F457822
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 515 | 274 | 487 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300005434|Ga0070709_10339556|Ga0070709_103395562 |
| Length | 182 |
| Sequence | MRRLMLLRHAKTENDAPSGRDQDRRLDNRGRNDATEIGGWIGRHPPFLPDLVLVSHAVRAYQTWEIAWQAMKERSPEPQVELTPELYGADPVQLLQIIRAASEADPQRLMLIGHNPGMHELALALAGSGGEPAGRKALADNLPTSGLAAFDFAIDDWADAAFRRGRLVQFVSPKLLKQASDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 7 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 8 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 9 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 10 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 11 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 12 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 13 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 14 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 15 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 16 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 17 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 18 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 19 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 20 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 21 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 22 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 23 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 24 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 50 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 73 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 74 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 144 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 146 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 157 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 158 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 159 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 160 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 161 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 164 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 171 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 172 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 173 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 175 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 176 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 178 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 179 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 187 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 188 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 189 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 243 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 244 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 247 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 248 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 249 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 250 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 251 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 252 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 253 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 263 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 267 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 268 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 269 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 270 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 271 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 272 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 273 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 274 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.53 |
| Metatranscriptomes | 0.59 |
| Isolates | 4.88 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.94 |
| Nodule | 5.05 |
| Rhizoplane | 10.68 |
| Rhizosphere | 75.53 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.8 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1001531 | 3300000549 | Bacteria | 3437 |
| 2 | JGI25406J46586_10000048 | 3300003203 | Bacteria | 54715 |
| 3 | Ga0070658_10007221 | 3300005327 | Bacteria | 8965 |
| 4 | Ga0070676_10316315 | 3300005328 | Bacteria | 1063 |
| 5 | Ga0070683_100015758 | 3300005329 | Bacteria | 6645 |
| 6 | Ga0070683_100657065 | 3300005329 | Bacteria | 1004 |
| 7 | Ga0070680_100044116 | 3300005336 | Bacteria | 3623 |
| 8 | Ga0070680_100046072 | 3300005336 | Bacteria | 3547 |
| 9 | Ga0070682_100882692 | 3300005337 | Bacteria | 733 |
| 10 | Ga0068868_100073585 | 3300005338 | Bacteria | 2729 |
| 11 | Ga0068868_101208330 | 3300005338 | Bacteria | 699 |
| 12 | Ga0070660_100008957 | 3300005339 | Bacteria | 7021 |
| 13 | Ga0070691_10059388 | 3300005341 | Bacteria | 1838 |
| 14 | Ga0070661_100611679 | 3300005344 | Bacteria | 882 |
| 15 | Ga0070673_100157709 | 3300005364 | Bacteria | 1927 |
| 16 | Ga0070659_100037727 | 3300005366 | Bacteria | 3768 |
| 17 | Ga0070659_100433794 | 3300005366 | Bacteria | 1112 |
| 18 | Ga0070709_10082451 | 3300005434 | Bacteria | 2101 |
| 19 | Ga0070709_10339556 | 3300005434 | Bacteria | 1107 |
| 20 | Ga0070714_100026993 | 3300005435 | Bacteria | 4751 |
| 21 | Ga0070714_100059084 | 3300005435 | Bacteria | 3287 |
| 22 | Ga0070714_100172527 | 3300005435 | Bacteria | 1963 |
| 23 | Ga0070713_100040482 | 3300005436 | Bacteria | 3788 |
| 24 | Ga0070713_100045688 | 3300005436 | Bacteria | 3591 |
| 25 | Ga0070713_100203434 | 3300005436 | Bacteria | 1789 |
| 26 | Ga0070713_100372657 | 3300005436 | Bacteria | 1329 |
| 27 | Ga0070713_100419390 | 3300005436 | Bacteria | 1253 |
| 28 | Ga0070710_10044379 | 3300005437 | Bacteria | 2466 |
| 29 | Ga0070710_10080519 | 3300005437 | Bacteria | 1900 |
| 30 | Ga0070710_10375488 | 3300005437 | Bacteria | 947 |
| 31 | Ga0070701_10540171 | 3300005438 | Bacteria | 763 |
| 32 | Ga0070711_100035807 | 3300005439 | Bacteria | 3321 |
| 33 | Ga0070711_100068940 | 3300005439 | Bacteria | 2487 |
| 34 | Ga0070711_100654796 | 3300005439 | Bacteria | 881 |
| 35 | Ga0070694_100508704 | 3300005444 | Bacteria | 959 |
| 36 | Ga0070663_100366659 | 3300005455 | Bacteria | 1170 |
| 37 | Ga0070678_100017123 | 3300005456 | Bacteria | 4656 |
| 38 | Ga0070681_10016205 | 3300005458 | Bacteria | 7432 |
| 39 | Ga0070681_10053286 | 3300005458 | Bacteria | 4031 |
| 40 | Ga0070681_10249855 | 3300005458 | Bacteria | 1686 |
| 41 | Ga0070681_10412465 | 3300005458 | Bacteria | 1262 |
| 42 | Ga0070699_101536545 | 3300005518 | Bacteria | 610 |
| 43 | Ga0070679_100059711 | 3300005530 | Bacteria | 3800 |
| 44 | Ga0070679_100169308 | 3300005530 | Bacteria | 2157 |
| 45 | Ga0070679_100634643 | 3300005530 | Bacteria | 1011 |
| 46 | Ga0070684_100010386 | 3300005535 | Bacteria | 7372 |
| 47 | Ga0070684_100163562 | 3300005535 | Bacteria | 2019 |
| 48 | Ga0070684_100274609 | 3300005535 | Bacteria | 1543 |
| 49 | Ga0070697_100034479 | 3300005536 | Bacteria | 4081 |
| 50 | Ga0068853_100005857 | 3300005539 | Bacteria | 9682 |
| 51 | Ga0068853_100179608 | 3300005539 | Bacteria | 1919 |
| 52 | Ga0070672_100044440 | 3300005543 | Bacteria | 3431 |
| 53 | Ga0070693_100036267 | 3300005547 | Bacteria | 2740 |
| 54 | Ga0070693_100213624 | 3300005547 | Bacteria | 1260 |
| 55 | Ga0070665_100357265 | 3300005548 | Bacteria | 1467 |
| 56 | Ga0070665_100426370 | 3300005548 | Bacteria | 1335 |
| 57 | Ga0068855_100061371 | 3300005563 | Bacteria | 4393 |
| 58 | Ga0068855_100089033 | 3300005563 | Bacteria | 3564 |
| 59 | Ga0068855_100195041 | 3300005563 | Bacteria | 2282 |
| 60 | Ga0068855_100481317 | 3300005563 | Bacteria | 1351 |
| 61 | Ga0068855_100574937 | 3300005563 | Bacteria | 1218 |
| 62 | Ga0068855_100608270 | 3300005563 | Bacteria | 1178 |
| 63 | Ga0070664_100026331 | 3300005564 | Bacteria | 4824 |
| 64 | Ga0070664_100370084 | 3300005564 | Bacteria | 1306 |
| 65 | Ga0068857_100037942 | 3300005577 | Bacteria | 4268 |
| 66 | Ga0068857_101688286 | 3300005577 | Bacteria | 619 |
| 67 | Ga0068854_100068908 | 3300005578 | Bacteria | 2581 |
| 68 | Ga0068854_100228709 | 3300005578 | Bacteria | 1475 |
| 69 | Ga0068856_100000363 | 3300005614 | Bacteria | 49777 |
| 70 | Ga0068856_100283694 | 3300005614 | Bacteria | 1673 |
| 71 | Ga0068856_100492933 | 3300005614 | Bacteria | 1246 |
| 72 | Ga0068852_100005807 | 3300005616 | Bacteria | 8861 |
| 73 | Ga0068852_100101036 | 3300005616 | Bacteria | 2603 |
| 74 | Ga0068852_100551489 | 3300005616 | Bacteria | 1153 |
| 75 | Ga0068864_100111252 | 3300005618 | Bacteria | 2440 |
| 76 | Ga0068864_100151419 | 3300005618 | Bacteria | 2101 |
| 77 | Ga0068851_10106177 | 3300005834 | Bacteria | 1495 |
| 78 | Ga0068863_100291498 | 3300005841 | Bacteria | 1582 |
| 79 | Ga0068858_100185117 | 3300005842 | Bacteria | 1967 |
| 80 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 81 | Ga0070717_10011341 | 3300006028 | Bacteria | 6764 |
| 82 | Ga0070717_10033177 | 3300006028 | Bacteria | 4164 |
| 83 | Ga0070717_10065485 | 3300006028 | Bacteria | 3021 |
| 84 | Ga0070717_10091712 | 3300006028 | Bacteria | 2566 |
| 85 | Ga0075365_10064551 | 3300006038 | Bacteria | 2453 |
| 86 | Ga0070715_10020502 | 3300006163 | Bacteria | 2551 |
| 87 | Ga0070716_100127145 | 3300006173 | Bacteria | 1605 |
| 88 | Ga0070712_100071504 | 3300006175 | Bacteria | 2482 |
| 89 | Ga0070712_100076644 | 3300006175 | Bacteria | 2408 |
| 90 | Ga0070712_100092377 | 3300006175 | Bacteria | 2219 |
| 91 | Ga0068871_100309654 | 3300006358 | Bacteria | 1388 |
| 92 | Ga0068865_100321509 | 3300006881 | Bacteria | 1245 |
| 93 | Ga0075436_100360435 | 3300006914 | Bacteria | 1049 |
| 94 | Ga0099824_1002915 | 3300006942 | Bacteria | 25054 |
| 95 | Ga0099822_1012763 | 3300006943 | Bacteria | 9978 |
| 96 | Ga0099794_10029028 | 3300007265 | Bacteria | 2575 |
| 97 | Ga0099794_10066616 | 3300007265 | Bacteria | 1757 |
| 98 | Ga0099794_10158442 | 3300007265 | Bacteria | 1151 |
| 99 | Ga0105240_10007748 | 3300009093 | Bacteria | 15534 |
| 100 | Ga0105240_10021481 | 3300009093 | Bacteria | 8584 |
| 101 | Ga0105240_10048119 | 3300009093 | Bacteria | 5391 |
| 102 | Ga0105245_10163512 | 3300009098 | Bacteria | 2114 |
| 103 | Ga0105245_10401668 | 3300009098 | Bacteria | 1369 |
| 104 | Ga0105247_10393835 | 3300009101 | Bacteria | 985 |
| 105 | Ga0105243_10241271 | 3300009148 | Bacteria | 1608 |
| 106 | Ga0105241_10090138 | 3300009174 | Bacteria | 2418 |
| 107 | Ga0105241_10519226 | 3300009174 | Bacteria | 1065 |
| 108 | Ga0105241_10758124 | 3300009174 | Bacteria | 891 |
| 109 | Ga0105248_10294518 | 3300009177 | Bacteria | 1827 |
| 110 | Ga0105237_10006757 | 3300009545 | Bacteria | 12663 |
| 111 | Ga0105237_10011809 | 3300009545 | Bacteria | 9237 |
| 112 | Ga0105237_10023711 | 3300009545 | Bacteria | 6282 |
| 113 | Ga0105237_10445308 | 3300009545 | Bacteria | 1301 |
| 114 | Ga0105237_10903519 | 3300009545 | Bacteria | 890 |
| 115 | Ga0105238_10002692 | 3300009551 | Bacteria | 17671 |
| 116 | Ga0105238_10101590 | 3300009551 | Bacteria | 2858 |
| 117 | Ga0105238_10276364 | 3300009551 | Bacteria | 1660 |
| 118 | Ga0105238_10448996 | 3300009551 | Bacteria | 1286 |
| 119 | Ga0105238_11308374 | 3300009551 | Bacteria | 751 |
| 120 | Ga0105249_10435902 | 3300009553 | Bacteria | 1347 |
| 121 | Ga0099796_10133054 | 3300010159 | Bacteria | 966 |
| 122 | Ga0105239_10012853 | 3300010375 | Bacteria | 9314 |
| 123 | Ga0105239_10130036 | 3300010375 | Bacteria | 2800 |
| 124 | Ga0105239_10199854 | 3300010375 | Bacteria | 2239 |
| 125 | Ga0105239_10483694 | 3300010375 | Bacteria | 1406 |
| 126 | Ga0105239_10778468 | 3300010375 | Bacteria | 1096 |
| 127 | Ga0105246_10028122 | 3300011119 | Bacteria | 3692 |
| 128 | Ga0105246_10245880 | 3300011119 | Bacteria | 1417 |
| 129 | Ga0157370_10142251 | 3300013104 | Bacteria | 2235 |
| 130 | Ga0157370_10217616 | 3300013104 | Bacteria | 1770 |
| 131 | Ga0157369_10004292 | 3300013105 | Bacteria | 16858 |
| 132 | Ga0157369_10008116 | 3300013105 | Bacteria | 12033 |
| 133 | Ga0157369_10230394 | 3300013105 | Bacteria | 1937 |
| 134 | Ga0157369_10335451 | 3300013105 | Bacteria | 1571 |
| 135 | Ga0157369_10451308 | 3300013105 | Bacteria | 1331 |
| 136 | Ga0157369_10975752 | 3300013105 | Bacteria | 868 |
| 137 | Ga0157374_10028994 | 3300013296 | Bacteria | 5005 |
| 138 | Ga0157378_10237044 | 3300013297 | Bacteria | 1741 |
| 139 | Ga0163162_10010007 | 3300013306 | Bacteria | 9221 |
| 140 | Ga0163162_10074878 | 3300013306 | Bacteria | 3445 |
| 141 | Ga0163162_10217908 | 3300013306 | Bacteria | 2039 |
| 142 | Ga0163162_10579958 | 3300013306 | Bacteria | 1248 |
| 143 | Ga0157372_10037750 | 3300013307 | Bacteria | 5328 |
| 144 | Ga0157372_10196810 | 3300013307 | Bacteria | 2334 |
| 145 | Ga0157372_10332291 | 3300013307 | Bacteria | 1770 |
| 146 | Ga0157375_10036503 | 3300013308 | Bacteria | 4702 |
| 147 | Ga0163163_10004103 | 3300014325 | Bacteria | 12420 |
| 148 | Ga0157380_11222064 | 3300014326 | Bacteria | 796 |
| 149 | Ga0157377_10424403 | 3300014745 | Bacteria | 911 |
| 150 | Ga0157376_10006130 | 3300014969 | Bacteria | 8465 |
| 151 | Ga0157376_11627914 | 3300014969 | Bacteria | 680 |
| 152 | Ga0206356_10910912 | 3300020070 | Bacteria | 961 |
| 153 | Ga0206356_11251455 | 3300020070 | Bacteria | 1169 |
| 154 | Ga0213876_10049984 | 3300021384 | Bacteria | 2209 |
| 155 | Ga0209233_1001233 | 3300025261 | Bacteria | 10268 |
| 156 | Ga0207656_10348292 | 3300025321 | Bacteria | 739 |
| 157 | Ga0207692_10152064 | 3300025898 | Bacteria | 1326 |
| 158 | Ga0207710_10478654 | 3300025900 | Bacteria | 645 |
| 159 | Ga0207647_10138605 | 3300025904 | Bacteria | 1426 |
| 160 | Ga0207685_10109196 | 3300025905 | Bacteria | 1196 |
| 161 | Ga0207685_10166268 | 3300025905 | Bacteria | 1011 |
| 162 | Ga0207685_10203488 | 3300025905 | Bacteria | 932 |
| 163 | Ga0207699_10067450 | 3300025906 | Bacteria | 2175 |
| 164 | Ga0207699_10258155 | 3300025906 | Bacteria | 1203 |
| 165 | Ga0207645_10364131 | 3300025907 | Bacteria | 969 |
| 166 | Ga0207705_10012662 | 3300025909 | Bacteria | 6088 |
| 167 | Ga0207705_10715385 | 3300025909 | Bacteria | 778 |
| 168 | Ga0207684_10962078 | 3300025910 | Bacteria | 716 |
| 169 | Ga0207654_10074113 | 3300025911 | Bacteria | 2031 |
| 170 | Ga0207707_10015318 | 3300025912 | Bacteria | 6675 |
| 171 | Ga0207707_10040760 | 3300025912 | Bacteria | 4055 |
| 172 | Ga0207707_10121346 | 3300025912 | Bacteria | 2285 |
| 173 | Ga0207707_10342301 | 3300025912 | Bacteria | 1289 |
| 174 | Ga0207695_10021731 | 3300025913 | Bacteria | 7313 |
| 175 | Ga0207695_10134238 | 3300025913 | Bacteria | 2430 |
| 176 | Ga0207695_10160882 | 3300025913 | Bacteria | 2177 |
| 177 | Ga0207695_10177540 | 3300025913 | Bacteria | 2052 |
| 178 | Ga0207671_10041126 | 3300025914 | Bacteria | 3421 |
| 179 | Ga0207671_10139527 | 3300025914 | Bacteria | 1867 |
| 180 | Ga0207671_10180431 | 3300025914 | Bacteria | 1643 |
| 181 | Ga0207671_10186464 | 3300025914 | Bacteria | 1616 |
| 182 | Ga0207671_10503803 | 3300025914 | Bacteria | 965 |
| 183 | Ga0207671_10523695 | 3300025914 | Bacteria | 945 |
| 184 | Ga0207693_10018039 | 3300025915 | Bacteria | 5625 |
| 185 | Ga0207693_10033278 | 3300025915 | Bacteria | 4068 |
| 186 | Ga0207693_10152028 | 3300025915 | Bacteria | 1821 |
| 187 | Ga0207693_10367364 | 3300025915 | Bacteria | 1126 |
| 188 | Ga0207693_10409355 | 3300025915 | Bacteria | 1060 |
| 189 | Ga0207663_10004056 | 3300025916 | Bacteria | 7261 |
| 190 | Ga0207660_10028890 | 3300025917 | Bacteria | 3798 |
| 191 | Ga0207660_10063549 | 3300025917 | Bacteria | 2662 |
| 192 | Ga0207660_10179064 | 3300025917 | Bacteria | 1645 |
| 193 | Ga0207660_10437215 | 3300025917 | Bacteria | 1057 |
| 194 | Ga0207660_10539576 | 3300025917 | Bacteria | 948 |
| 195 | Ga0207657_10034539 | 3300025919 | Bacteria | 4545 |
| 196 | Ga0207657_10314397 | 3300025919 | Bacteria | 1239 |
| 197 | Ga0207652_10056918 | 3300025921 | Bacteria | 3366 |
| 198 | Ga0207652_10064077 | 3300025921 | Bacteria | 3180 |
| 199 | Ga0207652_10066101 | 3300025921 | Bacteria | 3133 |
| 200 | Ga0207652_10172646 | 3300025921 | Bacteria | 1940 |
| 201 | Ga0207694_10259191 | 3300025924 | Bacteria | 1424 |
| 202 | Ga0207659_10649219 | 3300025926 | Bacteria | 902 |
| 203 | Ga0207687_10200730 | 3300025927 | Bacteria | 1558 |
| 204 | Ga0207687_10296829 | 3300025927 | Bacteria | 1300 |
| 205 | Ga0207700_10097557 | 3300025928 | Bacteria | 2336 |
| 206 | Ga0207700_10256597 | 3300025928 | Bacteria | 1495 |
| 207 | Ga0207700_10267481 | 3300025928 | Bacteria | 1466 |
| 208 | Ga0207664_10051264 | 3300025929 | Bacteria | 3258 |
| 209 | Ga0207686_10841937 | 3300025934 | Bacteria | 737 |
| 210 | Ga0207704_10672753 | 3300025938 | Bacteria | 854 |
| 211 | Ga0207665_10009625 | 3300025939 | Bacteria | 6347 |
| 212 | Ga0207665_10105006 | 3300025939 | Bacteria | 1978 |
| 213 | Ga0207665_10867526 | 3300025939 | Bacteria | 715 |
| 214 | Ga0207691_10094970 | 3300025940 | Bacteria | 2667 |
| 215 | Ga0207689_10183786 | 3300025942 | Bacteria | 1724 |
| 216 | Ga0207661_10001312 | 3300025944 | Bacteria | 16630 |
| 217 | Ga0207661_10019448 | 3300025944 | Bacteria | 5063 |
| 218 | Ga0207661_10162045 | 3300025944 | Bacteria | 1941 |
| 219 | Ga0207661_10582610 | 3300025944 | Bacteria | 1026 |
| 220 | Ga0207679_10048078 | 3300025945 | Bacteria | 3103 |
| 221 | Ga0207667_10073039 | 3300025949 | Bacteria | 3565 |
| 222 | Ga0207667_10162936 | 3300025949 | Bacteria | 2293 |
| 223 | Ga0207667_10207601 | 3300025949 | Bacteria | 2008 |
| 224 | Ga0207667_10317367 | 3300025949 | Bacteria | 1591 |
| 225 | Ga0207667_10475839 | 3300025949 | Bacteria | 1268 |
| 226 | Ga0207640_10189323 | 3300025981 | Bacteria | 1550 |
| 227 | Ga0207640_11182924 | 3300025981 | Bacteria | 679 |
| 228 | Ga0207677_11011456 | 3300026023 | Bacteria | 754 |
| 229 | Ga0207703_10711951 | 3300026035 | Bacteria | 955 |
| 230 | Ga0207639_10017229 | 3300026041 | Bacteria | 5121 |
| 231 | Ga0207639_10377992 | 3300026041 | Bacteria | 1271 |
| 232 | Ga0207678_10011003 | 3300026067 | Bacteria | 7946 |
| 233 | Ga0207702_10000261 | 3300026078 | Bacteria | 61023 |
| 234 | Ga0207702_10182239 | 3300026078 | Bacteria | 1935 |
| 235 | Ga0207641_10739890 | 3300026088 | Bacteria | 970 |
| 236 | Ga0207676_10110007 | 3300026095 | Bacteria | 2304 |
| 237 | Ga0207674_10028112 | 3300026116 | Bacteria | 5939 |
| 238 | Ga0207683_10206076 | 3300026121 | Bacteria | 1789 |
| 239 | Ga0207698_10062739 | 3300026142 | Bacteria | 2904 |
| 240 | Ga0207698_10068099 | 3300026142 | Bacteria | 2810 |
| 241 | Ga0207698_10641720 | 3300026142 | Bacteria | 1051 |
| 242 | Ga0209589_1000004 | 3300027357 | Bacteria | 578529 |
| 243 | Ga0209489_100004 | 3300027361 | Bacteria | 578529 |
| 244 | Ga0209700_100004 | 3300027363 | Bacteria | 578529 |
| 245 | Ga0209179_1082303 | 3300027512 | Bacteria | 711 |
| 246 | Ga0209588_1060488 | 3300027671 | Bacteria | 1225 |
| 247 | Ga0265334_10030027 | 3300028573 | Bacteria | 2177 |
| 248 | Ga0265332_10006468 | 3300031238 | Bacteria | 5313 |
| 249 | Ga0265328_10211662 | 3300031239 | Bacteria | 737 |
| 250 | Ga0265340_10013940 | 3300031247 | Bacteria | 4212 |
| 251 | Ga0265340_10098077 | 3300031247 | Bacteria | 1364 |
| 252 | Ga0265339_10011794 | 3300031249 | Bacteria | 5363 |
| 253 | Ga0265339_10152007 | 3300031249 | Bacteria | 1170 |
| 254 | Ga0265331_10074035 | 3300031250 | Bacteria | 1590 |
| 255 | Ga0307508_10001617 | 3300031616 | Bacteria | 25159 |
| 256 | Ga0307508_10106805 | 3300031616 | Bacteria | 2398 |
| 257 | Ga0265342_10031302 | 3300031712 | Bacteria | 3291 |
| 258 | Ga0265342_10087235 | 3300031712 | Bacteria | 1793 |
| 259 | Ga0265342_10133107 | 3300031712 | Bacteria | 1391 |
| 260 | Ga0307510_10026735 | 3300033180 | Bacteria | 6625 |
| 261 | Ga0315911_1000011 | 3300033442 | Bacteria | 264678 |
| 262 | Ga0316215_1004538 | 3300033544 | Bacteria | 1332 |
| 263 | Ga0316215_1015855 | 3300033544 | Bacteria | 757 |
| 264 | Ga0373926_0009066 | 3300035083 | Bacteria | 3319 |
| 265 | Ga0373928_0114881 | 3300035084 | Bacteria | 716 |
| 266 | Ga0373934_0001081 | 3300035086 | Bacteria | 9869 |
| 267 | Ga0373934_0158005 | 3300035086 | Bacteria | 930 |
| 268 | Ga0373944_0009877 | 3300035089 | Bacteria | 2595 |
| 269 | Ga0373923_0009768 | 3300035111 | Bacteria | 3470 |
| 270 | Ga0373923_0025745 | 3300035111 | Bacteria | 2334 |
| 271 | Ga0373932_0102275 | 3300035112 | Bacteria | 934 |
| 272 | Ga0373936_0011831 | 3300035113 | Bacteria | 3310 |
| 273 | Ga0373953_0027234 | 3300035117 | Bacteria | 2196 |
| 274 | Ga0373953_0028946 | 3300035117 | Bacteria | 2140 |
| 275 | Ga0373954_0008459 | 3300035118 | Bacteria | 4516 |
| 276 | Ga0373956_0014367 | 3300035119 | Bacteria | 3307 |
| 277 | Ga0373957_0010028 | 3300035120 | Bacteria | 3117 |
| 278 | Ga0373943_0013493 | 3300035170 | Bacteria | 3691 |
| 279 | Ga0373943_0130166 | 3300035170 | Bacteria | 1346 |
| 280 | Ga0373946_0008767 | 3300035171 | Bacteria | 3712 |
| 281 | Ga0373955_0024390 | 3300035172 | Bacteria | 3093 |
| 282 | Ga0373955_0070777 | 3300035172 | Bacteria | 1949 |
| 283 | Ga0373955_0147914 | 3300035172 | Bacteria | 1381 |
| 284 | Ga0373924_0074161 | 3300035410 | Bacteria | 1439 |
| 285 | Ga0373935_0046996 | 3300035692 | Bacteria | 2727 |
| 286 | Ga0373927_0109956 | 3300035695 | Bacteria | 1795 |
| 287 | Ga0373933_0000159 | 3300035724 | Bacteria | 43953 |
| 288 | Ga0373933_0067407 | 3300035724 | Bacteria | 2171 |
| 289 | Ga0373933_0081634 | 3300035724 | Bacteria | 1983 |
| 290 | Ga0373933_0232950 | 3300035724 | Bacteria | 1183 |
| 291 | Ga0373947_0056739 | 3300035725 | Bacteria | 2368 |
| 292 | Ga0373947_0090355 | 3300035725 | Bacteria | 1908 |
| 293 | Ga0373947_0215701 | 3300035725 | Bacteria | 1260 |
| 294 | Ga0373937_0030893 | 3300036401 | Bacteria | 4850 |
| 295 | Ga0373937_0293018 | 3300036401 | Bacteria | 1537 |
| 296 | Ga0373937_0300953 | 3300036401 | Bacteria | 1516 |
| 297 | Ga0372808_003696 | 3300036459 | Bacteria | 1902 |
| 298 | Ga0373925_0070463 | 3300037068 | Bacteria | 2643 |
| 299 | Ga0373925_0140935 | 3300037068 | Bacteria | 1887 |
| 300 | Ga0373925_0169723 | 3300037068 | Bacteria | 1722 |
| 301 | Ga0395900_0057479 | 3300037418 | Bacteria | 4005 |
| 302 | Ga0395900_0442408 | 3300037418 | Bacteria | 1257 |
| 303 | Ga0395898_0076506 | 3300037466 | Bacteria | 3232 |
| 304 | Ga0395898_0505642 | 3300037466 | Bacteria | 1149 |
| 305 | Ga0436364_0384534 | 3300037853 | Bacteria | 5052 |
| 306 | Ga0436364_1255264 | 3300037853 | Bacteria | 2476 |
| 307 | Ga0395901_0474403 | 3300038443 | Bacteria | 1277 |
| 308 | Ga0395901_0907886 | 3300038443 | Bacteria | 862 |
| 309 | Ga0436365_0572673 | 3300039437 | Bacteria | 942 |
| 310 | Ga0436365_1697229 | 3300039437 | Bacteria | 5763 |
| 311 | Ga0436360_0275470 | 3300039438 | Bacteria | 7453 |
| 312 | Ga0436361_0725474 | 3300039447 | Bacteria | 14455 |
| 313 | Ga0436363_0938134 | 3300039450 | Bacteria | 831 |
| 314 | Ga0436363_1401514 | 3300039450 | Bacteria | 842 |
| 315 | Ga0451851_0713221 | 3300041507 | Bacteria | 1181 |
| 316 | Ga0466966_0147135 | 3300044684 | Bacteria | 1438 |
| 317 | Ga0466963_0062167 | 3300044694 | Bacteria | 2498 |
| 318 | Ga0466959_0050741 | 3300045049 | Bacteria | 3045 |
| 319 | Ga0495592_0001055 | 3300046454 | Bacteria | 19077 |
| 320 | Ga0495592_0057172 | 3300046454 | Bacteria | 2880 |
| 321 | Ga0495592_0066154 | 3300046454 | Bacteria | 2645 |
| 322 | Ga0495603_0459049 | 3300046455 | Bacteria | 729 |
| 323 | Ga0495629_0004163 | 3300046459 | Bacteria | 10857 |
| 324 | Ga0495629_0040163 | 3300046459 | Bacteria | 3292 |
| 325 | Ga0495629_0254433 | 3300046459 | Bacteria | 1208 |
| 326 | Ga0495641_0080234 | 3300046461 | Bacteria | 1462 |
| 327 | Ga0495651_0115143 | 3300046462 | Bacteria | 1983 |
| 328 | Ga0495651_0122565 | 3300046462 | Bacteria | 1907 |
| 329 | Ga0495653_0013831 | 3300046463 | Bacteria | 6576 |
| 330 | Ga0495653_0107935 | 3300046463 | Bacteria | 2005 |
| 331 | Ga0495580_0023995 | 3300046472 | Bacteria | 4470 |
| 332 | Ga0495582_0092591 | 3300046473 | Bacteria | 1686 |
| 333 | Ga0495639_0004720 | 3300046475 | Bacteria | 5860 |
| 334 | Ga0495639_0108009 | 3300046475 | Bacteria | 1318 |
| 335 | Ga0495639_0133578 | 3300046475 | Bacteria | 1189 |
| 336 | Ga0495664_0021707 | 3300046477 | Bacteria | 3709 |
| 337 | Ga0495664_0050295 | 3300046477 | Bacteria | 2475 |
| 338 | Ga0495594_0259940 | 3300046499 | Bacteria | 989 |
| 339 | Ga0495606_0000992 | 3300046507 | Bacteria | 41375 |
| 340 | Ga0495608_0007611 | 3300046511 | Bacteria | 7636 |
| 341 | Ga0495608_0046596 | 3300046511 | Bacteria | 2884 |
| 342 | Ga0495618_0028872 | 3300046514 | Bacteria | 3458 |
| 343 | Ga0495618_0249246 | 3300046514 | Bacteria | 1114 |
| 344 | Ga0495628_0007764 | 3300046516 | Bacteria | 9246 |
| 345 | Ga0495628_0295854 | 3300046516 | Bacteria | 1199 |
| 346 | Ga0495630_0494318 | 3300046517 | Bacteria | 938 |
| 347 | Ga0495652_0093148 | 3300046529 | Bacteria | 2460 |
| 348 | Ga0495652_0189706 | 3300046529 | Bacteria | 1569 |
| 349 | Ga0495640_0006867 | 3300046533 | Bacteria | 8966 |
| 350 | Ga0495586_0087781 | 3300046535 | Bacteria | 1715 |
| 351 | Ga0495645_0024430 | 3300046543 | Bacteria | 4385 |
| 352 | Ga0495645_0097198 | 3300046543 | Bacteria | 2097 |
| 353 | Ga0495645_0278298 | 3300046543 | Bacteria | 1101 |
| 354 | Ga0495667_0137410 | 3300046559 | Bacteria | 1575 |
| 355 | Ga0495667_0202444 | 3300046559 | Bacteria | 1270 |
| 356 | Ga0495667_0409694 | 3300046559 | Bacteria | 853 |
| 357 | Ga0495668_0065320 | 3300046616 | Bacteria | 2003 |
| 358 | Ga0495634_0121474 | 3300046642 | Bacteria | 1672 |
| 359 | Ga0495634_0146073 | 3300046642 | Bacteria | 1498 |
| 360 | Ga0495635_0010764 | 3300046663 | Bacteria | 6408 |
| 361 | Ga0495635_0064224 | 3300046663 | Bacteria | 2520 |
| 362 | Ga0495657_0052411 | 3300046675 | Bacteria | 2735 |
| 363 | Ga0495657_0066866 | 3300046675 | Bacteria | 2360 |
| 364 | Ga0495657_0599103 | 3300046675 | Bacteria | 638 |
| 365 | Ga0495599_0196325 | 3300046678 | Bacteria | 1240 |
| 366 | Ga0495623_0047788 | 3300046679 | Bacteria | 2716 |
| 367 | Ga0495623_0145534 | 3300046679 | Bacteria | 1405 |
| 368 | Ga0495623_0196600 | 3300046679 | Bacteria | 1162 |
| 369 | Ga0495646_0005624 | 3300046680 | Bacteria | 7933 |
| 370 | Ga0495646_0011556 | 3300046680 | Bacteria | 5607 |
| 371 | Ga0495647_0025122 | 3300046681 | Bacteria | 2174 |
| 372 | Ga0495658_0390047 | 3300046683 | Bacteria | 887 |
| 373 | Ga0495669_0385876 | 3300046684 | Bacteria | 678 |
| 374 | Ga0495613_0247960 | 3300046689 | Bacteria | 1243 |
| 375 | Ga0495613_0326789 | 3300046689 | Bacteria | 1057 |
| 376 | Ga0495613_0683489 | 3300046689 | Bacteria | 677 |
| 377 | Ga0495624_0387958 | 3300046690 | Bacteria | 839 |
| 378 | Ga0495600_0145955 | 3300046809 | Bacteria | 1533 |
| 379 | Ga0495581_0005564 | 3300047315 | Bacteria | 7300 |
| 380 | Ga0495604_0175939 | 3300047317 | Bacteria | 1500 |
| 381 | Ga0495674_0041199 | 3300047319 | Bacteria | 4127 |
| 382 | Ga0495674_0088150 | 3300047319 | Bacteria | 2654 |
| 383 | Ga0495674_0382063 | 3300047319 | Bacteria | 1139 |
| 384 | Ga0495680_0043560 | 3300047322 | Bacteria | 3552 |
| 385 | Ga0495680_0066622 | 3300047322 | Bacteria | 2755 |
| 386 | Ga0495675_0093480 | 3300047444 | Bacteria | 1886 |
| 387 | Ga0495675_0277308 | 3300047444 | Bacteria | 1000 |
| 388 | Ga0495673_0021944 | 3300047469 | Bacteria | 3139 |
| 389 | Ga0495684_0003999 | 3300047471 | Bacteria | 11499 |
| 390 | Ga0495684_0007513 | 3300047471 | Bacteria | 8439 |
| 391 | Ga0495684_0111090 | 3300047471 | Bacteria | 2068 |
| 392 | Ga0495686_0061810 | 3300047472 | Bacteria | 2325 |
| 393 | Ga0495686_0091375 | 3300047472 | Bacteria | 1848 |
| 394 | Ga0495593_0011503 | 3300047673 | Bacteria | 5080 |
| 395 | Ga0495593_0035667 | 3300047673 | Bacteria | 2699 |
| 396 | Ga0495602_0087506 | 3300048088 | Bacteria | 2596 |
| 397 | Ga0496100_0099850 | 3300048903 | Bacteria | 1998 |
| 398 | Ga0496100_0168677 | 3300048903 | Bacteria | 1574 |
| 399 | Ga0496100_0390058 | 3300048903 | Bacteria | 1059 |
| 400 | Ga0496101_0037617 | 3300048904 | Bacteria | 3434 |
| 401 | Ga0496101_0271355 | 3300048904 | Bacteria | 1324 |
| 402 | Ga0496101_0697786 | 3300048904 | Bacteria | 801 |
| 403 | Ga0496102_0003066 | 3300048905 | Bacteria | 14146 |
| 404 | Ga0496102_0082282 | 3300048905 | Bacteria | 2969 |
| 405 | Ga0496102_0202795 | 3300048905 | Bacteria | 1870 |
| 406 | Ga0496102_0252034 | 3300048905 | Bacteria | 1665 |
| 407 | Ga0496102_0555129 | 3300048905 | Bacteria | 1071 |
| 408 | Ga0496102_0979793 | 3300048905 | Bacteria | 766 |
| 409 | Ga0496104_0008842 | 3300048907 | Bacteria | 8953 |
| 410 | Ga0496104_0074804 | 3300048907 | Bacteria | 3224 |
| 411 | Ga0496104_0695003 | 3300048907 | Bacteria | 925 |
| 412 | Ga0496105_0016158 | 3300048908 | Bacteria | 5953 |
| 413 | Ga0496105_0169585 | 3300048908 | Bacteria | 1789 |
| 414 | Ga0496106_0008756 | 3300048909 | Bacteria | 7479 |
| 415 | Ga0496106_0096534 | 3300048909 | Bacteria | 2287 |
| 416 | Ga0496106_0580143 | 3300048909 | Bacteria | 899 |
| 417 | Ga0496107_0067333 | 3300048910 | Bacteria | 2598 |
| 418 | Ga0496107_0070336 | 3300048910 | Bacteria | 2540 |
| 419 | Ga0496108_0002640 | 3300048911 | Bacteria | 14365 |
| 420 | Ga0496108_0025410 | 3300048911 | Bacteria | 4881 |
| 421 | Ga0496108_0061696 | 3300048911 | Bacteria | 3156 |
| 422 | Ga0496109_0039242 | 3300048912 | Bacteria | 4285 |
| 423 | Ga0496109_1557405 | 3300048912 | Bacteria | 595 |
| 424 | Ga0496110_0021301 | 3300048913 | Bacteria | 5486 |
| 425 | Ga0496110_0071118 | 3300048913 | Bacteria | 3084 |
| 426 | Ga0496111_0040080 | 3300048914 | Bacteria | 3360 |
| 427 | Ga0496111_0063449 | 3300048914 | Bacteria | 2679 |
| 428 | Ga0496111_0118540 | 3300048914 | Bacteria | 1954 |
| 429 | Ga0496111_0428386 | 3300048914 | Bacteria | 977 |
| 430 | Ga0496112_0000059 | 3300048915 | Bacteria | 74946 |
| 431 | Ga0496112_0037238 | 3300048915 | Bacteria | 4748 |
| 432 | Ga0496112_0054565 | 3300048915 | Bacteria | 3926 |
| 433 | Ga0496112_0534192 | 3300048915 | Bacteria | 1107 |
| 434 | Ga0496112_1060228 | 3300048915 | Bacteria | 729 |
| 435 | Ga0496113_0025039 | 3300048916 | Bacteria | 4249 |
| 436 | Ga0496113_0027493 | 3300048916 | Bacteria | 4079 |
| 437 | Ga0496113_0102542 | 3300048916 | Bacteria | 2219 |
| 438 | Ga0496114_0006343 | 3300048917 | Bacteria | 9307 |
| 439 | Ga0496114_0085051 | 3300048917 | Bacteria | 2679 |
| 440 | Ga0496114_0140466 | 3300048917 | Bacteria | 2091 |
| 441 | Ga0496114_0229387 | 3300048917 | Bacteria | 1631 |
| 442 | Ga0496114_0363606 | 3300048917 | Bacteria | 1280 |
| 443 | Ga0496115_0001279 | 3300048918 | Bacteria | 18002 |
| 444 | Ga0496115_0057665 | 3300048918 | Bacteria | 3124 |
| 445 | Ga0496115_0200370 | 3300048918 | Bacteria | 1649 |
| 446 | Ga0496115_0244761 | 3300048918 | Bacteria | 1478 |
| 447 | Ga0496115_0298740 | 3300048918 | Bacteria | 1320 |
| 448 | Ga0496115_0325291 | 3300048918 | Bacteria | 1257 |
| 449 | Ga0496115_0456210 | 3300048918 | Bacteria | 1032 |
| 450 | Ga0496115_0478655 | 3300048918 | Bacteria | 1003 |
| 451 | Ga0496118_0280872 | 3300048921 | Bacteria | 927 |
| 452 | Ga0496121_0000300 | 3300048924 | Bacteria | 102506 |
| 453 | Ga0496121_0054766 | 3300048924 | Bacteria | 3330 |
| 454 | Ga0496121_0103354 | 3300048924 | Bacteria | 2192 |
| 455 | Ga0496121_0276112 | 3300048924 | Bacteria | 1152 |
| 456 | Ga0496126_0011800 | 3300048929 | Bacteria | 8992 |
| 457 | Ga0496126_0029427 | 3300048929 | Bacteria | 5218 |
| 458 | Ga0496126_0115100 | 3300048929 | Bacteria | 2339 |
| 459 | Ga0496126_0136684 | 3300048929 | Bacteria | 2113 |
| 460 | Ga0496126_0205303 | 3300048929 | Bacteria | 1661 |
| 461 | Ga0496126_0220369 | 3300048929 | Bacteria | 1594 |
| 462 | Ga0496126_0240429 | 3300048929 | Bacteria | 1513 |
| 463 | Ga0496126_0316796 | 3300048929 | Bacteria | 1283 |
| 464 | Ga0496126_0580370 | 3300048929 | Bacteria | 886 |
| 465 | Ga0501046_0271486 | 3300049580 | Bacteria | 1244 |
| 466 | Ga0501047_0555089 | 3300049581 | Bacteria | 973 |
| 467 | nmdc:mga0yw44_154926_c1 | 3300050492 | Bacteria | 1497 |
| 468 | nmdc:mga0n895_34674_c1 | 3300050512 | Bacteria | 4860 |
| 469 | nmdc:mga08x19_413730_c1 | 3300050514 | Bacteria | 947 |
| 470 | Ga0495601_0035582 | 3300053077 | Bacteria | 3109 |
| 471 | Ga0495601_0038496 | 3300053077 | Bacteria | 2992 |
| 472 | Ga0495601_0083012 | 3300053077 | Bacteria | 2057 |
| 473 | Ga0495612_0025319 | 3300053078 | Bacteria | 2383 |
| 474 | Ga0495612_0038058 | 3300053078 | Bacteria | 1954 |
| 475 | Ga0495612_0181380 | 3300053078 | Bacteria | 925 |
| 476 | Ga0500635_0003001 | 3300053080 | Bacteria | 4204 |
| 477 | Ga0495595_0052569 | 3300053084 | Bacteria | 1890 |
| 478 | Ga0495595_0114225 | 3300053084 | Bacteria | 1311 |
| 479 | Ga0495619_0022919 | 3300053085 | Bacteria | 3997 |
| 480 | Ga0495619_0064822 | 3300053085 | Bacteria | 2436 |
| 481 | Ga0495619_0439520 | 3300053085 | Bacteria | 900 |
| 482 | Ga0500566_0347466 | 3300053094 | Bacteria | 681 |
| 483 | Ga0500556_0024589 | 3300053104 | Bacteria | 1980 |
| 484 | Ga0500595_003666 | 3300053119 | Bacteria | 7109 |
| 485 | Ga0500568_0004707 | 3300053139 | Bacteria | 7240 |
| 486 | Ga0500603_000154 | 3300053150 | Bacteria | 16931 |
| 487 | Ga0500637_0000127 | 3300053178 | Bacteria | 27567 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025898 | Ga0207692_10152064 | Ga0207692_101520642 | 175 |
| 2 | 3300009093 | Ga0105240_10007748 | Ga0105240_1000774810 | 176 |
| 3 | 3300010375 | Ga0105239_10130036 | Ga0105239_101300363 | 176 |
| 4 | 3300025905 | Ga0207685_10166268 | Ga0207685_101662682 | 176 |
| 5 | iso_pu_bacteria | 2508501128 | 2509151126 | 176 |
| 6 | iso_pu_bacteria | 2513237096 | 2513661195 | 176 |
| 7 | iso_pu_bacteria | 2513237137 | 2513860398 | 176 |
| 8 | iso_pu_bacteria | 2513237145 | 2513922833 | 176 |
| 9 | iso_pu_bacteria | 2517572143 | 2517894130 | 176 |
| 10 | iso_pu_bacteria | 2524023228 | 2524536144 | 176 |
| 11 | iso_pu_bacteria | 2667528175 | 2671123447 | 176 |
| 12 | iso_pu_bacteria | 2728368998 | 2728749499 | 176 |
| 13 | iso_pu_bacteria | 2791355197 | 2793073111 | 176 |
| 14 | iso_pu_bacteria | 2885374607 | 2885379147 | 176 |
| 15 | iso_pu_bacteria | 2903748898 | 2903751305 | 176 |
| 16 | iso_pu_bacteria | 2904690495 | 2904697448 | 176 |
| 17 | iso_pu_bacteria | 2904699407 | 2904705245 | 176 |
| 18 | iso_pu_bacteria | 2906610324 | 2906610938 | 176 |
| 19 | iso_pu_bacteria | 2906635258 | 2906639594 | 176 |
| 20 | iso_pu_bacteria | 2906660503 | 2906661740 | 176 |
| 21 | iso_pu_bacteria | 2908739725 | 2908744458 | 176 |
| 22 | iso_pu_bacteria | 2908756301 | 2908762096 | 176 |
| 23 | iso_pu_bacteria | 2922425934 | 2922428381 | 176 |
| 24 | iso_pu_bacteria | 2935630451 | 2935637859 | 176 |
| 25 | iso_pu_bacteria | 2941507105 | 2941514532 | 176 |
| 26 | iso_pu_bacteria | 2941515067 | 2941522428 | 176 |
| 27 | iso_pu_bacteria | 2941523033 | 2941530299 | 176 |
| 28 | iso_pu_bacteria | 3005474847 | 3005478371 | 176 |
| 29 | iso_pu_bacteria | 8006933436 | 8006942860 | 176 |
| 30 | iso_pu_bacteria | 8006973647 | 8006982579 | 176 |
| 31 | iso_pu_bacteria | 8019565922 | 8019566675 | 176 |
| 32 | iso_pu_bacteria | 8056689827 | 8056691710 | 176 |
| 33 | 3300005435 | Ga0070714_100059084 | Ga0070714_1000590843 | 177 |
| 34 | 3300005435 | Ga0070714_100172527 | Ga0070714_1001725272 | 177 |
| 35 | 3300005436 | Ga0070713_100040482 | Ga0070713_1000404823 | 177 |
| 36 | 3300005436 | Ga0070713_100203434 | Ga0070713_1002034342 | 177 |
| 37 | 3300005437 | Ga0070710_10080519 | Ga0070710_100805194 | 177 |
| 38 | 3300005614 | Ga0068856_100492933 | Ga0068856_1004929332 | 177 |
| 39 | 3300006028 | Ga0070717_10011341 | Ga0070717_100113413 | 177 |
| 40 | 3300006028 | Ga0070717_10033177 | Ga0070717_100331775 | 177 |
| 41 | 3300006163 | Ga0070715_10020502 | Ga0070715_100205023 | 177 |
| 42 | 3300007265 | Ga0099794_10029028 | Ga0099794_100290282 | 177 |
| 43 | 3300007265 | Ga0099794_10158442 | Ga0099794_101584422 | 177 |
| 44 | 3300009093 | Ga0105240_10021481 | Ga0105240_100214818 | 177 |
| 45 | 3300009553 | Ga0105249_10435902 | Ga0105249_104359021 | 177 |
| 46 | 3300010375 | Ga0105239_10778468 | Ga0105239_107784682 | 177 |
| 47 | 3300013306 | Ga0163162_10579958 | Ga0163162_105799582 | 177 |
| 48 | 3300025905 | Ga0207685_10203488 | Ga0207685_102034882 | 177 |
| 49 | 3300025913 | Ga0207695_10134238 | Ga0207695_101342381 | 177 |
| 50 | 3300025915 | Ga0207693_10367364 | Ga0207693_103673642 | 177 |
| 51 | 3300025915 | Ga0207693_10409355 | Ga0207693_104093552 | 177 |
| 52 | 3300025929 | Ga0207664_10051264 | Ga0207664_100512642 | 177 |
| 53 | 3300025939 | Ga0207665_10009625 | Ga0207665_100096255 | 177 |
| 54 | 3300025939 | Ga0207665_10867526 | Ga0207665_108675261 | 177 |
| 55 | 3300025949 | Ga0207667_10475839 | Ga0207667_104758391 | 177 |
| 56 | 3300027512 | Ga0209179_1082303 | Ga0209179_10823032 | 177 |
| 57 | 3300027671 | Ga0209588_1060488 | Ga0209588_10604881 | 177 |
| 58 | 3300031712 | Ga0265342_10031302 | Ga0265342_100313024 | 177 |
| 59 | 3300035724 | Ga0373933_0000159 | Ga0373933_0000159_29136_29669 | 177 |
| 60 | 3300044694 | Ga0466963_0062167 | Ga0466963_0062167_1831_2364 | 177 |
| 61 | 3300046475 | Ga0495639_0108009 | Ga0495639_0108009_573_1106 | 177 |
| 62 | 3300046477 | Ga0495664_0050295 | Ga0495664_0050295_981_1514 | 177 |
| 63 | 3300046507 | Ga0495606_0000992 | Ga0495606_0000992_26668_27201 | 177 |
| 64 | 3300046543 | Ga0495645_0278298 | Ga0495645_0278298_519_1052 | 177 |
| 65 | 3300046683 | Ga0495658_0390047 | Ga0495658_0390047_302_835 | 177 |
| 66 | 3300046689 | Ga0495613_0326789 | Ga0495613_0326789_428_961 | 177 |
| 67 | 3300048905 | Ga0496102_0202795 | Ga0496102_0202795_241_774 | 177 |
| 68 | 3300048905 | Ga0496102_0979793 | Ga0496102_0979793_71_604 | 177 |
| 69 | 3300048907 | Ga0496104_0695003 | Ga0496104_0695003_367_900 | 177 |
| 70 | 3300048914 | Ga0496111_0428386 | Ga0496111_0428386_32_565 | 177 |
| 71 | 3300048915 | Ga0496112_1060228 | Ga0496112_1060228_67_600 | 177 |
| 72 | 3300048917 | Ga0496114_0085051 | Ga0496114_0085051_97_630 | 177 |
| 73 | 3300048918 | Ga0496115_0298740 | Ga0496115_0298740_292_825 | 177 |
| 74 | 3300048918 | Ga0496115_0478655 | Ga0496115_0478655_323_856 | 177 |
| 75 | 3300048921 | Ga0496118_0280872 | Ga0496118_0280872_220_753 | 177 |
| 76 | 3300048929 | Ga0496126_0011800 | Ga0496126_0011800_764_1303 | 177 |
| 77 | 3300048929 | Ga0496126_0205303 | Ga0496126_0205303_1092_1625 | 177 |
| 78 | 3300006038 | Ga0075365_10064551 | Ga0075365_100645512 | 178 |
| 79 | 3300050492 | nmdc:mga0yw44_154926_c1 | nmdc:mga0yw44_154926_c1_543_1079 | 178 |
| 80 | 3300005614 | Ga0068856_100000363 | Ga0068856_10000036315 | 179 |
| 81 | 3300026078 | Ga0207702_10000261 | Ga0207702_1000026159 | 179 |
| 82 | 3300048903 | Ga0496100_0099850 | Ga0496100_0099850_510_1070 | 179 |
| 83 | 3300048905 | Ga0496102_0555129 | Ga0496102_0555129_108_668 | 179 |
| 84 | 3300048909 | Ga0496106_0008756 | Ga0496106_0008756_3651_4211 | 179 |
| 85 | 3300048910 | Ga0496107_0067333 | Ga0496107_0067333_493_1053 | 179 |
| 86 | 3300048911 | Ga0496108_0002640 | Ga0496108_0002640_5006_5566 | 179 |
| 87 | 3300048913 | Ga0496110_0021301 | Ga0496110_0021301_3760_4320 | 179 |
| 88 | 3300048914 | Ga0496111_0040080 | Ga0496111_0040080_2334_2894 | 179 |
| 89 | 3300048916 | Ga0496113_0102542 | Ga0496113_0102542_554_1114 | 179 |
| 90 | 3300048917 | Ga0496114_0363606 | Ga0496114_0363606_143_703 | 179 |
| 91 | 3300048929 | Ga0496126_0240429 | Ga0496126_0240429_310_885 | 179 |
| 92 | 3300048929 | Ga0496126_0580370 | Ga0496126_0580370_244_786 | 179 |
| 93 | 3300053078 | Ga0495612_0181380 | Ga0495612_0181380_143_685 | 179 |
| 94 | 3300000549 | LJQas_1001531 | LJQas_10015312 | 180 |
| 95 | 3300003203 | JGI25406J46586_10000048 | JGI25406J46586_1000004810 | 180 |
| 96 | 3300005327 | Ga0070658_10007221 | Ga0070658_100072216 | 180 |
| 97 | 3300005328 | Ga0070676_10316315 | Ga0070676_103163151 | 180 |
| 98 | 3300005329 | Ga0070683_100015758 | Ga0070683_1000157585 | 180 |
| 99 | 3300005329 | Ga0070683_100657065 | Ga0070683_1006570652 | 180 |
| 100 | 3300005336 | Ga0070680_100044116 | Ga0070680_1000441163 | 180 |
| 101 | 3300005336 | Ga0070680_100046072 | Ga0070680_1000460723 | 180 |
| 102 | 3300005337 | Ga0070682_100882692 | Ga0070682_1008826921 | 180 |
| 103 | 3300005338 | Ga0068868_100073585 | Ga0068868_1000735851 | 180 |
| 104 | 3300005338 | Ga0068868_101208330 | Ga0068868_1012083301 | 180 |
| 105 | 3300005339 | Ga0070660_100008957 | Ga0070660_1000089574 | 180 |
| 106 | 3300005341 | Ga0070691_10059388 | Ga0070691_100593882 | 180 |
| 107 | 3300005344 | Ga0070661_100611679 | Ga0070661_1006116791 | 180 |
| 108 | 3300005364 | Ga0070673_100157709 | Ga0070673_1001577092 | 180 |
| 109 | 3300005366 | Ga0070659_100037727 | Ga0070659_1000377272 | 180 |
| 110 | 3300005366 | Ga0070659_100433794 | Ga0070659_1004337941 | 180 |
| 111 | 3300005434 | Ga0070709_10082451 | Ga0070709_100824512 | 180 |
| 112 | 3300005434 | Ga0070709_10339556 | Ga0070709_103395562 | 180 |
| 113 | 3300005435 | Ga0070714_100026993 | Ga0070714_1000269934 | 180 |
| 114 | 3300005436 | Ga0070713_100045688 | Ga0070713_1000456883 | 180 |
| 115 | 3300005436 | Ga0070713_100372657 | Ga0070713_1003726572 | 180 |
| 116 | 3300005436 | Ga0070713_100419390 | Ga0070713_1004193901 | 180 |
| 117 | 3300005437 | Ga0070710_10044379 | Ga0070710_100443792 | 180 |
| 118 | 3300005437 | Ga0070710_10375488 | Ga0070710_103754882 | 180 |
| 119 | 3300005438 | Ga0070701_10540171 | Ga0070701_105401711 | 180 |
| 120 | 3300005439 | Ga0070711_100035807 | Ga0070711_1000358071 | 180 |
| 121 | 3300005439 | Ga0070711_100068940 | Ga0070711_1000689401 | 180 |
| 122 | 3300005439 | Ga0070711_100654796 | Ga0070711_1006547962 | 180 |
| 123 | 3300005444 | Ga0070694_100508704 | Ga0070694_1005087042 | 180 |
| 124 | 3300005455 | Ga0070663_100366659 | Ga0070663_1003666591 | 180 |
| 125 | 3300005456 | Ga0070678_100017123 | Ga0070678_1000171233 | 180 |
| 126 | 3300005458 | Ga0070681_10016205 | Ga0070681_100162055 | 180 |
| 127 | 3300005458 | Ga0070681_10053286 | Ga0070681_100532865 | 180 |
| 128 | 3300005458 | Ga0070681_10249855 | Ga0070681_102498551 | 180 |
| 129 | 3300005458 | Ga0070681_10412465 | Ga0070681_104124653 | 180 |
| 130 | 3300005518 | Ga0070699_101536545 | Ga0070699_1015365451 | 180 |
| 131 | 3300005530 | Ga0070679_100059711 | Ga0070679_1000597113 | 180 |
| 132 | 3300005530 | Ga0070679_100169308 | Ga0070679_1001693082 | 180 |
| 133 | 3300005530 | Ga0070679_100634643 | Ga0070679_1006346432 | 180 |
| 134 | 3300005535 | Ga0070684_100010386 | Ga0070684_1000103865 | 180 |
| 135 | 3300005535 | Ga0070684_100163562 | Ga0070684_1001635622 | 180 |
| 136 | 3300005535 | Ga0070684_100274609 | Ga0070684_1002746092 | 180 |
| 137 | 3300005536 | Ga0070697_100034479 | Ga0070697_1000344792 | 180 |
| 138 | 3300005539 | Ga0068853_100005857 | Ga0068853_1000058574 | 180 |
| 139 | 3300005539 | Ga0068853_100179608 | Ga0068853_1001796082 | 180 |
| 140 | 3300005543 | Ga0070672_100044440 | Ga0070672_1000444404 | 180 |
| 141 | 3300005547 | Ga0070693_100036267 | Ga0070693_1000362672 | 180 |
| 142 | 3300005547 | Ga0070693_100213624 | Ga0070693_1002136242 | 180 |
| 143 | 3300005548 | Ga0070665_100357265 | Ga0070665_1003572652 | 180 |
| 144 | 3300005548 | Ga0070665_100426370 | Ga0070665_1004263702 | 180 |
| 145 | 3300005563 | Ga0068855_100061371 | Ga0068855_1000613712 | 180 |
| 146 | 3300005563 | Ga0068855_100089033 | Ga0068855_1000890333 | 180 |
| 147 | 3300005563 | Ga0068855_100195041 | Ga0068855_1001950412 | 180 |
| 148 | 3300005563 | Ga0068855_100481317 | Ga0068855_1004813172 | 180 |
| 149 | 3300005563 | Ga0068855_100574937 | Ga0068855_1005749371 | 180 |
| 150 | 3300005563 | Ga0068855_100608270 | Ga0068855_1006082701 | 180 |
| 151 | 3300005564 | Ga0070664_100026331 | Ga0070664_1000263315 | 180 |
| 152 | 3300005564 | Ga0070664_100370084 | Ga0070664_1003700842 | 180 |
| 153 | 3300005577 | Ga0068857_100037942 | Ga0068857_1000379427 | 180 |
| 154 | 3300005577 | Ga0068857_101688286 | Ga0068857_1016882861 | 180 |
| 155 | 3300005578 | Ga0068854_100068908 | Ga0068854_1000689084 | 180 |
| 156 | 3300005578 | Ga0068854_100228709 | Ga0068854_1002287091 | 180 |
| 157 | 3300005614 | Ga0068856_100283694 | Ga0068856_1002836942 | 180 |
| 158 | 3300005616 | Ga0068852_100005807 | Ga0068852_1000058072 | 180 |
| 159 | 3300005616 | Ga0068852_100101036 | Ga0068852_1001010361 | 180 |
| 160 | 3300005616 | Ga0068852_100551489 | Ga0068852_1005514891 | 180 |
| 161 | 3300005618 | Ga0068864_100111252 | Ga0068864_1001112522 | 180 |
| 162 | 3300005618 | Ga0068864_100151419 | Ga0068864_1001514192 | 180 |
| 163 | 3300005834 | Ga0068851_10106177 | Ga0068851_101061771 | 180 |
| 164 | 3300005841 | Ga0068863_100291498 | Ga0068863_1002914982 | 180 |
| 165 | 3300005842 | Ga0068858_100185117 | Ga0068858_1001851172 | 180 |
| 166 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008279 | 180 |
| 167 | 3300006028 | Ga0070717_10065485 | Ga0070717_100654852 | 180 |
| 168 | 3300006028 | Ga0070717_10091712 | Ga0070717_100917121 | 180 |
| 169 | 3300006173 | Ga0070716_100127145 | Ga0070716_1001271452 | 180 |
| 170 | 3300006175 | Ga0070712_100071504 | Ga0070712_1000715042 | 180 |
| 171 | 3300006175 | Ga0070712_100076644 | Ga0070712_1000766441 | 180 |
| 172 | 3300006175 | Ga0070712_100092377 | Ga0070712_1000923772 | 180 |
| 173 | 3300006358 | Ga0068871_100309654 | Ga0068871_1003096542 | 180 |
| 174 | 3300006881 | Ga0068865_100321509 | Ga0068865_1003215092 | 180 |
| 175 | 3300006914 | Ga0075436_100360435 | Ga0075436_1003604351 | 180 |
| 176 | 3300006942 | Ga0099824_1002915 | Ga0099824_10029155 | 180 |
| 177 | 3300006943 | Ga0099822_1012763 | Ga0099822_10127639 | 180 |
| 178 | 3300007265 | Ga0099794_10066616 | Ga0099794_100666161 | 180 |
| 179 | 3300009093 | Ga0105240_10048119 | Ga0105240_100481196 | 180 |
| 180 | 3300009098 | Ga0105245_10163512 | Ga0105245_101635123 | 180 |
| 181 | 3300009098 | Ga0105245_10401668 | Ga0105245_104016682 | 180 |
| 182 | 3300009101 | Ga0105247_10393835 | Ga0105247_103938351 | 180 |
| 183 | 3300009148 | Ga0105243_10241271 | Ga0105243_102412713 | 180 |
| 184 | 3300009174 | Ga0105241_10090138 | Ga0105241_100901383 | 180 |
| 185 | 3300009174 | Ga0105241_10519226 | Ga0105241_105192262 | 180 |
| 186 | 3300009174 | Ga0105241_10758124 | Ga0105241_107581241 | 180 |
| 187 | 3300009177 | Ga0105248_10294518 | Ga0105248_102945181 | 180 |
| 188 | 3300009545 | Ga0105237_10006757 | Ga0105237_100067579 | 180 |
| 189 | 3300009545 | Ga0105237_10011809 | Ga0105237_100118094 | 180 |
| 190 | 3300009545 | Ga0105237_10023711 | Ga0105237_100237119 | 180 |
| 191 | 3300009545 | Ga0105237_10445308 | Ga0105237_104453082 | 180 |
| 192 | 3300009545 | Ga0105237_10903519 | Ga0105237_109035191 | 180 |
| 193 | 3300009551 | Ga0105238_10002692 | Ga0105238_1000269211 | 180 |
| 194 | 3300009551 | Ga0105238_10101590 | Ga0105238_101015905 | 180 |
| 195 | 3300009551 | Ga0105238_10276364 | Ga0105238_102763642 | 180 |
| 196 | 3300009551 | Ga0105238_10448996 | Ga0105238_104489962 | 180 |
| 197 | 3300009551 | Ga0105238_11308374 | Ga0105238_113083741 | 180 |
| 198 | 3300010159 | Ga0099796_10133054 | Ga0099796_101330542 | 180 |
| 199 | 3300010375 | Ga0105239_10012853 | Ga0105239_100128534 | 180 |
| 200 | 3300010375 | Ga0105239_10199854 | Ga0105239_101998542 | 180 |
| 201 | 3300010375 | Ga0105239_10483694 | Ga0105239_104836942 | 180 |
| 202 | 3300011119 | Ga0105246_10028122 | Ga0105246_100281221 | 180 |
| 203 | 3300011119 | Ga0105246_10245880 | Ga0105246_102458802 | 180 |
| 204 | 3300013104 | Ga0157370_10142251 | Ga0157370_101422512 | 180 |
| 205 | 3300013104 | Ga0157370_10217616 | Ga0157370_102176163 | 180 |
| 206 | 3300013105 | Ga0157369_10004292 | Ga0157369_100042924 | 180 |
| 207 | 3300013105 | Ga0157369_10008116 | Ga0157369_100081166 | 180 |
| 208 | 3300013105 | Ga0157369_10230394 | Ga0157369_102303942 | 180 |
| 209 | 3300013105 | Ga0157369_10335451 | Ga0157369_103354512 | 180 |
| 210 | 3300013105 | Ga0157369_10451308 | Ga0157369_104513081 | 180 |
| 211 | 3300013105 | Ga0157369_10975752 | Ga0157369_109757522 | 180 |
| 212 | 3300013296 | Ga0157374_10028994 | Ga0157374_100289945 | 180 |
| 213 | 3300013297 | Ga0157378_10237044 | Ga0157378_102370442 | 180 |
| 214 | 3300013306 | Ga0163162_10010007 | Ga0163162_1001000710 | 180 |
| 215 | 3300013306 | Ga0163162_10074878 | Ga0163162_100748783 | 180 |
| 216 | 3300013306 | Ga0163162_10217908 | Ga0163162_102179082 | 180 |
| 217 | 3300013307 | Ga0157372_10037750 | Ga0157372_100377505 | 180 |
| 218 | 3300013307 | Ga0157372_10196810 | Ga0157372_101968104 | 180 |
| 219 | 3300013307 | Ga0157372_10332291 | Ga0157372_103322913 | 180 |
| 220 | 3300013308 | Ga0157375_10036503 | Ga0157375_100365033 | 180 |
| 221 | 3300014325 | Ga0163163_10004103 | Ga0163163_100041038 | 180 |
| 222 | 3300014326 | Ga0157380_11222064 | Ga0157380_112220642 | 180 |
| 223 | 3300014745 | Ga0157377_10424403 | Ga0157377_104244032 | 180 |
| 224 | 3300014969 | Ga0157376_10006130 | Ga0157376_100061305 | 180 |
| 225 | 3300014969 | Ga0157376_11627914 | Ga0157376_116279141 | 180 |
| 226 | 3300020070 | Ga0206356_10910912 | Ga0206356_109109122 | 180 |
| 227 | 3300020070 | Ga0206356_11251455 | Ga0206356_112514552 | 180 |
| 228 | 3300021384 | Ga0213876_10049984 | Ga0213876_100499842 | 180 |
| 229 | 3300025261 | Ga0209233_1001233 | Ga0209233_10012335 | 180 |
| 230 | 3300025321 | Ga0207656_10348292 | Ga0207656_103482921 | 180 |
| 231 | 3300025900 | Ga0207710_10478654 | Ga0207710_104786541 | 180 |
| 232 | 3300025904 | Ga0207647_10138605 | Ga0207647_101386052 | 180 |
| 233 | 3300025905 | Ga0207685_10109196 | Ga0207685_101091962 | 180 |
| 234 | 3300025906 | Ga0207699_10067450 | Ga0207699_100674502 | 180 |
| 235 | 3300025906 | Ga0207699_10258155 | Ga0207699_102581552 | 180 |
| 236 | 3300025907 | Ga0207645_10364131 | Ga0207645_103641311 | 180 |
| 237 | 3300025909 | Ga0207705_10012662 | Ga0207705_100126625 | 180 |
| 238 | 3300025909 | Ga0207705_10715385 | Ga0207705_107153851 | 180 |
| 239 | 3300025910 | Ga0207684_10962078 | Ga0207684_109620781 | 180 |
| 240 | 3300025911 | Ga0207654_10074113 | Ga0207654_100741131 | 180 |
| 241 | 3300025912 | Ga0207707_10015318 | Ga0207707_100153182 | 180 |
| 242 | 3300025912 | Ga0207707_10040760 | Ga0207707_100407602 | 180 |
| 243 | 3300025912 | Ga0207707_10121346 | Ga0207707_101213462 | 180 |
| 244 | 3300025912 | Ga0207707_10342301 | Ga0207707_103423012 | 180 |
| 245 | 3300025913 | Ga0207695_10021731 | Ga0207695_100217312 | 180 |
| 246 | 3300025913 | Ga0207695_10160882 | Ga0207695_101608822 | 180 |
| 247 | 3300025913 | Ga0207695_10177540 | Ga0207695_101775402 | 180 |
| 248 | 3300025914 | Ga0207671_10041126 | Ga0207671_100411264 | 180 |
| 249 | 3300025914 | Ga0207671_10139527 | Ga0207671_101395272 | 180 |
| 250 | 3300025914 | Ga0207671_10180431 | Ga0207671_101804311 | 180 |
| 251 | 3300025914 | Ga0207671_10186464 | Ga0207671_101864642 | 180 |
| 252 | 3300025914 | Ga0207671_10503803 | Ga0207671_105038031 | 180 |
| 253 | 3300025914 | Ga0207671_10523695 | Ga0207671_105236951 | 180 |
| 254 | 3300025915 | Ga0207693_10018039 | Ga0207693_100180392 | 180 |
| 255 | 3300025915 | Ga0207693_10033278 | Ga0207693_100332782 | 180 |
| 256 | 3300025915 | Ga0207693_10152028 | Ga0207693_101520283 | 180 |
| 257 | 3300025916 | Ga0207663_10004056 | Ga0207663_100040562 | 180 |
| 258 | 3300025917 | Ga0207660_10028890 | Ga0207660_100288904 | 180 |
| 259 | 3300025917 | Ga0207660_10063549 | Ga0207660_100635493 | 180 |
| 260 | 3300025917 | Ga0207660_10179064 | Ga0207660_101790642 | 180 |
| 261 | 3300025917 | Ga0207660_10437215 | Ga0207660_104372152 | 180 |
| 262 | 3300025917 | Ga0207660_10539576 | Ga0207660_105395761 | 180 |
| 263 | 3300025919 | Ga0207657_10034539 | Ga0207657_100345392 | 180 |
| 264 | 3300025919 | Ga0207657_10314397 | Ga0207657_103143972 | 180 |
| 265 | 3300025921 | Ga0207652_10056918 | Ga0207652_100569181 | 180 |
| 266 | 3300025921 | Ga0207652_10064077 | Ga0207652_100640773 | 180 |
| 267 | 3300025921 | Ga0207652_10066101 | Ga0207652_100661013 | 180 |
| 268 | 3300025921 | Ga0207652_10172646 | Ga0207652_101726462 | 180 |
| 269 | 3300025924 | Ga0207694_10259191 | Ga0207694_102591913 | 180 |
| 270 | 3300025926 | Ga0207659_10649219 | Ga0207659_106492192 | 180 |
| 271 | 3300025927 | Ga0207687_10200730 | Ga0207687_102007303 | 180 |
| 272 | 3300025927 | Ga0207687_10296829 | Ga0207687_102968292 | 180 |
| 273 | 3300025928 | Ga0207700_10097557 | Ga0207700_100975573 | 180 |
| 274 | 3300025928 | Ga0207700_10256597 | Ga0207700_102565972 | 180 |
| 275 | 3300025928 | Ga0207700_10267481 | Ga0207700_102674811 | 180 |
| 276 | 3300025934 | Ga0207686_10841937 | Ga0207686_108419371 | 180 |
| 277 | 3300025938 | Ga0207704_10672753 | Ga0207704_106727532 | 180 |
| 278 | 3300025939 | Ga0207665_10105006 | Ga0207665_101050064 | 180 |
| 279 | 3300025940 | Ga0207691_10094970 | Ga0207691_100949702 | 180 |
| 280 | 3300025942 | Ga0207689_10183786 | Ga0207689_101837862 | 180 |
| 281 | 3300025944 | Ga0207661_10001312 | Ga0207661_1000131212 | 180 |
| 282 | 3300025944 | Ga0207661_10019448 | Ga0207661_100194483 | 180 |
| 283 | 3300025944 | Ga0207661_10162045 | Ga0207661_101620452 | 180 |
| 284 | 3300025944 | Ga0207661_10582610 | Ga0207661_105826102 | 180 |
| 285 | 3300025945 | Ga0207679_10048078 | Ga0207679_100480782 | 180 |
| 286 | 3300025949 | Ga0207667_10073039 | Ga0207667_100730392 | 180 |
| 287 | 3300025949 | Ga0207667_10162936 | Ga0207667_101629362 | 180 |
| 288 | 3300025949 | Ga0207667_10207601 | Ga0207667_102076011 | 180 |
| 289 | 3300025949 | Ga0207667_10317367 | Ga0207667_103173673 | 180 |
| 290 | 3300025981 | Ga0207640_10189323 | Ga0207640_101893233 | 180 |
| 291 | 3300025981 | Ga0207640_11182924 | Ga0207640_111829241 | 180 |
| 292 | 3300026023 | Ga0207677_11011456 | Ga0207677_110114561 | 180 |
| 293 | 3300026035 | Ga0207703_10711951 | Ga0207703_107119511 | 180 |
| 294 | 3300026041 | Ga0207639_10017229 | Ga0207639_100172293 | 180 |
| 295 | 3300026041 | Ga0207639_10377992 | Ga0207639_103779923 | 180 |
| 296 | 3300026067 | Ga0207678_10011003 | Ga0207678_100110032 | 180 |
| 297 | 3300026078 | Ga0207702_10182239 | Ga0207702_101822392 | 180 |
| 298 | 3300026088 | Ga0207641_10739890 | Ga0207641_107398902 | 180 |
| 299 | 3300026095 | Ga0207676_10110007 | Ga0207676_101100072 | 180 |
| 300 | 3300026116 | Ga0207674_10028112 | Ga0207674_100281127 | 180 |
| 301 | 3300026121 | Ga0207683_10206076 | Ga0207683_102060762 | 180 |
| 302 | 3300026142 | Ga0207698_10062739 | Ga0207698_100627392 | 180 |
| 303 | 3300026142 | Ga0207698_10068099 | Ga0207698_100680992 | 180 |
| 304 | 3300026142 | Ga0207698_10641720 | Ga0207698_106417201 | 180 |
| 305 | 3300027357 | Ga0209589_1000004 | Ga0209589_10000048 | 180 |
| 306 | 3300027361 | Ga0209489_100004 | Ga0209489_1000048 | 180 |
| 307 | 3300027363 | Ga0209700_100004 | Ga0209700_1000048 | 180 |
| 308 | 3300028573 | Ga0265334_10030027 | Ga0265334_100300272 | 180 |
| 309 | 3300031238 | Ga0265332_10006468 | Ga0265332_100064686 | 180 |
| 310 | 3300031239 | Ga0265328_10211662 | Ga0265328_102116621 | 180 |
| 311 | 3300031247 | Ga0265340_10013940 | Ga0265340_100139406 | 180 |
| 312 | 3300031247 | Ga0265340_10098077 | Ga0265340_100980771 | 180 |
| 313 | 3300031249 | Ga0265339_10011794 | Ga0265339_100117945 | 180 |
| 314 | 3300031249 | Ga0265339_10152007 | Ga0265339_101520071 | 180 |
| 315 | 3300031250 | Ga0265331_10074035 | Ga0265331_100740352 | 180 |
| 316 | 3300031616 | Ga0307508_10001617 | Ga0307508_1000161712 | 180 |
| 317 | 3300031616 | Ga0307508_10106805 | Ga0307508_101068054 | 180 |
| 318 | 3300031712 | Ga0265342_10087235 | Ga0265342_100872351 | 180 |
| 319 | 3300031712 | Ga0265342_10133107 | Ga0265342_101331072 | 180 |
| 320 | 3300033180 | Ga0307510_10026735 | Ga0307510_100267355 | 180 |
| 321 | 3300033442 | Ga0315911_1000011 | Ga0315911_1000011237 | 180 |
| 322 | 3300033544 | Ga0316215_1004538 | Ga0316215_10045382 | 180 |
| 323 | 3300033544 | Ga0316215_1015855 | Ga0316215_10158551 | 180 |
| 324 | 3300035083 | Ga0373926_0009066 | Ga0373926_0009066_50_592 | 180 |
| 325 | 3300035084 | Ga0373928_0114881 | Ga0373928_0114881_85_627 | 180 |
| 326 | 3300035086 | Ga0373934_0001081 | Ga0373934_0001081_8483_9025 | 180 |
| 327 | 3300035086 | Ga0373934_0158005 | Ga0373934_0158005_68_610 | 180 |
| 328 | 3300035089 | Ga0373944_0009877 | Ga0373944_0009877_1691_2233 | 180 |
| 329 | 3300035111 | Ga0373923_0009768 | Ga0373923_0009768_758_1300 | 180 |
| 330 | 3300035111 | Ga0373923_0025745 | Ga0373923_0025745_160_702 | 180 |
| 331 | 3300035112 | Ga0373932_0102275 | Ga0373932_0102275_153_695 | 180 |
| 332 | 3300035113 | Ga0373936_0011831 | Ga0373936_0011831_446_988 | 180 |
| 333 | 3300035117 | Ga0373953_0027234 | Ga0373953_0027234_1605_2147 | 180 |
| 334 | 3300035117 | Ga0373953_0028946 | Ga0373953_0028946_1544_2086 | 180 |
| 335 | 3300035118 | Ga0373954_0008459 | Ga0373954_0008459_2295_2837 | 180 |
| 336 | 3300035119 | Ga0373956_0014367 | Ga0373956_0014367_1816_2358 | 180 |
| 337 | 3300035120 | Ga0373957_0010028 | Ga0373957_0010028_444_986 | 180 |
| 338 | 3300035170 | Ga0373943_0013493 | Ga0373943_0013493_1817_2359 | 180 |
| 339 | 3300035170 | Ga0373943_0130166 | Ga0373943_0130166_369_917 | 180 |
| 340 | 3300035171 | Ga0373946_0008767 | Ga0373946_0008767_1445_1987 | 180 |
| 341 | 3300035172 | Ga0373955_0024390 | Ga0373955_0024390_1902_2444 | 180 |
| 342 | 3300035172 | Ga0373955_0070777 | Ga0373955_0070777_573_1115 | 180 |
| 343 | 3300035172 | Ga0373955_0147914 | Ga0373955_0147914_64_606 | 180 |
| 344 | 3300035410 | Ga0373924_0074161 | Ga0373924_0074161_155_697 | 180 |
| 345 | 3300035692 | Ga0373935_0046996 | Ga0373935_0046996_1071_1613 | 180 |
| 346 | 3300035695 | Ga0373927_0109956 | Ga0373927_0109956_366_908 | 180 |
| 347 | 3300035724 | Ga0373933_0067407 | Ga0373933_0067407_883_1425 | 180 |
| 348 | 3300035724 | Ga0373933_0081634 | Ga0373933_0081634_757_1299 | 180 |
| 349 | 3300035724 | Ga0373933_0232950 | Ga0373933_0232950_288_830 | 180 |
| 350 | 3300035725 | Ga0373947_0056739 | Ga0373947_0056739_995_1537 | 180 |
| 351 | 3300035725 | Ga0373947_0090355 | Ga0373947_0090355_1009_1551 | 180 |
| 352 | 3300035725 | Ga0373947_0215701 | Ga0373947_0215701_417_965 | 180 |
| 353 | 3300036401 | Ga0373937_0030893 | Ga0373937_0030893_107_649 | 180 |
| 354 | 3300036401 | Ga0373937_0293018 | Ga0373937_0293018_149_691 | 180 |
| 355 | 3300036401 | Ga0373937_0300953 | Ga0373937_0300953_647_1189 | 180 |
| 356 | 3300036459 | Ga0372808_003696 | Ga0372808_003696_655_1197 | 180 |
| 357 | 3300037068 | Ga0373925_0070463 | Ga0373925_0070463_1921_2469 | 180 |
| 358 | 3300037068 | Ga0373925_0140935 | Ga0373925_0140935_766_1308 | 180 |
| 359 | 3300037068 | Ga0373925_0169723 | Ga0373925_0169723_1019_1561 | 180 |
| 360 | 3300037418 | Ga0395900_0057479 | Ga0395900_0057479_157_699 | 180 |
| 361 | 3300037418 | Ga0395900_0442408 | Ga0395900_0442408_145_687 | 180 |
| 362 | 3300037466 | Ga0395898_0076506 | Ga0395898_0076506_785_1327 | 180 |
| 363 | 3300037466 | Ga0395898_0505642 | Ga0395898_0505642_71_613 | 180 |
| 364 | 3300037853 | Ga0436364_0384534 | Ga0436364_0384534_4314_4856 | 180 |
| 365 | 3300037853 | Ga0436364_1255264 | Ga0436364_1255264_1878_2420 | 180 |
| 366 | 3300038443 | Ga0395901_0474403 | Ga0395901_0474403_652_1194 | 180 |
| 367 | 3300038443 | Ga0395901_0907886 | Ga0395901_0907886_66_608 | 180 |
| 368 | 3300039437 | Ga0436365_0572673 | Ga0436365_0572673_155_697 | 180 |
| 369 | 3300039437 | Ga0436365_1697229 | Ga0436365_1697229_1885_2427 | 180 |
| 370 | 3300039438 | Ga0436360_0275470 | Ga0436360_0275470_955_1497 | 180 |
| 371 | 3300039447 | Ga0436361_0725474 | Ga0436361_0725474_8857_9399 | 180 |
| 372 | 3300039450 | Ga0436363_0938134 | Ga0436363_0938134_33_575 | 180 |
| 373 | 3300039450 | Ga0436363_1401514 | Ga0436363_1401514_205_747 | 180 |
| 374 | 3300041507 | Ga0451851_0713221 | Ga0451851_0713221_431_973 | 180 |
| 375 | 3300044684 | Ga0466966_0147135 | Ga0466966_0147135_609_1151 | 180 |
| 376 | 3300045049 | Ga0466959_0050741 | Ga0466959_0050741_1840_2403 | 180 |
| 377 | 3300046454 | Ga0495592_0001055 | Ga0495592_0001055_10020_10562 | 180 |
| 378 | 3300046454 | Ga0495592_0057172 | Ga0495592_0057172_915_1457 | 180 |
| 379 | 3300046454 | Ga0495592_0066154 | Ga0495592_0066154_48_590 | 180 |
| 380 | 3300046455 | Ga0495603_0459049 | Ga0495603_0459049_166_708 | 180 |
| 381 | 3300046459 | Ga0495629_0004163 | Ga0495629_0004163_10236_10778 | 180 |
| 382 | 3300046459 | Ga0495629_0040163 | Ga0495629_0040163_776_1318 | 180 |
| 383 | 3300046459 | Ga0495629_0254433 | Ga0495629_0254433_33_575 | 180 |
| 384 | 3300046461 | Ga0495641_0080234 | Ga0495641_0080234_107_649 | 180 |
| 385 | 3300046462 | Ga0495651_0115143 | Ga0495651_0115143_123_665 | 180 |
| 386 | 3300046462 | Ga0495651_0122565 | Ga0495651_0122565_888_1430 | 180 |
| 387 | 3300046463 | Ga0495653_0013831 | Ga0495653_0013831_5994_6536 | 180 |
| 388 | 3300046463 | Ga0495653_0107935 | Ga0495653_0107935_1207_1749 | 180 |
| 389 | 3300046472 | Ga0495580_0023995 | Ga0495580_0023995_1596_2138 | 180 |
| 390 | 3300046473 | Ga0495582_0092591 | Ga0495582_0092591_698_1240 | 180 |
| 391 | 3300046475 | Ga0495639_0004720 | Ga0495639_0004720_798_1340 | 180 |
| 392 | 3300046475 | Ga0495639_0133578 | Ga0495639_0133578_247_789 | 180 |
| 393 | 3300046477 | Ga0495664_0021707 | Ga0495664_0021707_1469_2011 | 180 |
| 394 | 3300046499 | Ga0495594_0259940 | Ga0495594_0259940_276_818 | 180 |
| 395 | 3300046511 | Ga0495608_0007611 | Ga0495608_0007611_1357_1899 | 180 |
| 396 | 3300046511 | Ga0495608_0046596 | Ga0495608_0046596_565_1107 | 180 |
| 397 | 3300046514 | Ga0495618_0028872 | Ga0495618_0028872_1256_1798 | 180 |
| 398 | 3300046514 | Ga0495618_0249246 | Ga0495618_0249246_174_716 | 180 |
| 399 | 3300046516 | Ga0495628_0007764 | Ga0495628_0007764_291_833 | 180 |
| 400 | 3300046516 | Ga0495628_0295854 | Ga0495628_0295854_473_1015 | 180 |
| 401 | 3300046517 | Ga0495630_0494318 | Ga0495630_0494318_298_840 | 180 |
| 402 | 3300046529 | Ga0495652_0093148 | Ga0495652_0093148_661_1203 | 180 |
| 403 | 3300046529 | Ga0495652_0189706 | Ga0495652_0189706_478_1020 | 180 |
| 404 | 3300046533 | Ga0495640_0006867 | Ga0495640_0006867_3350_3892 | 180 |
| 405 | 3300046535 | Ga0495586_0087781 | Ga0495586_0087781_374_916 | 180 |
| 406 | 3300046543 | Ga0495645_0024430 | Ga0495645_0024430_2372_2914 | 180 |
| 407 | 3300046543 | Ga0495645_0097198 | Ga0495645_0097198_380_922 | 180 |
| 408 | 3300046559 | Ga0495667_0137410 | Ga0495667_0137410_216_758 | 180 |
| 409 | 3300046559 | Ga0495667_0202444 | Ga0495667_0202444_164_706 | 180 |
| 410 | 3300046559 | Ga0495667_0409694 | Ga0495667_0409694_211_753 | 180 |
| 411 | 3300046616 | Ga0495668_0065320 | Ga0495668_0065320_1234_1776 | 180 |
| 412 | 3300046642 | Ga0495634_0121474 | Ga0495634_0121474_331_873 | 180 |
| 413 | 3300046642 | Ga0495634_0146073 | Ga0495634_0146073_527_1069 | 180 |
| 414 | 3300046663 | Ga0495635_0010764 | Ga0495635_0010764_1946_2488 | 180 |
| 415 | 3300046663 | Ga0495635_0064224 | Ga0495635_0064224_856_1398 | 180 |
| 416 | 3300046675 | Ga0495657_0052411 | Ga0495657_0052411_216_758 | 180 |
| 417 | 3300046675 | Ga0495657_0066866 | Ga0495657_0066866_25_567 | 180 |
| 418 | 3300046675 | Ga0495657_0599103 | Ga0495657_0599103_58_600 | 180 |
| 419 | 3300046678 | Ga0495599_0196325 | Ga0495599_0196325_483_1025 | 180 |
| 420 | 3300046679 | Ga0495623_0047788 | Ga0495623_0047788_251_793 | 180 |
| 421 | 3300046679 | Ga0495623_0145534 | Ga0495623_0145534_363_905 | 180 |
| 422 | 3300046679 | Ga0495623_0196600 | Ga0495623_0196600_524_1072 | 180 |
| 423 | 3300046680 | Ga0495646_0005624 | Ga0495646_0005624_7295_7837 | 180 |
| 424 | 3300046680 | Ga0495646_0011556 | Ga0495646_0011556_3223_3765 | 180 |
| 425 | 3300046681 | Ga0495647_0025122 | Ga0495647_0025122_1596_2138 | 180 |
| 426 | 3300046684 | Ga0495669_0385876 | Ga0495669_0385876_124_666 | 180 |
| 427 | 3300046689 | Ga0495613_0247960 | Ga0495613_0247960_484_1026 | 180 |
| 428 | 3300046689 | Ga0495613_0683489 | Ga0495613_0683489_35_577 | 180 |
| 429 | 3300046690 | Ga0495624_0387958 | Ga0495624_0387958_31_573 | 180 |
| 430 | 3300046809 | Ga0495600_0145955 | Ga0495600_0145955_216_758 | 180 |
| 431 | 3300047315 | Ga0495581_0005564 | Ga0495581_0005564_5256_5798 | 180 |
| 432 | 3300047317 | Ga0495604_0175939 | Ga0495604_0175939_759_1301 | 180 |
| 433 | 3300047319 | Ga0495674_0041199 | Ga0495674_0041199_2101_2643 | 180 |
| 434 | 3300047319 | Ga0495674_0088150 | Ga0495674_0088150_1711_2253 | 180 |
| 435 | 3300047319 | Ga0495674_0382063 | Ga0495674_0382063_496_1038 | 180 |
| 436 | 3300047322 | Ga0495680_0043560 | Ga0495680_0043560_1391_1933 | 180 |
| 437 | 3300047322 | Ga0495680_0066622 | Ga0495680_0066622_1455_1997 | 180 |
| 438 | 3300047444 | Ga0495675_0093480 | Ga0495675_0093480_1129_1671 | 180 |
| 439 | 3300047444 | Ga0495675_0277308 | Ga0495675_0277308_25_567 | 180 |
| 440 | 3300047469 | Ga0495673_0021944 | Ga0495673_0021944_1868_2410 | 180 |
| 441 | 3300047471 | Ga0495684_0003999 | Ga0495684_0003999_10229_10771 | 180 |
| 442 | 3300047471 | Ga0495684_0007513 | Ga0495684_0007513_6823_7365 | 180 |
| 443 | 3300047471 | Ga0495684_0111090 | Ga0495684_0111090_311_853 | 180 |
| 444 | 3300047472 | Ga0495686_0061810 | Ga0495686_0061810_366_908 | 180 |
| 445 | 3300047472 | Ga0495686_0091375 | Ga0495686_0091375_731_1273 | 180 |
| 446 | 3300047673 | Ga0495593_0011503 | Ga0495593_0011503_3636_4178 | 180 |
| 447 | 3300047673 | Ga0495593_0035667 | Ga0495593_0035667_1559_2101 | 180 |
| 448 | 3300048088 | Ga0495602_0087506 | Ga0495602_0087506_1345_1887 | 180 |
| 449 | 3300048903 | Ga0496100_0168677 | Ga0496100_0168677_477_1019 | 180 |
| 450 | 3300048903 | Ga0496100_0390058 | Ga0496100_0390058_379_921 | 180 |
| 451 | 3300048904 | Ga0496101_0037617 | Ga0496101_0037617_1906_2448 | 180 |
| 452 | 3300048904 | Ga0496101_0271355 | Ga0496101_0271355_159_701 | 180 |
| 453 | 3300048904 | Ga0496101_0697786 | Ga0496101_0697786_36_578 | 180 |
| 454 | 3300048905 | Ga0496102_0003066 | Ga0496102_0003066_5606_6148 | 180 |
| 455 | 3300048905 | Ga0496102_0082282 | Ga0496102_0082282_200_742 | 180 |
| 456 | 3300048905 | Ga0496102_0252034 | Ga0496102_0252034_667_1209 | 180 |
| 457 | 3300048907 | Ga0496104_0008842 | Ga0496104_0008842_4534_5076 | 180 |
| 458 | 3300048907 | Ga0496104_0074804 | Ga0496104_0074804_2168_2710 | 180 |
| 459 | 3300048908 | Ga0496105_0016158 | Ga0496105_0016158_929_1471 | 180 |
| 460 | 3300048908 | Ga0496105_0169585 | Ga0496105_0169585_395_937 | 180 |
| 461 | 3300048909 | Ga0496106_0096534 | Ga0496106_0096534_562_1104 | 180 |
| 462 | 3300048909 | Ga0496106_0580143 | Ga0496106_0580143_289_831 | 180 |
| 463 | 3300048910 | Ga0496107_0070336 | Ga0496107_0070336_819_1361 | 180 |
| 464 | 3300048911 | Ga0496108_0025410 | Ga0496108_0025410_2281_2823 | 180 |
| 465 | 3300048911 | Ga0496108_0061696 | Ga0496108_0061696_1585_2127 | 180 |
| 466 | 3300048912 | Ga0496109_0039242 | Ga0496109_0039242_1353_1895 | 180 |
| 467 | 3300048912 | Ga0496109_1557405 | Ga0496109_1557405_21_563 | 180 |
| 468 | 3300048913 | Ga0496110_0071118 | Ga0496110_0071118_1988_2530 | 180 |
| 469 | 3300048914 | Ga0496111_0063449 | Ga0496111_0063449_793_1335 | 180 |
| 470 | 3300048914 | Ga0496111_0118540 | Ga0496111_0118540_587_1129 | 180 |
| 471 | 3300048915 | Ga0496112_0000059 | Ga0496112_0000059_52461_53003 | 180 |
| 472 | 3300048915 | Ga0496112_0037238 | Ga0496112_0037238_3824_4366 | 180 |
| 473 | 3300048915 | Ga0496112_0054565 | Ga0496112_0054565_1279_1821 | 180 |
| 474 | 3300048915 | Ga0496112_0534192 | Ga0496112_0534192_292_834 | 180 |
| 475 | 3300048916 | Ga0496113_0025039 | Ga0496113_0025039_845_1387 | 180 |
| 476 | 3300048916 | Ga0496113_0027493 | Ga0496113_0027493_2597_3139 | 180 |
| 477 | 3300048917 | Ga0496114_0006343 | Ga0496114_0006343_994_1536 | 180 |
| 478 | 3300048917 | Ga0496114_0140466 | Ga0496114_0140466_410_952 | 180 |
| 479 | 3300048917 | Ga0496114_0229387 | Ga0496114_0229387_788_1330 | 180 |
| 480 | 3300048918 | Ga0496115_0001279 | Ga0496115_0001279_9834_10376 | 180 |
| 481 | 3300048918 | Ga0496115_0057665 | Ga0496115_0057665_207_749 | 180 |
| 482 | 3300048918 | Ga0496115_0200370 | Ga0496115_0200370_185_727 | 180 |
| 483 | 3300048918 | Ga0496115_0244761 | Ga0496115_0244761_170_712 | 180 |
| 484 | 3300048918 | Ga0496115_0325291 | Ga0496115_0325291_446_988 | 180 |
| 485 | 3300048918 | Ga0496115_0456210 | Ga0496115_0456210_471_1013 | 180 |
| 486 | 3300048924 | Ga0496121_0000300 | Ga0496121_0000300_93886_94428 | 180 |
| 487 | 3300048924 | Ga0496121_0054766 | Ga0496121_0054766_45_587 | 180 |
| 488 | 3300048924 | Ga0496121_0103354 | Ga0496121_0103354_1575_2117 | 180 |
| 489 | 3300048924 | Ga0496121_0276112 | Ga0496121_0276112_308_850 | 180 |
| 490 | 3300048929 | Ga0496126_0029427 | Ga0496126_0029427_4438_4980 | 180 |
| 491 | 3300048929 | Ga0496126_0115100 | Ga0496126_0115100_1279_1821 | 180 |
| 492 | 3300048929 | Ga0496126_0136684 | Ga0496126_0136684_1075_1617 | 180 |
| 493 | 3300048929 | Ga0496126_0220369 | Ga0496126_0220369_220_762 | 180 |
| 494 | 3300048929 | Ga0496126_0316796 | Ga0496126_0316796_537_1079 | 180 |
| 495 | 3300049580 | Ga0501046_0271486 | Ga0501046_0271486_95_637 | 180 |
| 496 | 3300049581 | Ga0501047_0555089 | Ga0501047_0555089_382_924 | 180 |
| 497 | 3300050512 | nmdc:mga0n895_34674_c1 | nmdc:mga0n895_34674_c1_2376_2918 | 180 |
| 498 | 3300050514 | nmdc:mga08x19_413730_c1 | nmdc:mga08x19_413730_c1_48_590 | 180 |
| 499 | 3300053077 | Ga0495601_0035582 | Ga0495601_0035582_771_1313 | 180 |
| 500 | 3300053077 | Ga0495601_0038496 | Ga0495601_0038496_500_1048 | 180 |
| 501 | 3300053077 | Ga0495601_0083012 | Ga0495601_0083012_42_584 | 180 |
| 502 | 3300053078 | Ga0495612_0025319 | Ga0495612_0025319_1627_2169 | 180 |
| 503 | 3300053078 | Ga0495612_0038058 | Ga0495612_0038058_1191_1733 | 180 |
| 504 | 3300053080 | Ga0500635_0003001 | Ga0500635_0003001_1551_2093 | 180 |
| 505 | 3300053084 | Ga0495595_0052569 | Ga0495595_0052569_1090_1632 | 180 |
| 506 | 3300053084 | Ga0495595_0114225 | Ga0495595_0114225_12_554 | 180 |
| 507 | 3300053085 | Ga0495619_0022919 | Ga0495619_0022919_618_1160 | 180 |
| 508 | 3300053085 | Ga0495619_0064822 | Ga0495619_0064822_1733_2275 | 180 |
| 509 | 3300053085 | Ga0495619_0439520 | Ga0495619_0439520_273_815 | 180 |
| 510 | 3300053094 | Ga0500566_0347466 | Ga0500566_0347466_58_600 | 180 |
| 511 | 3300053104 | Ga0500556_0024589 | Ga0500556_0024589_1175_1717 | 180 |
| 512 | 3300053119 | Ga0500595_003666 | Ga0500595_003666_6362_6904 | 180 |
| 513 | 3300053139 | Ga0500568_0004707 | Ga0500568_0004707_158_700 | 180 |
| 514 | 3300053150 | Ga0500603_000154 | Ga0500603_000154_9096_9638 | 180 |
| 515 | 3300053178 | Ga0500637_0000127 | Ga0500637_0000127_14332_14874 | 180 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rfl-assembly4.cif.gz_D | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.7699 | 6 | 171 |
| 4hbz-assembly1.cif.gz_A | the structure of putative phosphohistidine phosphatase sixa from nakamurella multipartitia. | 0.7513 | 4 | 171 |
| 2rfl-assembly3.cif.gz_C | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.7461 | 6 | 171 |
| 2rfl-assembly5.cif.gz_E | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.744 | 6 | 171 |
| 2rfl-assembly7.cif.gz_G | crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens | 0.7397 | 6 | 171 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O44899_1_131_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8844 | 25 | 85 | 3.40.50.1240 |
| af_Q9LW33_109_250_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8541 | 25 | 86 | 3.40.50.1240 |
| af_I1MNN7_108_282_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8536 | 25 | 86 | 3.40.50.1240 |
| af_K7TSF9_113_270_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8508 | 25 | 86 | 3.40.50.1240 |
| af_P9WGF9_1_158_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8077 | 7 | 171 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0G0SDM2-F1-model_v4 | Phosphoglycerate mutase | 0.9141 | 21 | 85 |
|
| AF-A0A3B9QGN6-F1-model_v4 | phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) | 0.9016 | 24 | 85 |
GO:0006096
GO:0016868 |
| AF-A0A6I2AEU5-F1-model_v4 | deleted | 0.9009 | 23 | 88 |
|
| AF-A0A3B8ULG0-F1-model_v4 | Histidine phosphatase | 0.8945 | 21 | 96 |
|
| AF-A0A2B4MAW0-F1-model_v4 | deleted | 0.8933 | 23 | 85 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar