ga0495628_0149176 | Ga0495628_0149176_1310_1696 | 128 |
| 380 | 3300046516 | Ga0495628_0459542 | Ga0495628_0459542_157_543 | 128 |
| 381 | 3300046517 | Ga0495630_0051811 | Ga0495630_0051811_2527_2913 | 128 |
| 382 | 3300046517 | Ga0495630_0361441 | Ga0495630_0361441_186_572 | 128 |
| 383 | 3300046518 | Ga0495631_0009252 | Ga0495631_0009252_4025_4411 | 128 |
| 384 | 3300046519 | Ga0495632_0025468 | Ga0495632_0025468_2001_2387 | 128 |
| 385 | 3300046519 | Ga0495632_0303073 | Ga0495632_0303073_25_411 | 128 |
| 386 | 3300046522 | Ga0495643_0000346 | Ga0495643_0000346_58012_58398 | 128 |
| 387 | 3300046524 | Ga0495648_0009496 | Ga0495648_0009496_86_472 | 128 |
| 388 | 3300046524 | Ga0495648_0020499 | Ga0495648_0020499_880_1266 | 128 |
| 389 | 3300046526 | Ga0495666_0072430 | Ga0495666_0072430_665_1051 | 128 |
| 390 | 3300046531 | Ga0495665_0204781 | Ga0495665_0204781_617_1003 | 128 |
| 391 | 3300046533 | Ga0495640_0040344 | Ga0495640_0040344_2280_2666 | 128 |
| 392 | 3300046533 | Ga0495640_0147206 | Ga0495640_0147206_919_1305 | 128 |
| 393 | 3300046535 | Ga0495586_0000802 | Ga0495586_0000802_10839_11225 | 128 |
| 394 | 3300046535 | Ga0495586_0015731 | Ga0495586_0015731_631_1017 | 128 |
| 395 | 3300046536 | Ga0495587_0497854 | Ga0495587_0497854_49_435 | 128 |
| 396 | 3300046537 | Ga0495598_0389375 | Ga0495598_0389375_88_474 | 128 |
| 397 | 3300046538 | Ga0495609_0004783 | Ga0495609_0004783_6553_6939 | 128 |
| 398 | 3300046539 | Ga0495621_0327354 | Ga0495621_0327354_177_563 | 128 |
| 399 | 3300046557 | Ga0495622_0356522 | Ga0495622_0356522_94_480 | 128 |
| 400 | 3300046559 | Ga0495667_0432197 | Ga0495667_0432197_17_403 | 128 |
| 401 | 3300046615 | Ga0495656_0336830 | Ga0495656_0336830_33_419 | 128 |
| 402 | 3300046616 | Ga0495668_0000093 | Ga0495668_0000093_130747_131133 | 128 |
| 403 | 3300046642 | Ga0495634_0032709 | Ga0495634_0032709_2616_3002 | 128 |
| 404 | 3300046648 | Ga0495611_0000008 | Ga0495611_0000008_41867_42253 | 128 |
| 405 | 3300046660 | Ga0495625_0144387 | Ga0495625_0144387_76_462 | 128 |
| 406 | 3300046663 | Ga0495635_0859786 | Ga0495635_0859786_172_558 | 128 |
| 407 | 3300046678 | Ga0495599_0644613 | Ga0495599_0644613_118_504 | 128 |
| 408 | 3300046681 | Ga0495647_0048950 | Ga0495647_0048950_665_1051 | 128 |
| 409 | 3300046683 | Ga0495658_0049611 | Ga0495658_0049611_1507_1893 | 128 |
| 410 | 3300046683 | Ga0495658_0309809 | Ga0495658_0309809_514_900 | 128 |
| 411 | 3300046694 | Ga0495649_0014911 | Ga0495649_0014911_2163_2549 | 128 |
| 412 | 3300047315 | Ga0495581_0265383 | Ga0495581_0265383_287_673 | 128 |
| 413 | 3300047315 | Ga0495581_0635929 | Ga0495581_0635929_143_529 | 128 |
| 414 | 3300047315 | Ga0495581_0792324 | Ga0495581_0792324_111_497 | 128 |
| 415 | 3300047317 | Ga0495604_0549170 | Ga0495604_0549170_244_630 | 128 |
| 416 | 3300047319 | Ga0495674_0138543 | Ga0495674_0138543_791_1177 | 128 |
| 417 | 3300047319 | Ga0495674_0145628 | Ga0495674_0145628_709_1095 | 128 |
| 418 | 3300047320 | Ga0495672_0000215 | Ga0495672_0000215_14080_14466 | 128 |
| 419 | 3300047321 | Ga0495676_0117618 | Ga0495676_0117618_72_458 | 128 |
