F457942

General Info

Members Datasets Scaffolds Average Seq Length
515 297 1030 216

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8056447290|8056448025
Length 227
Sequence HSTTPYPHRHTHSATPALRPNGKRRALRIGLGGPVGTGKTATVAALCRALRDDLSIAVVTNDIYTREDAEFLLRNAVLPPERITAVETGACPHTAIRDDISANLEAIEDLEETIEDPLDLILVESGGDNLTATFSKGLVDAQIFVIDVAGGDDIPRKGGPGITGADLLVVNKTDLAPYVGVDLDGMARDAKAQRGDLPVAFTSLAAEGGVAPVRDWVRERLAAWRRT

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
5 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
6 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
7 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
8 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
9 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
10 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
11 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
12 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
13 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
14 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
15 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
16 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
17 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
18 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
21 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
24 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
25 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
26 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
27 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
28 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
29 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
36 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
37 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
38 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
39 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
40 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
41 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
42 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
43 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
44 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
45 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
46 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
47 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
48 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
49 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
50 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
53 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
54 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
55 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
58 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
59 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
60 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
61 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
62 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
63 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
64 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
65 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
66 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
67 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
68 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
69 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
70 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
71 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
72 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
73 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
74 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
75 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
76 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
77 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
78 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
79 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
80 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
81 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
82 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
83 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
84 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
85 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
86 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
87 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
88 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
91 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
92 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
93 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
94 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
95 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
96 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
97 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
98 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
99 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
102 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
103 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
104 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
105 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
106 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
107 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
114 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
115 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
118 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
119 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
120 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
124 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
125 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
126 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
127 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
138 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
139 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
142 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
159 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
188 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
189 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
191 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
194 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
195 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
196 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
199 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
200 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
201 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
202 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
203 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
204 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
207 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
208 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
211 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
212 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
213 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
214 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
215 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
216 2643221548 Streptomyces sp. Root55 Isolate Unclassified
217 2643221578 Streptomyces sp. Root63 Isolate Unclassified
218 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
219 2643221647 Streptomyces sp. Root369 Isolate Unclassified
220 2643221670 Streptomyces sp. Root431 Isolate Unclassified
221 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
222 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
223 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
224 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
225 2643221714 Streptomyces sp. Root264 Isolate Unclassified
226 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
227 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
228 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
229 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
230 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
231 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
232 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
233 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
234 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
235 2808606448 Streptomyces sp. 193411 Isolate Unclassified
236 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
237 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
238 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
239 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
240 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
241 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
242 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
243 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
244 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
245 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
246 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
247 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
248 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
249 2867369537 Streptomyces sp. Z26 Isolate Unclassified
250 2867428634 Streptomyces sp. RP5T Isolate Unclassified
251 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
252 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
253 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
254 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
255 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
256 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
257 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
258 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
259 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
260 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
261 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
262 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
263 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
264 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
265 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
266 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
267 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
268 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
269 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
270 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
271 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
272 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
273 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
274 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
275 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
276 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
277 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
278 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
279 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
280 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
281 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
282 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
283 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
284 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
285 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
286 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
287 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
288 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
289 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
290 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
291 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
292 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
293 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
294 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
295 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
296 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
297 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.94
Metatranscriptomes 0
Isolates 18.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.38
Nodule 0.78
Rhizoplane 0.97
Rhizosphere 76.7
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10015792 3300003316 Bacteria 5059
2 rootH1_10017884 3300003323 Bacteria 1617
3 JGI25160J50197_1023502 3300003354 Bacteria 1775
4 Ga0070698_100483724 3300005471 Bacteria 1175
5 Ga0068853_100021448 3300005539 Bacteria 5387
6 Ga0068855_100702581 3300005563 Bacteria 1082
7 Ga0068854_100275655 3300005578 Bacteria 1352
8 Ga0070717_10121974 3300006028 Bacteria 2234
9 Ga0075365_10531278 3300006038 Bacteria 832
10 Ga0075368_10030301 3300006042 Bacteria 2095
11 Ga0075368_10091385 3300006042 Bacteria 1245
12 Ga0075367_10002769 3300006178 Bacteria 8121
13 Ga0075367_10250388 3300006178 Bacteria 1111
14 Ga0075428_100198836 3300006844 Bacteria 2167
15 Ga0075431_100317395 3300006847 Bacteria 1572
16 Ga0099826_10107844 3300006948 Bacteria 1665
17 Ga0105251_10032710 3300009011 Bacteria 2589
18 Ga0111539_10134527 3300009094 Bacteria 2895
19 Ga0114129_10839917 3300009147 Bacteria 1169
20 Ga0105243_10385705 3300009148 Bacteria 1297
21 Ga0105238_10441443 3300009551 Bacteria 1298
22 Ga0105249_10133022 3300009553 Bacteria 2376
23 Ga0105249_11062056 3300009553 Bacteria 879
24 Ga0105239_10498081 3300010375 Bacteria 1385
25 Ga0157372_10621895 3300013307 Bacteria 1258
26 Ga0163163_10260713 3300014325 Bacteria 1784
27 Ga0163163_11238844 3300014325 Bacteria 808
28 Ga0182008_10004158 3300014497 Bacteria 8522
29 Ga0182007_10000170 3300015262 Bacteria 44373
30 Ga0213875_10046099 3300021388 Bacteria 2046
31 Ga0209758_1061662 3300025297 Bacteria 1233
32 Ga0207426_1001773 3300025302 Bacteria 16274
33 Ga0207426_1006426 3300025302 Bacteria 5119
34 Ga0207426_1009114 3300025302 Bacteria 3947
35 Ga0207426_1030545 3300025302 Bacteria 1766
36 Ga0207647_10135380 3300025904 Bacteria 1446
37 Ga0207691_10266697 3300025940 Bacteria 1475
38 Ga0207667_10627116 3300025949 Bacteria 1082
39 Ga0207639_10080713 3300026041 Bacteria 2574
40 Ga0207648_10285425 3300026089 Bacteria 1477
41 Ga0207698_10346680 3300026142 Bacteria 1401
42 Ga0209282_1133189 3300027666 Bacteria 1225
43 Ga0209813_10015747 3300027866 Bacteria 2054
44 Ga0209813_10059501 3300027866 Bacteria 1216
45 Ga0207428_10023037 3300027907 Bacteria 5243
46 Ga0307515_10192933 3300028794 Bacteria 1940
47 Ga0307515_10239082 3300028794 Bacteria 1591
48 Ga0307511_10061093 3300030521 Bacteria 2875
49 Ga0307511_10128605 3300030521 Bacteria 1535
50 Ga0307511_10225733 3300030521 Bacteria 934
51 Ga0307512_10001761 3300030522 Bacteria 29532
52 Ga0307513_10061423 3300031456 Bacteria 3978
53 Ga0307513_10150192 3300031456 Bacteria 2240
54 Ga0307509_10158541 3300031507 Bacteria 2165
55 Ga0307509_10356665 3300031507 Bacteria 1183
56 Ga0307508_10004521 3300031616 Bacteria 13562
57 Ga0307508_10130283 3300031616 Bacteria 2118
58 Ga0307508_10153304 3300031616 Bacteria 1908
59 Ga0307508_10176053 3300031616 Bacteria 1742
60 Ga0307508_10284520 3300031616 Bacteria 1247
61 Ga0307514_10011710 3300031649 Bacteria 7297
62 Ga0307514_10024550 3300031649 Bacteria 4878
63 Ga0307514_10081189 3300031649 Bacteria 2397
64 Ga0316576_10040077 3300031727 Bacteria 3365
65 Ga0307516_10005037 3300031730 Bacteria 15985
66 Ga0307516_10024612 3300031730 Bacteria 6148
67 Ga0307518_10051856 3300031838 Bacteria 2981
68 Ga0307518_10082390 3300031838 Bacteria 2322
69 Ga0307518_10327498 3300031838 Bacteria 910
70 Ga0307406_10275108 3300031901 Bacteria 1281
71 Ga0307412_10420049 3300031911 Bacteria 1094
72 Ga0307409_100153986 3300031995 Bacteria 2000
73 Ga0307416_100180257 3300032002 Bacteria 1979
74 Ga0307416_100370978 3300032002 Bacteria 1457
75 Ga0307416_101003465 3300032002 Bacteria 938
76 Ga0307415_100110046 3300032126 Bacteria 2042
77 Ga0307507_10049890 3300033179 Bacteria 4049
78 Ga0307507_10127555 3300033179 Bacteria 2005
79 Ga0307510_10035467 3300033180 Bacteria 5570
80 Ga0307510_10092660 3300033180 Bacteria 2857
81 Ga0316574_0504358 3300035398 Bacteria 754
82 Ga0316584_0028120 3300036712 Bacteria 4143
83 Ga0395899_0139654 3300037312 Bacteria 1725
84 Ga0395900_0282223 3300037418 Bacteria 1652
85 Ga0395898_0022607 3300037466 Bacteria 6367
86 Ga0395898_0025985 3300037466 Bacteria 5897
87 Ga0395905_0104221 3300037471 Bacteria 2663
88 Ga0436364_0382334 3300037853 Bacteria 20372
89 Ga0395901_0152382 3300038443 Bacteria 2429
90 Ga0400483_026902 3300039062 Bacteria 6307
91 Ga0400483_054472 3300039062 Bacteria 4268
92 Ga0400483_160635 3300039062 Bacteria 9054
93 Ga0400483_221002 3300039062 Bacteria 3237
94 Ga0439436_0009381 3300041404 Bacteria 3001
95 Ga0439439_0008633 3300041406 Bacteria 2410
96 Ga0439439_0017753 3300041406 Bacteria 1753
97 Ga0439448_0018881 3300042005 Bacteria 2117
98 Ga0439448_0150477 3300042005 Bacteria 807
99 Ga0439432_089870 3300042006 Bacteria 925
100 Ga0439449_0029988 3300042007 Bacteria 2026
101 Ga0439449_0036872 3300042007 Bacteria 1818
102 Ga0439449_0042159 3300042007 Bacteria 1696
103 Ga0439450_003386 3300042008 Bacteria 2631
104 Ga0439457_000045 3300042014 Bacteria 26189
105 Ga0439462_0010022 3300042015 Bacteria 2399
106 Ga0450899_006088 3300042135 Bacteria 1302
107 Ga0450903_011316 3300042138 Bacteria 1438
108 Ga0466969_0024918 3300044656 Bacteria 3076
109 Ga0466969_0091316 3300044656 Bacteria 1443
110 Ga0466972_0019884 3300044658 Bacteria 3356
111 Ga0466972_0030870 3300044658 Bacteria 2637
112 Ga0466972_0082095 3300044658 Bacteria 1534
113 Ga0466965_0003378 3300044683 Bacteria 6990
114 Ga0466965_0057299 3300044683 Bacteria 1942
115 Ga0466965_0338267 3300044683 Bacteria 822
116 Ga0466966_0009933 3300044684 Bacteria 6312
117 Ga0466966_0011815 3300044684 Bacteria 5781
118 Ga0466966_0033502 3300044684 Bacteria 3326
119 Ga0466966_0432974 3300044684 Bacteria 791
120 Ga0466961_0001971 3300044693 Bacteria 12768
121 Ga0466961_0009678 3300044693 Bacteria 6136
122 Ga0466961_0017567 3300044693 Bacteria 4597
123 Ga0466961_0134343 3300044693 Bacteria 1550
124 Ga0466963_0003723 3300044694 Bacteria 8772
125 Ga0466963_0024995 3300044694 Bacteria 3805
126 Ga0466964_0021174 3300044706 Bacteria 2513
127 Ga0466971_0003547 3300044719 Bacteria 6668
128 Ga0466971_0069776 3300044719 Bacteria 1595
129 Ga0466970_0002926 3300044765 Bacteria 8272
130 Ga0466970_0023000 3300044765 Bacteria 3252
131 Ga0466957_0000722 3300044842 Bacteria 16962
132 Ga0466960_0067594 3300044901 Bacteria 1770
133 Ga0466960_0260171 3300044901 Bacteria 966
134 Ga0466959_0002455 3300045049 Bacteria 11855
135 Ga0466958_0003160 3300045836 Bacteria 8477
136 Ga0466967_0261016 3300045976 Bacteria 1657
137 Ga0466967_0261293 3300045976 Bacteria 1656
138 Ga0466967_0401189 3300045976 Bacteria 1334
139 Ga0495592_0004180 3300046454 Bacteria 10543
140 Ga0495592_0005849 3300046454 Bacteria 9126
141 Ga0495592_0025923 3300046454 Bacteria 4449
142 Ga0495603_0002979 3300046455 Bacteria 10013
143 Ga0495603_0003555 3300046455 Bacteria 9283
144 Ga0495603_0003799 3300046455 Bacteria 8990
145 Ga0495603_0004210 3300046455 Bacteria 8568
146 Ga0495603_0007390 3300046455 Bacteria 6605
147 Ga0495603_0008446 3300046455 Bacteria 6220
148 Ga0495603_0010592 3300046455 Bacteria 5586
149 Ga0495603_0073291 3300046455 Bacteria 2012
150 Ga0495629_0001593 3300046459 Bacteria 17857
151 Ga0495629_0005761 3300046459 Bacteria 9249
152 Ga0495629_0017005 3300046459 Bacteria 5218
153 Ga0495629_0035797 3300046459 Bacteria 3506
154 Ga0495629_0046892 3300046459 Bacteria 3030
155 Ga0495629_0149339 3300046459 Bacteria 1624
156 Ga0495629_0330503 3300046459 Bacteria 1041
157 Ga0495638_0036019 3300046460 Bacteria 3153
158 Ga0495651_0020472 3300046462 Bacteria 5136
159 Ga0495651_0052219 3300046462 Bacteria 3148
160 Ga0495651_0109610 3300046462 Bacteria 2043
161 Ga0495653_0042636 3300046463 Bacteria 3532
162 Ga0495653_0421638 3300046463 Bacteria 844
163 Ga0495580_0050096 3300046472 Bacteria 2953
164 Ga0495580_0164986 3300046472 Bacteria 1532
165 Ga0495582_0082298 3300046473 Bacteria 1788
166 Ga0495605_0003952 3300046474 Bacteria 8764
167 Ga0495605_0024083 3300046474 Bacteria 3190
168 Ga0495662_0002625 3300046476 Bacteria 9090
169 Ga0495662_0006669 3300046476 Bacteria 5755
170 Ga0495662_0024309 3300046476 Bacteria 2924
171 Ga0495662_0042425 3300046476 Bacteria 2196
172 Ga0495664_0000486 3300046477 Bacteria 19785
173 Ga0495664_0020182 3300046477 Bacteria 3840
174 Ga0495585_0005497 3300046492 Bacteria 7977
175 Ga0495585_0100426 3300046492 Bacteria 1548
176 Ga0495585_0185000 3300046492 Bacteria 1069
177 Ga0495594_0000609 3300046499 Bacteria 18428
178 Ga0495594_0009446 3300046499 Bacteria 5037
179 Ga0495594_0011759 3300046499 Bacteria 4549
180 Ga0495594_0041784 3300046499 Bacteria 2510
181 Ga0495594_0085991 3300046499 Bacteria 1759
182 Ga0495596_0034841 3300046500 Bacteria 1997
183 Ga0495607_0004564 3300046501 Bacteria 10155
184 Ga0495607_0075672 3300046501 Bacteria 1865
185 Ga0495607_0153057 3300046501 Bacteria 1178
186 Ga0495583_0006514 3300046506 Bacteria 7619
187 Ga0495583_0014086 3300046506 Bacteria 4425
188 Ga0495583_0031535 3300046506 Bacteria 2568
189 Ga0495606_0003562 3300046507 Bacteria 16425
190 Ga0495606_0027670 3300046507 Bacteria 4014
191 Ga0495608_0101246 3300046511 Bacteria 1857
192 Ga0495608_0192926 3300046511 Bacteria 1286
193 Ga0495610_0089660 3300046512 Bacteria 1396
194 Ga0495610_0158517 3300046512 Bacteria 959
195 Ga0495610_0163838 3300046512 Bacteria 938
196 Ga0495616_0003249 3300046513 Bacteria 10456
197 Ga0495616_0012509 3300046513 Bacteria 4816
198 Ga0495618_0369013 3300046514 Bacteria 882
199 Ga0495620_0001135 3300046515 Bacteria 16252
200 Ga0495620_0006434 3300046515 Bacteria 6453
201 Ga0495620_0008545 3300046515 Bacteria 5492
202 Ga0495628_0038989 3300046516 Bacteria 3801
203 Ga0495628_0067182 3300046516 Bacteria 2800
204 Ga0495628_0085741 3300046516 Bacteria 2443
205 Ga0495630_0008738 3300046517 Bacteria 7277
206 Ga0495630_0188536 3300046517 Bacteria 1573
207 Ga0495631_0131160 3300046518 Bacteria 1077
208 Ga0495643_0001890 3300046522 Bacteria 17722
209 Ga0495643_0009735 3300046522 Bacteria 5946
210 Ga0495643_0016179 3300046522 Bacteria 4387
211 Ga0495648_0039025 3300046524 Bacteria 3028
212 Ga0495648_0123131 3300046524 Bacteria 1390
213 Ga0495648_0199077 3300046524 Bacteria 1004
214 Ga0495666_0002297 3300046526 Bacteria 9525
215 Ga0495666_0002859 3300046526 Bacteria 8647
216 Ga0495666_0008066 3300046526 Bacteria 5280
217 Ga0495642_0175418 3300046528 Bacteria 932
218 Ga0495652_0026977 3300046529 Bacteria 5066
219 Ga0495652_0100376 3300046529 Bacteria 2348
220 Ga0495654_0196588 3300046530 Bacteria 865
221 Ga0495665_0006988 3300046531 Bacteria 6089
222 Ga0495640_0005298 3300046533 Bacteria 10251
223 Ga0495640_0009160 3300046533 Bacteria 7725
224 Ga0495586_0114735 3300046535 Bacteria 1501
225 Ga0495587_0395143 3300046536 Bacteria 768
226 Ga0495609_0008871 3300046538 Bacteria 4892
227 Ga0495597_0053229 3300046542 Bacteria 1780
228 Ga0495645_0179744 3300046543 Bacteria 1450
229 Ga0495645_0244783 3300046543 Bacteria 1194
230 Ga0495622_0001198 3300046557 Bacteria 13394
231 Ga0495622_0002356 3300046557 Bacteria 9192
232 Ga0495633_0032131 3300046558 Bacteria 2537
233 Ga0495633_0174475 3300046558 Bacteria 990
234 Ga0495667_0048781 3300046559 Bacteria 2795
235 Ga0495667_0105443 3300046559 Bacteria 1822
236 Ga0495667_0216128 3300046559 Bacteria 1224
237 Ga0495656_0187075 3300046615 Bacteria 1021
238 Ga0495668_0003772 3300046616 Bacteria 11107
239 Ga0495668_0013251 3300046616 Bacteria 4872
240 Ga0495668_0090915 3300046616 Bacteria 1672
241 Ga0495634_0001165 3300046642 Bacteria 24350
242 Ga0495634_0023194 3300046642 Bacteria 4364
243 Ga0495634_0325537 3300046642 Bacteria 924
244 Ga0495611_0025034 3300046648 Bacteria 2598
245 Ga0495611_0030769 3300046648 Bacteria 2361
246 Ga0495611_0045749 3300046648 Bacteria 1961
247 Ga0495611_0060384 3300046648 Bacteria 1722
248 Ga0495625_0002581 3300046660 Bacteria 19455
249 Ga0495625_0096389 3300046660 Bacteria 2038
250 Ga0495625_0110145 3300046660 Bacteria 1882
251 Ga0495625_0205404 3300046660 Bacteria 1297
252 Ga0495635_0009725 3300046663 Bacteria 6722
253 Ga0495635_0015759 3300046663 Bacteria 5279
254 Ga0495635_0036446 3300046663 Bacteria 3409
255 Ga0495635_0194247 3300046663 Bacteria 1377
256 Ga0495661_0111402 3300046665 Bacteria 1525
257 Ga0495661_0148504 3300046665 Bacteria 1268
258 Ga0495588_0007945 3300046674 Bacteria 4850
259 Ga0495588_0009903 3300046674 Bacteria 4417
260 Ga0495588_0075909 3300046674 Bacteria 1751
261 Ga0495657_0000283 3300046675 Bacteria 45961
262 Ga0495657_0005489 3300046675 Bacteria 10035
263 Ga0495599_0005798 3300046678 Bacteria 7413
264 Ga0495623_0154118 3300046679 Bacteria 1355
265 Ga0495646_0004288 3300046680 Bacteria 8981
266 Ga0495646_0005851 3300046680 Bacteria 7797
267 Ga0495646_0309984 3300046680 Bacteria 833
268 Ga0495613_0000322 3300046689 Bacteria 43462
269 Ga0495613_0004479 3300046689 Bacteria 10466
270 Ga0495613_0004945 3300046689 Bacteria 10011
271 Ga0495613_0005069 3300046689 Bacteria 9879
272 Ga0495613_0011896 3300046689 Bacteria 6467
273 Ga0495613_0029920 3300046689 Bacteria 4046
274 Ga0495613_0030724 3300046689 Bacteria 3990
275 Ga0495613_0086005 3300046689 Bacteria 2280
276 Ga0495613_0380783 3300046689 Bacteria 965
277 Ga0495670_0219176 3300046691 Bacteria 1010
278 Ga0495649_0009513 3300046694 Bacteria 5767
279 Ga0495589_0003974 3300046794 Bacteria 7933
280 Ga0495589_0018297 3300046794 Bacteria 3594
281 Ga0495589_0042516 3300046794 Bacteria 2264
282 Ga0495589_0046282 3300046794 Bacteria 2159
283 Ga0495589_0064069 3300046794 Bacteria 1802
284 Ga0495600_0016754 3300046809 Bacteria 4657
285 Ga0495600_0028337 3300046809 Bacteria 3623
286 Ga0495600_0156792 3300046809 Bacteria 1472
287 Ga0495600_0199480 3300046809 Bacteria 1285
288 Ga0495600_0219750 3300046809 Bacteria 1215
289 Ga0495660_0003011 3300046810 Bacteria 10509
290 Ga0495660_0026598 3300046810 Bacteria 3279
291 Ga0495581_0021372 3300047315 Bacteria 3752
292 Ga0495581_0044213 3300047315 Bacteria 2576
293 Ga0495581_0102917 3300047315 Bacteria 1659
294 Ga0495581_0109622 3300047315 Bacteria 1605
295 Ga0495581_0137157 3300047315 Bacteria 1426
296 Ga0495604_0000172 3300047317 Bacteria 57028
297 Ga0495604_0051763 3300047317 Bacteria 3181
298 Ga0495604_0105512 3300047317 Bacteria 2062
299 Ga0495604_0153072 3300047317 Bacteria 1636
300 Ga0495604_0190491 3300047317 Bacteria 1429
301 Ga0495604_0246857 3300047317 Bacteria 1218
302 Ga0495604_0372079 3300047317 Bacteria 945
303 Ga0495636_0000470 3300047318 Bacteria 14859
304 Ga0495636_0001798 3300047318 Bacteria 8186
305 Ga0495636_0009669 3300047318 Bacteria 3798
306 Ga0495636_0034012 3300047318 Bacteria 2097
307 Ga0495636_0068705 3300047318 Bacteria 1509
308 Ga0495674_0025869 3300047319 Bacteria 5372
309 Ga0495672_0101913 3300047320 Bacteria 1555
310 Ga0495676_0000850 3300047321 Bacteria 25574
311 Ga0495676_0001475 3300047321 Bacteria 20305
312 Ga0495676_0003408 3300047321 Bacteria 14379
313 Ga0495676_0005903 3300047321 Bacteria 11242
314 Ga0495676_0025998 3300047321 Bacteria 5044
315 Ga0495676_0041719 3300047321 Bacteria 3774
316 Ga0495676_0056993 3300047321 Bacteria 3085
317 Ga0495676_0090529 3300047321 Bacteria 2289
318 Ga0495680_0004931 3300047322 Bacteria 12629
319 Ga0495683_0002147 3300047323 Bacteria 12127
320 Ga0495687_001897 3300047443 Bacteria 18020
321 Ga0495687_003711 3300047443 Bacteria 10847
322 Ga0495687_008603 3300047443 Bacteria 5821
323 Ga0495687_013105 3300047443 Bacteria 4342
324 Ga0495687_013396 3300047443 Bacteria 4283
325 Ga0495687_015265 3300047443 Bacteria 3914
326 Ga0495687_019087 3300047443 Bacteria 3373
327 Ga0495687_044772 3300047443 Bacteria 1920
328 Ga0495687_118715 3300047443 Bacteria 958
329 Ga0495675_0131818 3300047444 Bacteria 1553
330 Ga0495675_0216547 3300047444 Bacteria 1160
331 Ga0495685_000407 3300047447 Bacteria 13643
332 Ga0495685_006759 3300047447 Bacteria 3770
333 Ga0495685_010084 3300047447 Bacteria 3165
334 Ga0495685_036458 3300047447 Bacteria 1688
335 Ga0495685_038903 3300047447 Bacteria 1628
336 Ga0495685_060448 3300047447 Bacteria 1277
337 Ga0495685_116931 3300047447 Bacteria 876
338 Ga0495681_0001066 3300047470 Bacteria 20908
339 Ga0495681_0090910 3300047470 Bacteria 1348
340 Ga0495681_0192824 3300047470 Bacteria 830
341 Ga0495684_0011063 3300047471 Bacteria 6975
342 Ga0495684_0136870 3300047471 Bacteria 1838
343 Ga0495686_0016150 3300047472 Bacteria 5072
344 Ga0495686_0071797 3300047472 Bacteria 2130
345 Ga0495686_0105515 3300047472 Bacteria 1695
346 Ga0495686_0136876 3300047472 Bacteria 1448
347 Ga0495593_0001501 3300047673 Bacteria 13711
348 Ga0495593_0010936 3300047673 Bacteria 5227
349 Ga0495593_0085549 3300047673 Bacteria 1627
350 Ga0495593_0365610 3300047673 Bacteria 721
351 Ga0495602_0023757 3300048088 Bacteria 5964
352 Ga0495602_0043947 3300048088 Bacteria 4056
353 Ga0495602_0240932 3300048088 Bacteria 1353
354 Ga0495614_0000481 3300048089 Bacteria 16422
355 Ga0495614_0001310 3300048089 Bacteria 10727
356 Ga0495614_0020901 3300048089 Bacteria 2828
357 Ga0495614_0100518 3300048089 Bacteria 1263
358 Ga0495626_0069049 3300048091 Bacteria 1592
359 Ga0496108_0307957 3300048911 Bacteria 1380
360 Ga0496109_0037858 3300048912 Bacteria 4359
361 Ga0496110_0636317 3300048913 Bacteria 966
362 Ga0496113_0560858 3300048916 Bacteria 916
363 Ga0496124_0159225 3300048927 Bacteria 1762
364 Ga0496124_0163157 3300048927 Bacteria 1735
365 Ga0495678_045700 3300049459 Bacteria 1726
366 Ga0495678_048650 3300049459 Bacteria 1652
367 Ga0501031_0243355 3300049568 Bacteria 1169
368 Ga0501032_0230838 3300049569 Bacteria 1203
369 Ga0501033_0018127 3300049570 Bacteria 5319
370 Ga0501034_0047139 3300049571 Bacteria 4353
371 Ga0501034_0602773 3300049571 Bacteria 1004
372 Ga0501038_0013546 3300049574 Bacteria 7432
373 Ga0501038_0409182 3300049574 Bacteria 1048
374 Ga0501042_0452505 3300049578 Bacteria 931
375 Ga0501042_0551377 3300049578 Bacteria 838
376 Ga0501047_0000065 3300049581 Bacteria 132939
377 Ga0501047_0061438 3300049581 Bacteria 3625
378 Ga0501047_0125902 3300049581 Bacteria 2442
379 Ga0501047_0157190 3300049581 Bacteria 2147
380 Ga0501072_0358364 3300049588 Bacteria 1158
381 Ga0501075_0257320 3300049591 Bacteria 1330
382 Ga0501080_0452108 3300049742 Bacteria 1151
383 Ga0501035_0054325 3300049822 Bacteria 3579
384 Ga0501035_0064947 3300049822 Bacteria 3243
385 Ga0501035_0216417 3300049822 Bacteria 1637
386 Ga0501044_0299743 3300049823 Bacteria 1536
387 Ga0501044_0452228 3300049823 Bacteria 1191
388 Ga0501044_0677646 3300049823 Bacteria 918
389 nmdc:mga03n38_292178_c1 3300050490 Bacteria 873
390 nmdc:mga06z11_712_c1 3300050494 Bacteria 12110
391 nmdc:mga04h51_59670_c1 3300050495 Bacteria 1304
392 nmdc:mga04h51_67261_c1 3300050495 Bacteria 1243
393 nmdc:mga08y16_27882_c1 3300050511 Bacteria 5954
394 Ga0495601_0021479 3300053077 Bacteria 3954
395 Ga0495612_0004620 3300053078 Bacteria 5704
396 Ga0495612_0067454 3300053078 Bacteria 1488
397 Ga0500610_0252765 3300053079 Bacteria 811
398 Ga0495655_0005570 3300053083 Bacteria 2234
399 Ga0495655_0054390 3300053083 Bacteria 1071
400 Ga0495619_0004063 3300053085 Bacteria 9372
401 Ga0500578_0030062 3300053086 Bacteria 3489
402 Ga0500583_0300418 3300053092 Bacteria 786
403 Ga0500566_0165085 3300053094 Bacteria 1150
404 Ga0500654_078030 3300053099 Bacteria 1564
405 Ga0500553_069639 3300053101 Bacteria 1620
406 Ga0500556_0000149 3300053104 Bacteria 57972
407 Ga0500572_004316 3300053111 Bacteria 3229
408 Ga0500614_007726 3300053123 Bacteria 2271
409 Ga0500658_0131033 3300053134 Bacteria 1118
410 Ga0500561_0080805 3300053137 Bacteria 946
411 Ga0500573_0091105 3300053140 Bacteria 1722
412 Ga0500573_0211152 3300053140 Bacteria 1024
413 Ga0500577_0081595 3300053142 Bacteria 1291
414 Ga0500600_0013694 3300053149 Bacteria 4928
415 Ga0500600_0119479 3300053149 Bacteria 1361
416 Ga0500616_0001810 3300053153 Bacteria 19427
417 Ga0500616_0083591 3300053153 Bacteria 1598
418 Ga0500633_0159031 3300053160 Bacteria 847
419 Ga0500634_0096521 3300053161 Bacteria 1488
420 Ga0500656_009083 3300053732 Bacteria 1064
421 Ga0466962_0001950 3300061719 Bacteria 9729
422 Ga0466962_0049910 3300061719 Bacteria 2000
423 8056448025 8056447290 Bacteria 7680491
424 2547409094 2547132111 Bacteria 8013147
425 2585309685 2582581313 Bacteria 10042643
426 2585315911 2582581314 Bacteria 11452267
427 2585319033 2582581314 Bacteria 11452267
428 2616693036 2616644814 Bacteria 11555299
429 2616902008 2616644941 Bacteria 8510691
430 2643764417 2643221548 Bacteria 8053412
431 2643905092 2643221578 Bacteria 9213798
432 2643942574 2643221587 Bacteria 7586415
433 2644264285 2643221647 Bacteria 10741251
434 2644386061 2643221670 Bacteria 6497041
435 2644403150 2643221673 Bacteria 9196637
436 2644430033 2643221677 Bacteria 7584031
437 2644438308 2643221678 Bacteria 9540101
438 2644458524 2643221682 Bacteria 6743283
439 2644630063 2643221714 Bacteria 9015452
440 2768645008 2767802112 Bacteria 6465194
441 2784586490 2784132148 Bacteria 8627943
442 2785346021 2784746763 Bacteria 9783172
443 2785366886 2784746768 Bacteria 10036182
444 2786667923 2786546132 Bacteria 10419719
445 2793981089 2791355406 Bacteria 11364898
446 2804843497 2802429296 Bacteria 7227771
447 2808847387 2808606359 Bacteria 9866990
448 2808918109 2808606375 Bacteria 9466072
449 2809230002 2808606448 Bacteria 8656184
450 2811846735 2808606982 Bacteria 7791042
451 2812360581 2811994879 Bacteria 9313447
452 2812482647 2811994917 Bacteria 7761064
453 2819699305 2818991463 Bacteria 7948711
454 2852641405 2852635781 Bacteria 8251373
455 2862181307 2862178590 Bacteria 8583590
456 2862289985 2862281513 Bacteria 9621493
457 2862296522 2862290372 Bacteria 7471434
458 2862392063 2862382967 Bacteria 10317375
459 2862515553 2862507626 Bacteria 9425308
460 2862709194 2862705112 Bacteria 6563286
461 2863407287 2863404153 Bacteria 9672205
462 2867352627 2867346516 Bacteria 7608576
463 2867375009 2867369537 Bacteria 6501581
464 2867432569 2867428634 Bacteria 9590268
465 2873158216 2873151551 Bacteria 8625867
466 2873158657 2873151551 Bacteria 8625867
467 2875392468 2875391855 Bacteria 7600475
468 2877683671 2877676314 Bacteria 9512378
469 2895451249 2895442618 Bacteria 11027144
470 2912722941 2912715099 Bacteria 9460473
471 2912758522 2912757875 Bacteria 7940295
472 2918502266 2918501144 Bacteria 8668083
473 2919474344 2919468124 Bacteria 9133025
474 2935394062 2935390628 Bacteria 7043367
475 2946047113 2946045630 Bacteria 8527308
476 2946052278 2946045630 Bacteria 8527308
477 2946065302 2946064051 Bacteria 8957905
478 2946073673 2946072368 Bacteria 8999607
479 2947232142 2947224130 Bacteria 9938529
480 2947232909 2947224130 Bacteria 9938529
481 2954008736 2954002825 Bacteria 9173742
482 2954388969 2954380949 Bacteria 10050426
483 2954674207 2954673503 Bacteria 9685905
484 2954689925 2954682443 Bacteria 9862841
485 2954699709 2954691527 Bacteria 10720516
486 2954702490 2954701450 Bacteria 10834262
487 2954718648 2954711539 Bacteria 10867210
488 2954728619 2954721474 Bacteria 10456478
489 2954733193 2954731030 Bacteria 10243860
490 2954747515 2954740390 Bacteria 10229294
491 2954752073 2954749733 Bacteria 10366972
492 2954766631 2954759201 Bacteria 9358192
493 2966604685 2966598605 Bacteria 7676064
494 2990064733 2990059506 Bacteria 9321252
495 2995466523 2995463766 Bacteria 8577691
496 2997452757 2997451912 Bacteria 8492419
497 2997457521 2997451912 Bacteria 8492419
498 3006396365 3006393351 Bacteria 6615579
499 3006497117 3006493962 Bacteria 8825450
500 8008488520 8008485437 Bacteria 7198341
501 8008560969 8008558824 Bacteria 10610750
502 8008581044 8008574985 Bacteria 7815457
503 8023628654 8023623736 Bacteria 8593882
504 8025418651 8025413630 Bacteria 7014048
505 8025527433 8025524527 Bacteria 7197316
506 8025535075 8025530807 Bacteria 8495698
507 8047894455 8047893842 Bacteria 11723082
508 8048134790 8048127548 Bacteria 11053136
509 8048364597 8048356638 Bacteria 11044339
510 8048371472 8048369669 Bacteria 11666822
511 8048380273 8048379754 Bacteria 11877923
512 8048411478 8048406513 Bacteria 8936924
513 8054164245 8054160619 Bacteria 7783213
514 8056672316 8056667051 Bacteria 6953971
515 8056832592 8056829672 Bacteria 9045328
516 rootH1_10015792
517 rootH1_10017884
518 JGI25160J50197_1023502
519 Ga0070698_100483724
520 Ga0068853_100021448
521 Ga0068855_100702581
522 Ga0068854_100275655
523 Ga0070717_10121974
524 Ga0075365_10531278
525 Ga0075368_10030301
526 Ga0075368_10091385
527 Ga0075367_10002769
528 Ga0075367_10250388
529 Ga0075428_100198836
530 Ga0075431_100317395
531 Ga0099826_10107844
532 Ga0105251_10032710
533 Ga0111539_10134527
534 Ga0114129_10839917
535 Ga0105243_10385705
536 Ga0105238_10441443
537 Ga0105249_10133022
538 Ga0105249_11062056
539 Ga0105239_10498081
540 Ga0157372_10621895
541 Ga0163163_10260713
542 Ga0163163_11238844
543 Ga0182008_10004158
544 Ga0182007_10000170
545 Ga0213875_10046099
546 Ga0209758_1061662
547 Ga0207426_1001773
548 Ga0207426_1006426
549 Ga0207426_1009114
550 Ga0207426_1030545
551 Ga0207647_10135380
552 Ga0207691_10266697
553 Ga0207667_10627116
554 Ga0207639_10080713
555 Ga0207648_10285425
556 Ga0207698_10346680
557 Ga0209282_1133189
558 Ga0209813_10015747
559 Ga0209813_10059501
560 Ga0207428_10023037
561 Ga0307515_10192933
562 Ga0307515_10239082
563 Ga0307511_10061093
564 Ga0307511_10128605
565 Ga0307511_10225733
566 Ga0307512_10001761
567 Ga0307513_10061423
568 Ga0307513_10150192
569 Ga0307509_10158541
570 Ga0307509_10356665
571 Ga0307508_10004521
572 Ga0307508_10130283
573 Ga0307508_10153304
574 Ga0307508_10176053
575 Ga0307508_10284520
576 Ga0307514_10011710
577 Ga0307514_10024550
578 Ga0307514_10081189
579 Ga0316576_10040077
580 Ga0307516_10005037
581 Ga0307516_10024612
582 Ga0307518_10051856
583 Ga0307518_10082390
584 Ga0307518_10327498
585 Ga0307406_10275108
586 Ga0307412_10420049
587 Ga0307409_100153986
588 Ga0307416_100180257
589 Ga0307416_100370978
590 Ga0307416_101003465
591 Ga0307415_100110046
592 Ga0307507_10049890
593 Ga0307507_10127555
594 Ga0307510_10035467
595 Ga0307510_10092660
596 Ga0316574_0504358
597 Ga0316584_0028120
598 Ga0395899_0139654
599 Ga0395900_0282223
600 Ga0395898_0022607
601 Ga0395898_0025985
602 Ga0395905_0104221
603 Ga0436364_0382334
604 Ga0395901_0152382
605 Ga0400483_026902
606 Ga0400483_054472
607 Ga0400483_160635
608 Ga0400483_221002
609 Ga0439436_0009381
610 Ga0439439_0008633
611 Ga0439439_0017753
612 Ga0439448_0018881
613 Ga0439448_0150477
614 Ga0439432_089870
615 Ga0439449_0029988
616 Ga0439449_0036872
617 Ga0439449_0042159
618 Ga0439450_003386
619 Ga0439457_000045
620 Ga0439462_0010022
621 Ga0450899_006088
622 Ga0450903_011316
623 Ga0466969_0024918
624 Ga0466969_0091316
625 Ga0466972_0019884
626 Ga0466972_0030870
627 Ga0466972_0082095
628 Ga0466965_0003378
629 Ga0466965_0057299
630 Ga0466965_0338267
631 Ga0466966_0009933
632 Ga0466966_0011815
633 Ga0466966_0033502
634 Ga0466966_0432974
635 Ga0466961_0001971
636 Ga0466961_0009678
637 Ga0466961_0017567
638 Ga0466961_0134343
639 Ga0466963_0003723
640 Ga0466963_0024995
641 Ga0466964_0021174
642 Ga0466971_0003547
643 Ga0466971_0069776
644 Ga0466970_0002926
645 Ga0466970_0023000
646 Ga0466957_0000722
647 Ga0466960_0067594
648 Ga0466960_0260171
649 Ga0466959_0002455
650 Ga0466958_0003160
651 Ga0466967_0261016
652 Ga0466967_0261293
653 Ga0466967_0401189
654 Ga0495592_0004180
655 Ga0495592_0005849
656 Ga0495592_0025923
657 Ga0495603_0002979
658 Ga0495603_0003555
659 Ga0495603_0003799
660 Ga0495603_0004210
661 Ga0495603_0007390
662 Ga0495603_0008446
663 Ga0495603_0010592
664 Ga0495603_0073291
665 Ga0495629_0001593
666 Ga0495629_0005761
667 Ga0495629_0017005
668 Ga0495629_0035797
669 Ga0495629_0046892
670 Ga0495629_0149339
671 Ga0495629_0330503
672 Ga0495638_0036019
673 Ga0495651_0020472
674 Ga0495651_0052219
675 Ga0495651_0109610
676 Ga0495653_0042636
677 Ga0495653_0421638
678 Ga0495580_0050096
679 Ga0495580_0164986
680 Ga0495582_0082298
681 Ga0495605_0003952
682 Ga0495605_0024083
683 Ga0495662_0002625
684 Ga0495662_0006669
685 Ga0495662_0024309
686 Ga0495662_0042425
687 Ga0495664_0000486
688 Ga0495664_0020182
689 Ga0495585_0005497
690 Ga0495585_0100426
691 Ga0495585_0185000
692 Ga0495594_0000609
693 Ga0495594_0009446
694 Ga0495594_0011759
695 Ga0495594_0041784
696 Ga0495594_0085991
697 Ga0495596_0034841
698 Ga0495607_0004564
699 Ga0495607_0075672
700 Ga0495607_0153057
701 Ga0495583_0006514
702 Ga0495583_0014086
703 Ga0495583_0031535
704 Ga0495606_0003562
705 Ga0495606_0027670
706 Ga0495608_0101246
707 Ga0495608_0192926
708 Ga0495610_0089660
709 Ga0495610_0158517
710 Ga0495610_0163838
711 Ga0495616_0003249
712 Ga0495616_0012509
713 Ga0495618_0369013
714 Ga0495620_0001135
715 Ga0495620_0006434
716 Ga0495620_0008545
717 Ga0495628_0038989
718 Ga0495628_0067182
719 Ga0495628_0085741
720 Ga0495630_0008738
721 Ga0495630_0188536
722 Ga0495631_0131160
723 Ga0495643_0001890
724 Ga0495643_0009735
725 Ga0495643_0016179
726 Ga0495648_0039025
727 Ga0495648_0123131
728 Ga0495648_0199077
729 Ga0495666_0002297
730 Ga0495666_0002859
731 Ga0495666_0008066
732 Ga0495642_0175418
733 Ga0495652_0026977
734 Ga0495652_0100376
735 Ga0495654_0196588
736 Ga0495665_0006988
737 Ga0495640_0005298
738 Ga0495640_0009160
739 Ga0495586_0114735
740 Ga0495587_0395143
741 Ga0495609_0008871
742 Ga0495597_0053229
743 Ga0495645_0179744
744 Ga0495645_0244783
745 Ga0495622_0001198
746 Ga0495622_0002356
747 Ga0495633_0032131
748 Ga0495633_0174475
749 Ga0495667_0048781
750 Ga0495667_0105443
751 Ga0495667_0216128
752 Ga0495656_0187075
753 Ga0495668_0003772
754 Ga0495668_0013251
755 Ga0495668_0090915
756 Ga0495634_0001165
757 Ga0495634_0023194
758 Ga0495634_0325537
759 Ga0495611_0025034
760 Ga0495611_0030769
761 Ga0495611_0045749
762 Ga0495611_0060384
763 Ga0495625_0002581
764 Ga0495625_0096389
765 Ga0495625_0110145
766 Ga0495625_0205404
767 Ga0495635_0009725
768 Ga0495635_0015759
769 Ga0495635_0036446
770 Ga0495635_0194247
771 Ga0495661_0111402
772 Ga0495661_0148504
773 Ga0495588_0007945
774 Ga0495588_0009903
775 Ga0495588_0075909
776 Ga0495657_0000283
777 Ga0495657_0005489
778 Ga0495599_0005798
779 Ga0495623_0154118
780 Ga0495646_0004288
781 Ga0495646_0005851
782 Ga0495646_0309984
783 Ga0495613_0000322
784 Ga0495613_0004479
785 Ga0495613_0004945
786 Ga0495613_0005069
787 Ga0495613_0011896
788 Ga0495613_0029920
789 Ga0495613_0030724
790 Ga0495613_0086005
791 Ga0495613_0380783
792 Ga0495670_0219176
793 Ga0495649_0009513
794 Ga0495589_0003974
795 Ga0495589_0018297
796 Ga0495589_0042516
797 Ga0495589_0046282
798 Ga0495589_0064069
799 Ga0495600_0016754
800 Ga0495600_0028337
801 Ga0495600_0156792
802 Ga0495600_0199480
803 Ga0495600_0219750
804 Ga0495660_0003011
805 Ga0495660_0026598
806 Ga0495581_0021372
807 Ga0495581_0044213
808 Ga0495581_0102917
809 Ga0495581_0109622
810 Ga0495581_0137157
811 Ga0495604_0000172
812 Ga0495604_0051763
813 Ga0495604_0105512
814 Ga0495604_0153072
815 Ga0495604_0190491
816 Ga0495604_0246857
817 Ga0495604_0372079
818 Ga0495636_0000470
819 Ga0495636_0001798
820 Ga0495636_0009669
821 Ga0495636_0034012
822 Ga0495636_0068705
823 Ga0495674_0025869
824 Ga0495672_0101913
825 Ga0495676_0000850
826 Ga0495676_0001475
827 Ga0495676_0003408
828 Ga0495676_0005903
829 Ga0495676_0025998
830 Ga0495676_0041719
831 Ga0495676_0056993
832 Ga0495676_0090529
833 Ga0495680_0004931
834 Ga0495683_0002147
835 Ga0495687_001897
836 Ga0495687_003711
837 Ga0495687_008603
838 Ga0495687_013105
839 Ga0495687_013396
840 Ga0495687_015265
841 Ga0495687_019087
842 Ga0495687_044772
843 Ga0495687_118715
844 Ga0495675_0131818
845 Ga0495675_0216547
846 Ga0495685_000407
847 Ga0495685_006759
848 Ga0495685_010084
849 Ga0495685_036458
850 Ga0495685_038903
851 Ga0495685_060448
852 Ga0495685_116931
853 Ga0495681_0001066
854 Ga0495681_0090910
855 Ga0495681_0192824
856 Ga0495684_0011063
857 Ga0495684_0136870
858 Ga0495686_0016150
859 Ga0495686_0071797
860 Ga0495686_0105515
861 Ga0495686_0136876
862 Ga0495593_0001501
863 Ga0495593_0010936
864 Ga0495593_0085549
865 Ga0495593_0365610
866 Ga0495602_0023757
867 Ga0495602_0043947
868 Ga0495602_0240932
869 Ga0495614_0000481
870 Ga0495614_0001310
871 Ga0495614_0020901
872 Ga0495614_0100518
873 Ga0495626_0069049
874 Ga0496108_0307957
875 Ga0496109_0037858
876 Ga0496110_0636317
877 Ga0496113_0560858
878 Ga0496124_0159225
879 Ga0496124_0163157
880 Ga0495678_045700
881 Ga0495678_048650
882 Ga0501031_0243355
883 Ga0501032_0230838
884 Ga0501033_0018127
885 Ga0501034_0047139
886 Ga0501034_0602773
887 Ga0501038_0013546
888 Ga0501038_0409182
889 Ga0501042_0452505
890 Ga0501042_0551377
891 Ga0501047_0000065
892 Ga0501047_0061438
893 Ga0501047_0125902
894 Ga0501047_0157190
895 Ga0501072_0358364
896 Ga0501075_0257320
897 Ga0501080_0452108
898 Ga0501035_0054325
899 Ga0501035_0064947
900 Ga0501035_0216417
901 Ga0501044_0299743
902 Ga0501044_0452228
903 Ga0501044_0677646
904 nmdc:mga03n38_292178_c1
905 nmdc:mga06z11_712_c1
906 nmdc:mga04h51_59670_c1
907 nmdc:mga04h51_67261_c1
908 nmdc:mga08y16_27882_c1
909 Ga0495601_0021479
910 Ga0495612_0004620
911 Ga0495612_0067454
912 Ga0500610_0252765
913 Ga0495655_0005570
914 Ga0495655_0054390
915 Ga0495619_0004063
916 Ga0500578_0030062
917 Ga0500583_0300418
918 Ga0500566_0165085
919 Ga0500654_078030
920 Ga0500553_069639
921 Ga0500556_0000149
922 Ga0500572_004316
923 Ga0500614_007726
924 Ga0500658_0131033
925 Ga0500561_0080805
926 Ga0500573_0091105
927 Ga0500573_0211152
928 Ga0500577_0081595
929 Ga0500600_0013694
930 Ga0500600_0119479
931 Ga0500616_0001810
932 Ga0500616_0083591
933 Ga0500633_0159031
934 Ga0500634_0096521
935 Ga0500656_009083
936 Ga0466962_0001950
937 Ga0466962_0049910
938 8056448025
939 2547409094
940 2585309685
941 2585315911
942 2585319033
943 2616693036
944 2616902008
945 2643764417
946 2643905092
947 2643942574
948 2644264285
949 2644386061
950 2644403150
951 2644430033
952 2644438308
953 2644458524
954 2644630063
955 2768645008
956 2784586490
957 2785346021
958 2785366886
959 2786667923
960 2793981089
961 2804843497
962 2808847387
963 2808918109
964 2809230002
965 2811846735
966 2812360581
967 2812482647
968 2819699305
969 2852641405
970 2862181307
971 2862289985
972 2862296522
973 2862392063
974 2862515553
975 2862709194
976 2863407287
977 2867352627
978 2867375009
979 2867432569
980 2873158216
981 2873158657
982 2875392468
983 2877683671
984 2895451249
985 2912722941
986 2912758522
987 2918502266
988 2919474344
989 2935394062
990 2946047113
991 2946052278
992 2946065302
993 2946073673
994 2947232142
995 2947232909
996 2954008736
997 2954388969
998 2954674207
999 2954689925
1000 2954699709
1001 2954702490
1002 2954718648
1003 2954728619
1004 2954733193
1005 2954747515
1006 2954752073
1007 2954766631
1008 2966604685
1009 2990064733
1010 2995466523
1011 2997452757
1012 2997457521
1013 3006396365
1014 3006497117
1015 8008488520
1016 8008560969
1017 8008581044
1018 8023628654
1019 8025418651
1020 8025527433
1021 8025535075
1022 8047894455
1023 8048134790
1024 8048364597
1025 8048371472
1026 8048380273
1027 8048411478
1028 8054164245
1029 8056672316
1030 8056832592

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02492

cobW

CobW/HypB/UreG, nucleotide-binding domain

27

201

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.9386 25 199
4hi0-assembly1.cif.gz_F crystal structure of helicobacter pylori urease accessory protein uref/h/g complex 0.9151 27 197
5xkt-assembly1.cif.gz_B klebsiella pneumoniae ureg in complex with gmppnp and nickel 0.8243 25 199
1zn0-assembly1.cif.gz_B coordinates of rrf and ef-g fitted into cryo-em map of the 50s subunit bound with both ef-g (gdpnp) and rrf 0.8237 25 52
3qof-assembly3.cif.gz_C crystal structure of the cytosolic domain of human atlastin-1 in complex with gdp, orthorhombic form 0.8147 25 53
ID Description Score Start End Superfamily
af_P9WNL3_25_184_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9466 26 46 3.40.50.300
af_O64700_71_266_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9167 24 198 3.40.50.300
3sopA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8633 27 51 3.40.50.300
af_A0A1P8B4T0_94_311_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8434 25 53 3.40.50.300
af_F4HXI5_9_190_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8373 25 46 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A508ZP30-F1-model_v4 Putative urease accessory protein 0.9965 27 111 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A2J4UPZ5-F1-model_v4 deleted 0.9935 24 104
AF-A0A376FFI8-F1-model_v4 Urease accessory protein UreG 0.9925 27 112 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A846BTH3-F1-model_v4 Urease accessory protein UreG 0.9923 25 112 GO:0003924
GO:0005525
GO:0016151
GO:0043419
AF-A0A1R3X8P8-F1-model_v4 Urease accessory protein 0.9915 27 114 GO:0003924
GO:0005525
GO:0016151
GO:0043419

Map