| 420 | 3300047322 | Ga0495680_0023526 | Ga0495680_0023526_797_1183 | 128 |
| 421 | 3300047322 | Ga0495680_0466461 | Ga0495680_0466461_63_449 | 128 |
| 422 | 3300047323 | Ga0495683_0191937 | Ga0495683_0191937_492_878 | 128 |
| 423 | 3300047445 | Ga0495677_0143527 | Ga0495677_0143527_299_685 | 128 |
| 424 | 3300047469 | Ga0495673_0000030 | Ga0495673_0000030_300741_301127 | 128 |
| 425 | 3300047471 | Ga0495684_0085434 | Ga0495684_0085434_1064_1450 | 128 |
| 426 | 3300047471 | Ga0495684_0121470 | Ga0495684_0121470_85_471 | 128 |
| 427 | 3300047471 | Ga0495684_0147632 | Ga0495684_0147632_976_1362 | 128 |
| 428 | 3300047472 | Ga0495686_0000077 | Ga0495686_0000077_198158_198547 | 128 |
| 429 | 3300047472 | Ga0495686_0001944 | Ga0495686_0001944_8998_9384 | 128 |
| 430 | 3300048088 | Ga0495602_0423636 | Ga0495602_0423636_42_428 | 128 |
| 431 | 3300048088 | Ga0495602_0712976 | Ga0495602_0712976_65_451 | 128 |
| 432 | 3300048905 | Ga0496102_0318597 | Ga0496102_0318597_1027_1413 | 128 |
| 433 | 3300048907 | Ga0496104_0079377 | Ga0496104_0079377_1412_1798 | 128 |
| 434 | 3300048907 | Ga0496104_0207477 | Ga0496104_0207477_686_1072 | 128 |
| 435 | 3300048910 | Ga0496107_0313961 | Ga0496107_0313961_572_958 | 128 |
| 436 | 3300048913 | Ga0496110_0318364 | Ga0496110_0318364_1001_1387 | 128 |
| 437 | 3300048914 | Ga0496111_0090559 | Ga0496111_0090559_1816_2202 | 128 |
| 438 | 3300048921 | Ga0496118_0022321 | Ga0496118_0022321_3707_4093 | 128 |
| 439 | 3300048923 | Ga0496120_0000015 | Ga0496120_0000015_60010_60396 | 128 |
| 440 | 3300048924 | Ga0496121_0043517 | Ga0496121_0043517_1983_2369 | 128 |
| 441 | 3300048929 | Ga0496126_0006217 | Ga0496126_0006217_7738_8124 | 128 |
| 442 | 3300049459 | Ga0495678_000645 | Ga0495678_000645_3299_3685 | 128 |
| 443 | 3300049459 | Ga0495678_175128 | Ga0495678_175128_123_509 | 128 |
| 444 | 3300049568 | Ga0501031_0205231 | Ga0501031_0205231_70_456 | 128 |
| 445 | 3300049568 | Ga0501031_0794755 | Ga0501031_0794755_36_422 | 128 |
| 446 | 3300049572 | Ga0501036_0004752 | Ga0501036_0004752_1054_1440 | 128 |
| 447 | 3300049573 | Ga0501037_0037340 | Ga0501037_0037340_2613_2999 | 128 |
| 448 | 3300049574 | Ga0501038_0002784 | Ga0501038_0002784_4956_5342 | 128 |
| 449 | 3300049575 | Ga0501039_0054599 | Ga0501039_0054599_1038_1424 | 128 |
| 450 | 3300049576 | Ga0501040_0005087 | Ga0501040_0005087_5880_6266 | 128 |
| 451 | 3300049577 | Ga0501041_0003565 | Ga0501041_0003565_6847_7233 | 128 |
| 452 | 3300049578 | Ga0501042_0005091 | Ga0501042_0005091_1179_1565 | 128 |
| 453 | 3300049578 | Ga0501042_0088796 | Ga0501042_0088796_1347_1733 | 128 |
| 454 | 3300049579 | Ga0501043_0051201 | Ga0501043_0051201_835_1221 | 128 |
| 455 | 3300049580 | Ga0501046_0072302 | Ga0501046_0072302_1628_2014 | 128 |
| 456 | 3300049582 | Ga0501048_0019632 | Ga0501048_0019632_796_1182 | 128 |
| 457 | 3300049586 | Ga0501070_0433649 | Ga0501070_0433649_243_629 | 128 |
| 458 | 3300049587 | Ga0501071_0072836 | Ga0501071_0072836_1764_2150 | 128 |
| 459 | 3300049587 | Ga0501071_0560980 | Ga0501071_0560980_370_756 | 128 |
| 460 | 3300049588 | Ga0501072_0020219 | Ga0501072_0020219_377_763 | 128 |
| 461 | 3300049589 | Ga0501073_0190000 | Ga0501073_0190000_374_760 | 128 |
| 462 | 3300049590 | Ga0501074_0041690 | Ga0501074_0041690_2664_3050 | 128 |
| 463 | 3300049591 | Ga0501075_0002432 | Ga0501075_0002432_3883_4269 | 128 |
| 464 | 3300049591 | Ga0501075_1477883 | Ga0501075_1477883_68_454 | 128 |
| 465 | 3300049592 | Ga0501076_0005418 | Ga0501076_0005418_4749_5135 | 128 |
| 466 | 3300049593 | Ga0501077_0022657 | Ga0501077_0022657_756_1142 | 128 |
| 467 | 3300049675 | Ga0501243_040130 | Ga0501243_040130_402_788 | 128 |
| 468 | 3300049704 | Ga0501221_130047 | Ga0501221_130047_33_419 | 128 |
| 469 | 3300049742 | Ga0501080_0012374 | Ga0501080_0012374_707_1093 | 128 |
| 470 | 3300049743 | Ga0501081_0006637 | Ga0501081_0006637_899_1285 | 128 |
| 471 | 3300049743 | Ga0501081_0135205 | Ga0501081_0135205_157_543 | 128 |
| 472 | 3300049744 | Ga0501083_0036988 | Ga0501083_0036988_720_1106 | 128 |
| 473 | 3300049769 | Ga0501272_027864 | Ga0501272_027864_28_414 | 128 |
| 474 | 3300049822 | Ga0501035_0022819 | Ga0501035_0022819_4066_4452 | 128 |
| 475 | 3300049823 | Ga0501044_0666409 | Ga0501044_0666409_427_813 | 128 |
| 476 | 3300049824 | Ga0501045_0003227 | Ga0501045_0003227_6417_6803 | 128 |
| 477 | 3300049824 | Ga0501045_0232060 | Ga0501045_0232060_794_1180 | 128 |
| 478 | 3300049824 | Ga0501045_1230633 | Ga0501045_1230633_99_485 | 128 |
| 479 | 3300050507 | nmdc:mga05p37_19044_c2 | nmdc:mga05p37_19044_c2_4176_4562 | 128 |
| 480 | 3300050507 | nmdc:mga05p37_220747_c1 | nmdc:mga05p37_220747_c1_357_743 | 128 |
| 481 | 3300050507 | nmdc:mga05p37_75960_c1 | nmdc:mga05p37_75960_c1_357_743 | 128 |
| 482 | 3300050508 | nmdc:mga09592_125595_c1 | nmdc:mga09592_125595_c1_237_623 | 128 |
| 483 | 3300050508 | nmdc:mga09592_71206_c1 | nmdc:mga09592_71206_c1_1407_1793 | 128 |
| 484 | 3300050508 | nmdc:mga09592_89786_c1 | nmdc:mga09592_89786_c1_381_767 | 128 |
| 485 | 3300050509 | nmdc:mga0qj67_1575905_c1 | nmdc:mga0qj67_1575905_c1_59_445 | 128 |
| 486 | 3300050509 | nmdc:mga0qj67_232211_c1 | nmdc:mga0qj67_232211_c1_785_1171 | 128 |
| 487 | 3300050509 | nmdc:mga0qj67_38053_c1 | nmdc:mga0qj67_38053_c1_3126_3512 | 128 |
| 488 | 3300050510 | nmdc:mga06r32_17679_c1 | nmdc:mga06r32_17679_c1_4963_5349 | 128 |
| 489 | 3300050510 | nmdc:mga06r32_5368_c1 | nmdc:mga06r32_5368_c1_1787_2173 | 128 |
| 490 | 3300050510 | nmdc:mga06r32_722469_c1 | nmdc:mga06r32_722469_c1_241_627 | 128 |
| 491 | 3300050510 | nmdc:mga06r32_9997_c1 | nmdc:mga06r32_9997_c1_2601_2987 | 128 |
| 492 | 3300050511 | nmdc:mga08y16_1224728_c1 | nmdc:mga08y16_1224728_c1_255_641 | 128 |
| 493 | 3300050511 | nmdc:mga08y16_458222_c1 | nmdc:mga08y16_458222_c1_141_527 | 128 |
| 494 | 3300050511 | nmdc:mga08y16_532746_c1 | nmdc:mga08y16_532746_c1_75_461 | 128 |
| 495 | 3300050511 | nmdc:mga08y16_733578_c1 | nmdc:mga08y16_733578_c1_561_947 | 128 |
| 496 | 3300050512 | nmdc:mga0n895_339457_c1 | nmdc:mga0n895_339457_c1_324_710 | 128 |
| 497 | 3300050512 | nmdc:mga0n895_412980_c1 | nmdc:mga0n895_412980_c1_576_962 | 128 |
| 498 | 3300050515 | nmdc:mga0a205_50749_c1 | nmdc:mga0a205_50749_c1_2194_2580 | 128 |
| 499 | 3300050515 | nmdc:mga0a205_6975_c1 | nmdc:mga0a205_6975_c1_4101_4487 | 128 |
| 500 | 3300053084 | Ga0495595_0160614 | Ga0495595_0160614_391_777 | 128 |
| 501 | 3300053084 | Ga0495595_0369745 | Ga0495595_0369745_177_563 | 128 |
| 502 | 3300053085 | Ga0495619_0539439 | Ga0495619_0539439_294_680 | 128 |
| 503 | 3300053092 | Ga0500583_0168721 | Ga0500583_0168721_159_545 | 128 |
| 504 | 3300053094 | Ga0500566_0109284 | Ga0500566_0109284_171_557 | 128 |
| 505 | 3300053160 | Ga0500633_0000581 | Ga0500633_0000581_94_480 | 128 |
| 506 | 3300054114 | Ga0501084_0002853 | Ga0501084_0002853_9470_9856 | 128 |
| 507 | 3300060353 | Ga0501082_0034399 | Ga0501082_0034399_3607_3993 | 128 |
| 508 | 3300060353 | Ga0501082_0530113 | Ga0501082_0530113_110_496 | 128 |
| 509 | 3300061734 | Ga0530510_0006773 | Ga0530510_0006773_948_1334 | 128 |
| 510 | 3300003771 | Ga0055526_1005085 | Ga0055526_10050854 | 129 |
| 511 | 3300003790 | Ga0055528_1063016 | Ga0055528_10630161 | 129 |
| 512 | 3300004625 | Ga0055543_1004678 | Ga0055543_10046781 | 129 |
| 513 | 3300005262 | Ga0065165_1000675 | Ga0065165_10006751 | 129 |
| 514 | 3300025295 | Ga0209564_1000005 | Ga0209564_100000536 | 129 |
| 515 | 3300048926 | Ga0496123_0497240 | Ga0496123_0497240_96_485 | 129 |
| 516 | 3300053156 | Ga0500622_0014599 | Ga0500622_0014599_1517_1906 | 129 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3iuz-assembly1.cif.gz_A | crystal structure of putative glyoxalase superfamily protein (yp_299723.1) from ralstonia eutropha jmp134 at 1.90 a resolution | 0.8261 | 75 | 124 |
| 2i5x-assembly1.cif.gz_A | engineering the ptpbeta catalytic domain with improved crystallization properties | 0.7287 | 95 | 125 |
| 2i5x-assembly2.cif.gz_B | engineering the ptpbeta catalytic domain with improved crystallization properties | 0.7258 | 95 | 125 |
| 1yfo-assembly2.cif.gz_B | receptor protein tyrosine phosphatase alpha, domain 1 from mouse | 0.7218 | 95 | 127 |
| 1z47-assembly1.cif.gz_B-2 | structure of the atpase subunit cysa of the putative sulfate atp-binding cassette (abc) transporter from alicyclobacillus acidocaldarius | 0.7217 | 95 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8946 | 75 | 123 | 3.30.720.110 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8457 | 75 | 126 | 3.30.720.110 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8308 | 75 | 123 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.817 | 75 | 125 | 3.30.720.110 |
| 3bt3B02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7973 | 74 | 126 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5J4E851-F1-model_v4 | VOC domain-containing protein | 1.006 | 77 | 129 |
|
| AF-A0A7W8EAH5-F1-model_v4 | Putative enzyme related to lactoylglutathione lyase | 0.9751 | 77 | 129 |
GO:0016829
|
| AF-A0A7V9PWX8-F1-model_v4 | VOC family protein | 0.973 | 75 | 127 |
|
| AF-A0A136M9B9-F1-model_v4 | Glyoxalase | 0.9574 | 77 | 125 |
|
| AF-A0A5J4E851-F1-model_v4 | VOC domain-containing protein | 0.9516 | 77 | 129 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar