F457822

General Info

Members Datasets Scaffolds Average Seq Length
515 274 487 180

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10339556|Ga0070709_103395562
Length 182
Sequence MRRLMLLRHAKTENDAPSGRDQDRRLDNRGRNDATEIGGWIGRHPPFLPDLVLVSHAVRAYQTWEIAWQAMKERSPEPQVELTPELYGADPVQLLQIIRAASEADPQRLMLIGHNPGMHELALALAGSGGEPAGRKALADNLPTSGLAAFDFAIDDWADAAFRRGRLVQFVSPKLLKQASDD

Samples

Sample ID Description Type Environment
1 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
8 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
9 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
10 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
11 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
12 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
13 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
14 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
15 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
16 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
17 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
18 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
19 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
20 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
21 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
22 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
23 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
73 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
144 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
145 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
146 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
158 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
205 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
206 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
214 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
217 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
218 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
238 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
267 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
268 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
269 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
270 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
271 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
272 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
273 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
274 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.53
Metatranscriptomes 0.59
Isolates 4.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.94
Nodule 5.05
Rhizoplane 10.68
Rhizosphere 75.53
Stem 0
Stem Tuber 0
Unclassified 6.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001531 3300000549 Bacteria 3437
2 JGI25406J46586_10000048 3300003203 Bacteria 54715
3 Ga0070658_10007221 3300005327 Bacteria 8965
4 Ga0070676_10316315 3300005328 Bacteria 1063
5 Ga0070683_100015758 3300005329 Bacteria 6645
6 Ga0070683_100657065 3300005329 Bacteria 1004
7 Ga0070680_100044116 3300005336 Bacteria 3623
8 Ga0070680_100046072 3300005336 Bacteria 3547
9 Ga0070682_100882692 3300005337 Bacteria 733
10 Ga0068868_100073585 3300005338 Bacteria 2729
11 Ga0068868_101208330 3300005338 Bacteria 699
12 Ga0070660_100008957 3300005339 Bacteria 7021
13 Ga0070691_10059388 3300005341 Bacteria 1838
14 Ga0070661_100611679 3300005344 Bacteria 882
15 Ga0070673_100157709 3300005364 Bacteria 1927
16 Ga0070659_100037727 3300005366 Bacteria 3768
17 Ga0070659_100433794 3300005366 Bacteria 1112
18 Ga0070709_10082451 3300005434 Bacteria 2101
19 Ga0070709_10339556 3300005434 Bacteria 1107
20 Ga0070714_100026993 3300005435 Bacteria 4751
21 Ga0070714_100059084 3300005435 Bacteria 3287
22 Ga0070714_100172527 3300005435 Bacteria 1963
23 Ga0070713_100040482 3300005436 Bacteria 3788
24 Ga0070713_100045688 3300005436 Bacteria 3591
25 Ga0070713_100203434 3300005436 Bacteria 1789
26 Ga0070713_100372657 3300005436 Bacteria 1329
27 Ga0070713_100419390 3300005436 Bacteria 1253
28 Ga0070710_10044379 3300005437 Bacteria 2466
29 Ga0070710_10080519 3300005437 Bacteria 1900
30 Ga0070710_10375488 3300005437 Bacteria 947
31 Ga0070701_10540171 3300005438 Bacteria 763
32 Ga0070711_100035807 3300005439 Bacteria 3321
33 Ga0070711_100068940 3300005439 Bacteria 2487
34 Ga0070711_100654796 3300005439 Bacteria 881
35 Ga0070694_100508704 3300005444 Bacteria 959
36 Ga0070663_100366659 3300005455 Bacteria 1170
37 Ga0070678_100017123 3300005456 Bacteria 4656
38 Ga0070681_10016205 3300005458 Bacteria 7432
39 Ga0070681_10053286 3300005458 Bacteria 4031
40 Ga0070681_10249855 3300005458 Bacteria 1686
41 Ga0070681_10412465 3300005458 Bacteria 1262
42 Ga0070699_101536545 3300005518 Bacteria 610
43 Ga0070679_100059711 3300005530 Bacteria 3800
44 Ga0070679_100169308 3300005530 Bacteria 2157
45 Ga0070679_100634643 3300005530 Bacteria 1011
46 Ga0070684_100010386 3300005535 Bacteria 7372
47 Ga0070684_100163562 3300005535 Bacteria 2019
48 Ga0070684_100274609 3300005535 Bacteria 1543
49 Ga0070697_100034479 3300005536 Bacteria 4081
50 Ga0068853_100005857 3300005539 Bacteria 9682
51 Ga0068853_100179608 3300005539 Bacteria 1919
52 Ga0070672_100044440 3300005543 Bacteria 3431
53 Ga0070693_100036267 3300005547 Bacteria 2740
54 Ga0070693_100213624 3300005547 Bacteria 1260
55 Ga0070665_100357265 3300005548 Bacteria 1467
56 Ga0070665_100426370 3300005548 Bacteria 1335
57 Ga0068855_100061371 3300005563 Bacteria 4393
58 Ga0068855_100089033 3300005563 Bacteria 3564
59 Ga0068855_100195041 3300005563 Bacteria 2282
60 Ga0068855_100481317 3300005563 Bacteria 1351
61 Ga0068855_100574937 3300005563 Bacteria 1218
62 Ga0068855_100608270 3300005563 Bacteria 1178
63 Ga0070664_100026331 3300005564 Bacteria 4824
64 Ga0070664_100370084 3300005564 Bacteria 1306
65 Ga0068857_100037942 3300005577 Bacteria 4268
66 Ga0068857_101688286 3300005577 Bacteria 619
67 Ga0068854_100068908 3300005578 Bacteria 2581
68 Ga0068854_100228709 3300005578 Bacteria 1475
69 Ga0068856_100000363 3300005614 Bacteria 49777
70 Ga0068856_100283694 3300005614 Bacteria 1673
71 Ga0068856_100492933 3300005614 Bacteria 1246
72 Ga0068852_100005807 3300005616 Bacteria 8861
73 Ga0068852_100101036 3300005616 Bacteria 2603
74 Ga0068852_100551489 3300005616 Bacteria 1153
75 Ga0068864_100111252 3300005618 Bacteria 2440
76 Ga0068864_100151419 3300005618 Bacteria 2101
77 Ga0068851_10106177 3300005834 Bacteria 1495
78 Ga0068863_100291498 3300005841 Bacteria 1582
79 Ga0068858_100185117 3300005842 Bacteria 1967
80 Ga0081539_10000008 3300005985 Bacteria 525071
81 Ga0070717_10011341 3300006028 Bacteria 6764
82 Ga0070717_10033177 3300006028 Bacteria 4164
83 Ga0070717_10065485 3300006028 Bacteria 3021
84 Ga0070717_10091712 3300006028 Bacteria 2566
85 Ga0075365_10064551 3300006038 Bacteria 2453
86 Ga0070715_10020502 3300006163 Bacteria 2551
87 Ga0070716_100127145 3300006173 Bacteria 1605
88 Ga0070712_100071504 3300006175 Bacteria 2482
89 Ga0070712_100076644 3300006175 Bacteria 2408
90 Ga0070712_100092377 3300006175 Bacteria 2219
91 Ga0068871_100309654 3300006358 Bacteria 1388
92 Ga0068865_100321509 3300006881 Bacteria 1245
93 Ga0075436_100360435 3300006914 Bacteria 1049
94 Ga0099824_1002915 3300006942 Bacteria 25054
95 Ga0099822_1012763 3300006943 Bacteria 9978
96 Ga0099794_10029028 3300007265 Bacteria 2575
97 Ga0099794_10066616 3300007265 Bacteria 1757
98 Ga0099794_10158442 3300007265 Bacteria 1151
99 Ga0105240_10007748 3300009093 Bacteria 15534
100 Ga0105240_10021481 3300009093 Bacteria 8584
101 Ga0105240_10048119 3300009093 Bacteria 5391
102 Ga0105245_10163512 3300009098 Bacteria 2114
103 Ga0105245_10401668 3300009098 Bacteria 1369
104 Ga0105247_10393835 3300009101 Bacteria 985
105 Ga0105243_10241271 3300009148 Bacteria 1608
106 Ga0105241_10090138 3300009174 Bacteria 2418
107 Ga0105241_10519226 3300009174 Bacteria 1065
108 Ga0105241_10758124 3300009174 Bacteria 891
109 Ga0105248_10294518 3300009177 Bacteria 1827
110 Ga0105237_10006757 3300009545 Bacteria 12663
111 Ga0105237_10011809 3300009545 Bacteria 9237
112 Ga0105237_10023711 3300009545 Bacteria 6282
113 Ga0105237_10445308 3300009545 Bacteria 1301
114 Ga0105237_10903519 3300009545 Bacteria 890
115 Ga0105238_10002692 3300009551 Bacteria 17671
116 Ga0105238_10101590 3300009551 Bacteria 2858
117 Ga0105238_10276364 3300009551 Bacteria 1660
118 Ga0105238_10448996 3300009551 Bacteria 1286
119 Ga0105238_11308374 3300009551 Bacteria 751
120 Ga0105249_10435902 3300009553 Bacteria 1347
121 Ga0099796_10133054 3300010159 Bacteria 966
122 Ga0105239_10012853 3300010375 Bacteria 9314
123 Ga0105239_10130036 3300010375 Bacteria 2800
124 Ga0105239_10199854 3300010375 Bacteria 2239
125 Ga0105239_10483694 3300010375 Bacteria 1406
126 Ga0105239_10778468 3300010375 Bacteria 1096
127 Ga0105246_10028122 3300011119 Bacteria 3692
128 Ga0105246_10245880 3300011119 Bacteria 1417
129 Ga0157370_10142251 3300013104 Bacteria 2235
130 Ga0157370_10217616 3300013104 Bacteria 1770
131 Ga0157369_10004292 3300013105 Bacteria 16858
132 Ga0157369_10008116 3300013105 Bacteria 12033
133 Ga0157369_10230394 3300013105 Bacteria 1937
134 Ga0157369_10335451 3300013105 Bacteria 1571
135 Ga0157369_10451308 3300013105 Bacteria 1331
136 Ga0157369_10975752 3300013105 Bacteria 868
137 Ga0157374_10028994 3300013296 Bacteria 5005
138 Ga0157378_10237044 3300013297 Bacteria 1741
139 Ga0163162_10010007 3300013306 Bacteria 9221
140 Ga0163162_10074878 3300013306 Bacteria 3445
141 Ga0163162_10217908 3300013306 Bacteria 2039
142 Ga0163162_10579958 3300013306 Bacteria 1248
143 Ga0157372_10037750 3300013307 Bacteria 5328
144 Ga0157372_10196810 3300013307 Bacteria 2334
145 Ga0157372_10332291 3300013307 Bacteria 1770
146 Ga0157375_10036503 3300013308 Bacteria 4702
147 Ga0163163_10004103 3300014325 Bacteria 12420
148 Ga0157380_11222064 3300014326 Bacteria 796
149 Ga0157377_10424403 3300014745 Bacteria 911
150 Ga0157376_10006130 3300014969 Bacteria 8465
151 Ga0157376_11627914 3300014969 Bacteria 680
152 Ga0206356_10910912 3300020070 Bacteria 961
153 Ga0206356_11251455 3300020070 Bacteria 1169
154 Ga0213876_10049984 3300021384 Bacteria 2209
155 Ga0209233_1001233 3300025261 Bacteria 10268
156 Ga0207656_10348292 3300025321 Bacteria 739
157 Ga0207692_10152064 3300025898 Bacteria 1326
158 Ga0207710_10478654 3300025900 Bacteria 645
159 Ga0207647_10138605 3300025904 Bacteria 1426
160 Ga0207685_10109196 3300025905 Bacteria 1196
161 Ga0207685_10166268 3300025905 Bacteria 1011
162 Ga0207685_10203488 3300025905 Bacteria 932
163 Ga0207699_10067450 3300025906 Bacteria 2175
164 Ga0207699_10258155 3300025906 Bacteria 1203
165 Ga0207645_10364131 3300025907 Bacteria 969
166 Ga0207705_10012662 3300025909 Bacteria 6088
167 Ga0207705_10715385 3300025909 Bacteria 778
168 Ga0207684_10962078 3300025910 Bacteria 716
169 Ga0207654_10074113 3300025911 Bacteria 2031
170 Ga0207707_10015318 3300025912 Bacteria 6675
171 Ga0207707_10040760 3300025912 Bacteria 4055
172 Ga0207707_10121346 3300025912 Bacteria 2285
173 Ga0207707_10342301 3300025912 Bacteria 1289
174 Ga0207695_10021731 3300025913 Bacteria 7313
175 Ga0207695_10134238 3300025913 Bacteria 2430
176 Ga0207695_10160882 3300025913 Bacteria 2177
177 Ga0207695_10177540 3300025913 Bacteria 2052
178 Ga0207671_10041126 3300025914 Bacteria 3421
179 Ga0207671_10139527 3300025914 Bacteria 1867
180 Ga0207671_10180431 3300025914 Bacteria 1643
181 Ga0207671_10186464 3300025914 Bacteria 1616
182 Ga0207671_10503803 3300025914 Bacteria 965
183 Ga0207671_10523695 3300025914 Bacteria 945
184 Ga0207693_10018039 3300025915 Bacteria 5625
185 Ga0207693_10033278 3300025915 Bacteria 4068
186 Ga0207693_10152028 3300025915 Bacteria 1821
187 Ga0207693_10367364 3300025915 Bacteria 1126
188 Ga0207693_10409355 3300025915 Bacteria 1060
189 Ga0207663_10004056 3300025916 Bacteria 7261
190 Ga0207660_10028890 3300025917 Bacteria 3798
191 Ga0207660_10063549 3300025917 Bacteria 2662
192 Ga0207660_10179064 3300025917 Bacteria 1645
193 Ga0207660_10437215 3300025917 Bacteria 1057
194 Ga0207660_10539576 3300025917 Bacteria 948
195 Ga0207657_10034539 3300025919 Bacteria 4545
196 Ga0207657_10314397 3300025919 Bacteria 1239
197 Ga0207652_10056918 3300025921 Bacteria 3366
198 Ga0207652_10064077 3300025921 Bacteria 3180
199 Ga0207652_10066101 3300025921 Bacteria 3133
200 Ga0207652_10172646 3300025921 Bacteria 1940
201 Ga0207694_10259191 3300025924 Bacteria 1424
202 Ga0207659_10649219 3300025926 Bacteria 902
203 Ga0207687_10200730 3300025927 Bacteria 1558
204 Ga0207687_10296829 3300025927 Bacteria 1300
205 Ga0207700_10097557 3300025928 Bacteria 2336
206 Ga0207700_10256597 3300025928 Bacteria 1495
207 Ga0207700_10267481 3300025928 Bacteria 1466
208 Ga0207664_10051264 3300025929 Bacteria 3258
209 Ga0207686_10841937 3300025934 Bacteria 737
210 Ga0207704_10672753 3300025938 Bacteria 854
211 Ga0207665_10009625 3300025939 Bacteria 6347
212 Ga0207665_10105006 3300025939 Bacteria 1978
213 Ga0207665_10867526 3300025939 Bacteria 715
214 Ga0207691_10094970 3300025940 Bacteria 2667
215 Ga0207689_10183786 3300025942 Bacteria 1724
216 Ga0207661_10001312 3300025944 Bacteria 16630
217 Ga0207661_10019448 3300025944 Bacteria 5063
218 Ga0207661_10162045 3300025944 Bacteria 1941
219 Ga0207661_10582610 3300025944 Bacteria 1026
220 Ga0207679_10048078 3300025945 Bacteria 3103
221 Ga0207667_10073039 3300025949 Bacteria 3565
222 Ga0207667_10162936 3300025949 Bacteria 2293
223 Ga0207667_10207601 3300025949 Bacteria 2008
224 Ga0207667_10317367 3300025949 Bacteria 1591
225 Ga0207667_10475839 3300025949 Bacteria 1268
226 Ga0207640_10189323 3300025981 Bacteria 1550
227 Ga0207640_11182924 3300025981 Bacteria 679
228 Ga0207677_11011456 3300026023 Bacteria 754
229 Ga0207703_10711951 3300026035 Bacteria 955
230 Ga0207639_10017229 3300026041 Bacteria 5121
231 Ga0207639_10377992 3300026041 Bacteria 1271
232 Ga0207678_10011003 3300026067 Bacteria 7946
233 Ga0207702_10000261 3300026078 Bacteria 61023
234 Ga0207702_10182239 3300026078 Bacteria 1935
235 Ga0207641_10739890 3300026088 Bacteria 970
236 Ga0207676_10110007 3300026095 Bacteria 2304
237 Ga0207674_10028112 3300026116 Bacteria 5939
238 Ga0207683_10206076 3300026121 Bacteria 1789
239 Ga0207698_10062739 3300026142 Bacteria 2904
240 Ga0207698_10068099 3300026142 Bacteria 2810
241 Ga0207698_10641720 3300026142 Bacteria 1051
242 Ga0209589_1000004 3300027357 Bacteria 578529
243 Ga0209489_100004 3300027361 Bacteria 578529
244 Ga0209700_100004 3300027363 Bacteria 578529
245 Ga0209179_1082303 3300027512 Bacteria 711
246 Ga0209588_1060488 3300027671 Bacteria 1225
247 Ga0265334_10030027 3300028573 Bacteria 2177
248 Ga0265332_10006468 3300031238 Bacteria 5313
249 Ga0265328_10211662 3300031239 Bacteria 737
250 Ga0265340_10013940 3300031247 Bacteria 4212
251 Ga0265340_10098077 3300031247 Bacteria 1364
252 Ga0265339_10011794 3300031249 Bacteria 5363
253 Ga0265339_10152007 3300031249 Bacteria 1170
254 Ga0265331_10074035 3300031250 Bacteria 1590
255 Ga0307508_10001617 3300031616 Bacteria 25159
256 Ga0307508_10106805 3300031616 Bacteria 2398
257 Ga0265342_10031302 3300031712 Bacteria 3291
258 Ga0265342_10087235 3300031712 Bacteria 1793
259 Ga0265342_10133107 3300031712 Bacteria 1391
260 Ga0307510_10026735 3300033180 Bacteria 6625
261 Ga0315911_1000011 3300033442 Bacteria 264678
262 Ga0316215_1004538 3300033544 Bacteria 1332
263 Ga0316215_1015855 3300033544 Bacteria 757
264 Ga0373926_0009066 3300035083 Bacteria 3319
265 Ga0373928_0114881 3300035084 Bacteria 716
266 Ga0373934_0001081 3300035086 Bacteria 9869
267 Ga0373934_0158005 3300035086 Bacteria 930
268 Ga0373944_0009877 3300035089 Bacteria 2595
269 Ga0373923_0009768 3300035111 Bacteria 3470
270 Ga0373923_0025745 3300035111 Bacteria 2334
271 Ga0373932_0102275 3300035112 Bacteria 934
272 Ga0373936_0011831 3300035113 Bacteria 3310
273 Ga0373953_0027234 3300035117 Bacteria 2196
274 Ga0373953_0028946 3300035117 Bacteria 2140
275 Ga0373954_0008459 3300035118 Bacteria 4516
276 Ga0373956_0014367 3300035119 Bacteria 3307
277 Ga0373957_0010028 3300035120 Bacteria 3117
278 Ga0373943_0013493 3300035170 Bacteria 3691
279 Ga0373943_0130166 3300035170 Bacteria 1346
280 Ga0373946_0008767 3300035171 Bacteria 3712
281 Ga0373955_0024390 3300035172 Bacteria 3093
282 Ga0373955_0070777 3300035172 Bacteria 1949
283 Ga0373955_0147914 3300035172 Bacteria 1381
284 Ga0373924_0074161 3300035410 Bacteria 1439
285 Ga0373935_0046996 3300035692 Bacteria 2727
286 Ga0373927_0109956 3300035695 Bacteria 1795
287 Ga0373933_0000159 3300035724 Bacteria 43953
288 Ga0373933_0067407 3300035724 Bacteria 2171
289 Ga0373933_0081634 3300035724 Bacteria 1983
290 Ga0373933_0232950 3300035724 Bacteria 1183
291 Ga0373947_0056739 3300035725 Bacteria 2368
292 Ga0373947_0090355 3300035725 Bacteria 1908
293 Ga0373947_0215701 3300035725 Bacteria 1260
294 Ga0373937_0030893 3300036401 Bacteria 4850
295 Ga0373937_0293018 3300036401 Bacteria 1537
296 Ga0373937_0300953 3300036401 Bacteria 1516
297 Ga0372808_003696 3300036459 Bacteria 1902
298 Ga0373925_0070463 3300037068 Bacteria 2643
299 Ga0373925_0140935 3300037068 Bacteria 1887
300 Ga0373925_0169723 3300037068 Bacteria 1722
301 Ga0395900_0057479 3300037418 Bacteria 4005
302 Ga0395900_0442408 3300037418 Bacteria 1257
303 Ga0395898_0076506 3300037466 Bacteria 3232
304 Ga0395898_0505642 3300037466 Bacteria 1149
305 Ga0436364_0384534 3300037853 Bacteria 5052
306 Ga0436364_1255264 3300037853 Bacteria 2476
307 Ga0395901_0474403 3300038443 Bacteria 1277
308 Ga0395901_0907886 3300038443 Bacteria 862
309 Ga0436365_0572673 3300039437 Bacteria 942
310 Ga0436365_1697229 3300039437 Bacteria 5763
311 Ga0436360_0275470 3300039438 Bacteria 7453
312 Ga0436361_0725474 3300039447 Bacteria 14455
313 Ga0436363_0938134 3300039450 Bacteria 831
314 Ga0436363_1401514 3300039450 Bacteria 842
315 Ga0451851_0713221 3300041507 Bacteria 1181
316 Ga0466966_0147135 3300044684 Bacteria 1438
317 Ga0466963_0062167 3300044694 Bacteria 2498
318 Ga0466959_0050741 3300045049 Bacteria 3045
319 Ga0495592_0001055 3300046454 Bacteria 19077
320 Ga0495592_0057172 3300046454 Bacteria 2880
321 Ga0495592_0066154 3300046454 Bacteria 2645
322 Ga0495603_0459049 3300046455 Bacteria 729
323 Ga0495629_0004163 3300046459 Bacteria 10857
324 Ga0495629_0040163 3300046459 Bacteria 3292
325 Ga0495629_0254433 3300046459 Bacteria 1208
326 Ga0495641_0080234 3300046461 Bacteria 1462
327 Ga0495651_0115143 3300046462 Bacteria 1983
328 Ga0495651_0122565 3300046462 Bacteria 1907
329 Ga0495653_0013831 3300046463 Bacteria 6576
330 Ga0495653_0107935 3300046463 Bacteria 2005
331 Ga0495580_0023995 3300046472 Bacteria 4470
332 Ga0495582_0092591 3300046473 Bacteria 1686
333 Ga0495639_0004720 3300046475 Bacteria 5860
334 Ga0495639_0108009 3300046475 Bacteria 1318
335 Ga0495639_0133578 3300046475 Bacteria 1189
336 Ga0495664_0021707 3300046477 Bacteria 3709
337 Ga0495664_0050295 3300046477 Bacteria 2475
338 Ga0495594_0259940 3300046499 Bacteria 989
339 Ga0495606_0000992 3300046507 Bacteria 41375
340 Ga0495608_0007611 3300046511 Bacteria 7636
341 Ga0495608_0046596 3300046511 Bacteria 2884
342 Ga0495618_0028872 3300046514 Bacteria 3458
343 Ga0495618_0249246 3300046514 Bacteria 1114
344 Ga0495628_0007764 3300046516 Bacteria 9246
345 Ga0495628_0295854 3300046516 Bacteria 1199
346 Ga0495630_0494318 3300046517 Bacteria 938
347 Ga0495652_0093148 3300046529 Bacteria 2460
348 Ga0495652_0189706 3300046529 Bacteria 1569
349 Ga0495640_0006867 3300046533 Bacteria 8966
350 Ga0495586_0087781 3300046535 Bacteria 1715
351 Ga0495645_0024430 3300046543 Bacteria 4385
352 Ga0495645_0097198 3300046543 Bacteria 2097
353 Ga0495645_0278298 3300046543 Bacteria 1101
354 Ga0495667_0137410 3300046559 Bacteria 1575
355 Ga0495667_0202444 3300046559 Bacteria 1270
356 Ga0495667_0409694 3300046559 Bacteria 853
357 Ga0495668_0065320 3300046616 Bacteria 2003
358 Ga0495634_0121474 3300046642 Bacteria 1672
359 Ga0495634_0146073 3300046642 Bacteria 1498
360 Ga0495635_0010764 3300046663 Bacteria 6408
361 Ga0495635_0064224 3300046663 Bacteria 2520
362 Ga0495657_0052411 3300046675 Bacteria 2735
363 Ga0495657_0066866 3300046675 Bacteria 2360
364 Ga0495657_0599103 3300046675 Bacteria 638
365 Ga0495599_0196325 3300046678 Bacteria 1240
366 Ga0495623_0047788 3300046679 Bacteria 2716
367 Ga0495623_0145534 3300046679 Bacteria 1405
368 Ga0495623_0196600 3300046679 Bacteria 1162
369 Ga0495646_0005624 3300046680 Bacteria 7933
370 Ga0495646_0011556 3300046680 Bacteria 5607
371 Ga0495647_0025122 3300046681 Bacteria 2174
372 Ga0495658_0390047 3300046683 Bacteria 887
373 Ga0495669_0385876 3300046684 Bacteria 678
374 Ga0495613_0247960 3300046689 Bacteria 1243
375 Ga0495613_0326789 3300046689 Bacteria 1057
376 Ga0495613_0683489 3300046689 Bacteria 677
377 Ga0495624_0387958 3300046690 Bacteria 839
378 Ga0495600_0145955 3300046809 Bacteria 1533
379 Ga0495581_0005564 3300047315 Bacteria 7300
380 Ga0495604_0175939 3300047317 Bacteria 1500
381 Ga0495674_0041199 3300047319 Bacteria 4127
382 Ga0495674_0088150 3300047319 Bacteria 2654
383 Ga0495674_0382063 3300047319 Bacteria 1139
384 Ga0495680_0043560 3300047322 Bacteria 3552
385 Ga0495680_0066622 3300047322 Bacteria 2755
386 Ga0495675_0093480 3300047444 Bacteria 1886
387 Ga0495675_0277308 3300047444 Bacteria 1000
388 Ga0495673_0021944 3300047469 Bacteria 3139
389 Ga0495684_0003999 3300047471 Bacteria 11499
390 Ga0495684_0007513 3300047471 Bacteria 8439
391 Ga0495684_0111090 3300047471 Bacteria 2068
392 Ga0495686_0061810 3300047472 Bacteria 2325
393 Ga0495686_0091375 3300047472 Bacteria 1848
394 Ga0495593_0011503 3300047673 Bacteria 5080
395 Ga0495593_0035667 3300047673 Bacteria 2699
396 Ga0495602_0087506 3300048088 Bacteria 2596
397 Ga0496100_0099850 3300048903 Bacteria 1998
398 Ga0496100_0168677 3300048903 Bacteria 1574
399 Ga0496100_0390058 3300048903 Bacteria 1059
400 Ga0496101_0037617 3300048904 Bacteria 3434
401 Ga0496101_0271355 3300048904 Bacteria 1324
402 Ga0496101_0697786 3300048904 Bacteria 801
403 Ga0496102_0003066 3300048905 Bacteria 14146
404 Ga0496102_0082282 3300048905 Bacteria 2969
405 Ga0496102_0202795 3300048905 Bacteria 1870
406 Ga0496102_0252034 3300048905 Bacteria 1665
407 Ga0496102_0555129 3300048905 Bacteria 1071
408 Ga0496102_0979793 3300048905 Bacteria 766
409 Ga0496104_0008842 3300048907 Bacteria 8953
410 Ga0496104_0074804 3300048907 Bacteria 3224
411 Ga0496104_0695003 3300048907 Bacteria 925
412 Ga0496105_0016158 3300048908 Bacteria 5953
413 Ga0496105_0169585 3300048908 Bacteria 1789
414 Ga0496106_0008756 3300048909 Bacteria 7479
415 Ga0496106_0096534 3300048909 Bacteria 2287
416 Ga0496106_0580143 3300048909 Bacteria 899
417 Ga0496107_0067333 3300048910 Bacteria 2598
418 Ga0496107_0070336 3300048910 Bacteria 2540
419 Ga0496108_0002640 3300048911 Bacteria 14365
420 Ga0496108_0025410 3300048911 Bacteria 4881
421 Ga0496108_0061696 3300048911 Bacteria 3156
422 Ga0496109_0039242 3300048912 Bacteria 4285
423 Ga0496109_1557405 3300048912 Bacteria 595
424 Ga0496110_0021301 3300048913 Bacteria 5486
425 Ga0496110_0071118 3300048913 Bacteria 3084
426 Ga0496111_0040080 3300048914 Bacteria 3360
427 Ga0496111_0063449 3300048914 Bacteria 2679
428 Ga0496111_0118540 3300048914 Bacteria 1954
429 Ga0496111_0428386 3300048914 Bacteria 977
430 Ga0496112_0000059 3300048915 Bacteria 74946
431 Ga0496112_0037238 3300048915 Bacteria 4748
432 Ga0496112_0054565 3300048915 Bacteria 3926
433 Ga0496112_0534192 3300048915 Bacteria 1107
434 Ga0496112_1060228 3300048915 Bacteria 729
435 Ga0496113_0025039 3300048916 Bacteria 4249
436 Ga0496113_0027493 3300048916 Bacteria 4079
437 Ga0496113_0102542 3300048916 Bacteria 2219
438 Ga0496114_0006343 3300048917 Bacteria 9307
439 Ga0496114_0085051 3300048917 Bacteria 2679
440 Ga0496114_0140466 3300048917 Bacteria 2091
441 Ga0496114_0229387 3300048917 Bacteria 1631
442 Ga0496114_0363606 3300048917 Bacteria 1280
443 Ga0496115_0001279 3300048918 Bacteria 18002
444 Ga0496115_0057665 3300048918 Bacteria 3124
445 Ga0496115_0200370 3300048918 Bacteria 1649
446 Ga0496115_0244761 3300048918 Bacteria 1478
447 Ga0496115_0298740 3300048918 Bacteria 1320
448 Ga0496115_0325291 3300048918 Bacteria 1257
449 Ga0496115_0456210 3300048918 Bacteria 1032
450 Ga0496115_0478655 3300048918 Bacteria 1003
451 Ga0496118_0280872 3300048921 Bacteria 927
452 Ga0496121_0000300 3300048924 Bacteria 102506
453 Ga0496121_0054766 3300048924 Bacteria 3330
454 Ga0496121_0103354 3300048924 Bacteria 2192
455 Ga0496121_0276112 3300048924 Bacteria 1152
456 Ga0496126_0011800 3300048929 Bacteria 8992
457 Ga0496126_0029427 3300048929 Bacteria 5218
458 Ga0496126_0115100 3300048929 Bacteria 2339
459 Ga0496126_0136684 3300048929 Bacteria 2113
460 Ga0496126_0205303 3300048929 Bacteria 1661
461 Ga0496126_0220369 3300048929 Bacteria 1594
462 Ga0496126_0240429 3300048929 Bacteria 1513
463 Ga0496126_0316796 3300048929 Bacteria 1283
464 Ga0496126_0580370 3300048929 Bacteria 886
465 Ga0501046_0271486 3300049580 Bacteria 1244
466 Ga0501047_0555089 3300049581 Bacteria 973
467 nmdc:mga0yw44_154926_c1 3300050492 Bacteria 1497
468 nmdc:mga0n895_34674_c1 3300050512 Bacteria 4860
469 nmdc:mga08x19_413730_c1 3300050514 Bacteria 947
470 Ga0495601_0035582 3300053077 Bacteria 3109
471 Ga0495601_0038496 3300053077 Bacteria 2992
472 Ga0495601_0083012 3300053077 Bacteria 2057
473 Ga0495612_0025319 3300053078 Bacteria 2383
474 Ga0495612_0038058 3300053078 Bacteria 1954
475 Ga0495612_0181380 3300053078 Bacteria 925
476 Ga0500635_0003001 3300053080 Bacteria 4204
477 Ga0495595_0052569 3300053084 Bacteria 1890
478 Ga0495595_0114225 3300053084 Bacteria 1311
479 Ga0495619_0022919 3300053085 Bacteria 3997
480 Ga0495619_0064822 3300053085 Bacteria 2436
481 Ga0495619_0439520 3300053085 Bacteria 900
482 Ga0500566_0347466 3300053094 Bacteria 681
483 Ga0500556_0024589 3300053104 Bacteria 1980
484 Ga0500595_003666 3300053119 Bacteria 7109
485 Ga0500568_0004707 3300053139 Bacteria 7240
486 Ga0500603_000154 3300053150 Bacteria 16931
487 Ga0500637_0000127 3300053178 Bacteria 27567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025898 Ga0207692_10152064 Ga0207692_101520642 175
2 3300009093 Ga0105240_10007748 Ga0105240_1000774810 176
3 3300010375 Ga0105239_10130036 Ga0105239_101300363 176
4 3300025905 Ga0207685_10166268 Ga0207685_101662682 176
5 iso_pu_bacteria 2508501128 2509151126 176
6 iso_pu_bacteria 2513237096 2513661195 176
7 iso_pu_bacteria 2513237137 2513860398 176
8 iso_pu_bacteria 2513237145 2513922833 176
9 iso_pu_bacteria 2517572143 2517894130 176
10 iso_pu_bacteria 2524023228 2524536144 176
11 iso_pu_bacteria 2667528175 2671123447 176
12 iso_pu_bacteria 2728368998 2728749499 176
13 iso_pu_bacteria 2791355197 2793073111 176
14 iso_pu_bacteria 2885374607 2885379147 176
15 iso_pu_bacteria 2903748898 2903751305 176
16 iso_pu_bacteria 2904690495 2904697448 176
17 iso_pu_bacteria 2904699407 2904705245 176
18 iso_pu_bacteria 2906610324 2906610938 176
19 iso_pu_bacteria 2906635258 2906639594 176
20 iso_pu_bacteria 2906660503 2906661740 176
21 iso_pu_bacteria 2908739725 2908744458 176
22 iso_pu_bacteria 2908756301 2908762096 176
23 iso_pu_bacteria 2922425934 2922428381 176
24 iso_pu_bacteria 2935630451 2935637859 176
25 iso_pu_bacteria 2941507105 2941514532 176
26 iso_pu_bacteria 2941515067 2941522428 176
27 iso_pu_bacteria 2941523033 2941530299 176
28 iso_pu_bacteria 3005474847 3005478371 176
29 iso_pu_bacteria 8006933436 8006942860 176
30 iso_pu_bacteria 8006973647 8006982579 176
31 iso_pu_bacteria 8019565922 8019566675 176
32 iso_pu_bacteria 8056689827 8056691710 176
33 3300005435 Ga0070714_100059084 Ga0070714_1000590843 177
34 3300005435 Ga0070714_100172527 Ga0070714_1001725272 177
35 3300005436 Ga0070713_100040482 Ga0070713_1000404823 177
36 3300005436 Ga0070713_100203434 Ga0070713_1002034342 177
37 3300005437 Ga0070710_10080519 Ga0070710_100805194 177
38 3300005614 Ga0068856_100492933 Ga0068856_1004929332 177
39 3300006028 Ga0070717_10011341 Ga0070717_100113413 177
40 3300006028 Ga0070717_10033177 Ga0070717_100331775 177
41 3300006163 Ga0070715_10020502 Ga0070715_100205023 177
42 3300007265 Ga0099794_10029028 Ga0099794_100290282 177
43 3300007265 Ga0099794_10158442 Ga0099794_101584422 177
44 3300009093 Ga0105240_10021481 Ga0105240_100214818 177
45 3300009553 Ga0105249_10435902 Ga0105249_104359021 177
46 3300010375 Ga0105239_10778468 Ga0105239_107784682 177
47 3300013306 Ga0163162_10579958 Ga0163162_105799582 177
48 3300025905 Ga0207685_10203488 Ga0207685_102034882 177
49 3300025913 Ga0207695_10134238 Ga0207695_101342381 177
50 3300025915 Ga0207693_10367364 Ga0207693_103673642 177
51 3300025915 Ga0207693_10409355 Ga0207693_104093552 177
52 3300025929 Ga0207664_10051264 Ga0207664_100512642 177
53 3300025939 Ga0207665_10009625 Ga0207665_100096255 177
54 3300025939 Ga0207665_10867526 Ga0207665_108675261 177
55 3300025949 Ga0207667_10475839 Ga0207667_104758391 177
56 3300027512 Ga0209179_1082303 Ga0209179_10823032 177
57 3300027671 Ga0209588_1060488 Ga0209588_10604881 177
58 3300031712 Ga0265342_10031302 Ga0265342_100313024 177
59 3300035724 Ga0373933_0000159 Ga0373933_0000159_29136_29669 177
60 3300044694 Ga0466963_0062167 Ga0466963_0062167_1831_2364 177
61 3300046475 Ga0495639_0108009 Ga0495639_0108009_573_1106 177
62 3300046477 Ga0495664_0050295 Ga0495664_0050295_981_1514 177
63 3300046507 Ga0495606_0000992 Ga0495606_0000992_26668_27201 177
64 3300046543 Ga0495645_0278298 Ga0495645_0278298_519_1052 177
65 3300046683 Ga0495658_0390047 Ga0495658_0390047_302_835 177
66 3300046689 Ga0495613_0326789 Ga0495613_0326789_428_961 177
67 3300048905 Ga0496102_0202795 Ga0496102_0202795_241_774 177
68 3300048905 Ga0496102_0979793 Ga0496102_0979793_71_604 177
69 3300048907 Ga0496104_0695003 Ga0496104_0695003_367_900 177
70 3300048914 Ga0496111_0428386 Ga0496111_0428386_32_565 177
71 3300048915 Ga0496112_1060228 Ga0496112_1060228_67_600 177
72 3300048917 Ga0496114_0085051 Ga0496114_0085051_97_630 177
73 3300048918 Ga0496115_0298740 Ga0496115_0298740_292_825 177
74 3300048918 Ga0496115_0478655 Ga0496115_0478655_323_856 177
75 3300048921 Ga0496118_0280872 Ga0496118_0280872_220_753 177
76 3300048929 Ga0496126_0011800 Ga0496126_0011800_764_1303 177
77 3300048929 Ga0496126_0205303 Ga0496126_0205303_1092_1625 177
78 3300006038 Ga0075365_10064551 Ga0075365_100645512 178
79 3300050492 nmdc:mga0yw44_154926_c1 nmdc:mga0yw44_154926_c1_543_1079 178
80 3300005614 Ga0068856_100000363 Ga0068856_10000036315 179
81 3300026078 Ga0207702_10000261 Ga0207702_1000026159 179
82 3300048903 Ga0496100_0099850 Ga0496100_0099850_510_1070 179
83 3300048905 Ga0496102_0555129 Ga0496102_0555129_108_668 179
84 3300048909 Ga0496106_0008756 Ga0496106_0008756_3651_4211 179
85 3300048910 Ga0496107_0067333 Ga0496107_0067333_493_1053 179
86 3300048911 Ga0496108_0002640 Ga0496108_0002640_5006_5566 179
87 3300048913 Ga0496110_0021301 Ga0496110_0021301_3760_4320 179
88 3300048914 Ga0496111_0040080 Ga0496111_0040080_2334_2894 179
89 3300048916 Ga0496113_0102542 Ga0496113_0102542_554_1114 179
90 3300048917 Ga0496114_0363606 Ga0496114_0363606_143_703 179
91 3300048929 Ga0496126_0240429 Ga0496126_0240429_310_885 179
92 3300048929 Ga0496126_0580370 Ga0496126_0580370_244_786 179
93 3300053078 Ga0495612_0181380 Ga0495612_0181380_143_685 179
94 3300000549 LJQas_1001531 LJQas_10015312 180
95 3300003203 JGI25406J46586_10000048 JGI25406J46586_1000004810 180
96 3300005327 Ga0070658_10007221 Ga0070658_100072216 180
97 3300005328 Ga0070676_10316315 Ga0070676_103163151 180
98 3300005329 Ga0070683_100015758 Ga0070683_1000157585 180
99 3300005329 Ga0070683_100657065 Ga0070683_1006570652 180
100 3300005336 Ga0070680_100044116 Ga0070680_1000441163 180
101 3300005336 Ga0070680_100046072 Ga0070680_1000460723 180
102 3300005337 Ga0070682_100882692 Ga0070682_1008826921 180
103 3300005338 Ga0068868_100073585 Ga0068868_1000735851 180
104 3300005338 Ga0068868_101208330 Ga0068868_1012083301 180
105 3300005339 Ga0070660_100008957 Ga0070660_1000089574 180
106 3300005341 Ga0070691_10059388 Ga0070691_100593882 180
107 3300005344 Ga0070661_100611679 Ga0070661_1006116791 180
108 3300005364 Ga0070673_100157709 Ga0070673_1001577092 180
109 3300005366 Ga0070659_100037727 Ga0070659_1000377272 180
110 3300005366 Ga0070659_100433794 Ga0070659_1004337941 180
111 3300005434 Ga0070709_10082451 Ga0070709_100824512 180
112 3300005434 Ga0070709_10339556 Ga0070709_103395562 180
113 3300005435 Ga0070714_100026993 Ga0070714_1000269934 180
114 3300005436 Ga0070713_100045688 Ga0070713_1000456883 180
115 3300005436 Ga0070713_100372657 Ga0070713_1003726572 180
116 3300005436 Ga0070713_100419390 Ga0070713_1004193901 180
117 3300005437 Ga0070710_10044379 Ga0070710_100443792 180
118 3300005437 Ga0070710_10375488 Ga0070710_103754882 180
119 3300005438 Ga0070701_10540171 Ga0070701_105401711 180
120 3300005439 Ga0070711_100035807 Ga0070711_1000358071 180
121 3300005439 Ga0070711_100068940 Ga0070711_1000689401 180
122 3300005439 Ga0070711_100654796 Ga0070711_1006547962 180
123 3300005444 Ga0070694_100508704 Ga0070694_1005087042 180
124 3300005455 Ga0070663_100366659 Ga0070663_1003666591 180
125 3300005456 Ga0070678_100017123 Ga0070678_1000171233 180
126 3300005458 Ga0070681_10016205 Ga0070681_100162055 180
127 3300005458 Ga0070681_10053286 Ga0070681_100532865 180
128 3300005458 Ga0070681_10249855 Ga0070681_102498551 180
129 3300005458 Ga0070681_10412465 Ga0070681_104124653 180
130 3300005518 Ga0070699_101536545 Ga0070699_1015365451 180
131 3300005530 Ga0070679_100059711 Ga0070679_1000597113 180
132 3300005530 Ga0070679_100169308 Ga0070679_1001693082 180
133 3300005530 Ga0070679_100634643 Ga0070679_1006346432 180
134 3300005535 Ga0070684_100010386 Ga0070684_1000103865 180
135 3300005535 Ga0070684_100163562 Ga0070684_1001635622 180
136 3300005535 Ga0070684_100274609 Ga0070684_1002746092 180
137 3300005536 Ga0070697_100034479 Ga0070697_1000344792 180
138 3300005539 Ga0068853_100005857 Ga0068853_1000058574 180
139 3300005539 Ga0068853_100179608 Ga0068853_1001796082 180
140 3300005543 Ga0070672_100044440 Ga0070672_1000444404 180
141 3300005547 Ga0070693_100036267 Ga0070693_1000362672 180
142 3300005547 Ga0070693_100213624 Ga0070693_1002136242 180
143 3300005548 Ga0070665_100357265 Ga0070665_1003572652 180
144 3300005548 Ga0070665_100426370 Ga0070665_1004263702 180
145 3300005563 Ga0068855_100061371 Ga0068855_1000613712 180
146 3300005563 Ga0068855_100089033 Ga0068855_1000890333 180
147 3300005563 Ga0068855_100195041 Ga0068855_1001950412 180
148 3300005563 Ga0068855_100481317 Ga0068855_1004813172 180
149 3300005563 Ga0068855_100574937 Ga0068855_1005749371 180
150 3300005563 Ga0068855_100608270 Ga0068855_1006082701 180
151 3300005564 Ga0070664_100026331 Ga0070664_1000263315 180
152 3300005564 Ga0070664_100370084 Ga0070664_1003700842 180
153 3300005577 Ga0068857_100037942 Ga0068857_1000379427 180
154 3300005577 Ga0068857_101688286 Ga0068857_1016882861 180
155 3300005578 Ga0068854_100068908 Ga0068854_1000689084 180
156 3300005578 Ga0068854_100228709 Ga0068854_1002287091 180
157 3300005614 Ga0068856_100283694 Ga0068856_1002836942 180
158 3300005616 Ga0068852_100005807 Ga0068852_1000058072 180
159 3300005616 Ga0068852_100101036 Ga0068852_1001010361 180
160 3300005616 Ga0068852_100551489 Ga0068852_1005514891 180
161 3300005618 Ga0068864_100111252 Ga0068864_1001112522 180
162 3300005618 Ga0068864_100151419 Ga0068864_1001514192 180
163 3300005834 Ga0068851_10106177 Ga0068851_101061771 180
164 3300005841 Ga0068863_100291498 Ga0068863_1002914982 180
165 3300005842 Ga0068858_100185117 Ga0068858_1001851172 180
166 3300005985 Ga0081539_10000008 Ga0081539_10000008279 180
167 3300006028 Ga0070717_10065485 Ga0070717_100654852 180
168 3300006028 Ga0070717_10091712 Ga0070717_100917121 180
169 3300006173 Ga0070716_100127145 Ga0070716_1001271452 180
170 3300006175 Ga0070712_100071504 Ga0070712_1000715042 180
171 3300006175 Ga0070712_100076644 Ga0070712_1000766441 180
172 3300006175 Ga0070712_100092377 Ga0070712_1000923772 180
173 3300006358 Ga0068871_100309654 Ga0068871_1003096542 180
174 3300006881 Ga0068865_100321509 Ga0068865_1003215092 180
175 3300006914 Ga0075436_100360435 Ga0075436_1003604351 180
176 3300006942 Ga0099824_1002915 Ga0099824_10029155 180
177 3300006943 Ga0099822_1012763 Ga0099822_10127639 180
178 3300007265 Ga0099794_10066616 Ga0099794_100666161 180
179 3300009093 Ga0105240_10048119 Ga0105240_100481196 180
180 3300009098 Ga0105245_10163512 Ga0105245_101635123 180
181 3300009098 Ga0105245_10401668 Ga0105245_104016682 180
182 3300009101 Ga0105247_10393835 Ga0105247_103938351 180
183 3300009148 Ga0105243_10241271 Ga0105243_102412713 180
184 3300009174 Ga0105241_10090138 Ga0105241_100901383 180
185 3300009174 Ga0105241_10519226 Ga0105241_105192262 180
186 3300009174 Ga0105241_10758124 Ga0105241_107581241 180
187 3300009177 Ga0105248_10294518 Ga0105248_102945181 180
188 3300009545 Ga0105237_10006757 Ga0105237_100067579 180
189 3300009545 Ga0105237_10011809 Ga0105237_100118094 180
190 3300009545 Ga0105237_10023711 Ga0105237_100237119 180
191 3300009545 Ga0105237_10445308 Ga0105237_104453082 180
192 3300009545 Ga0105237_10903519 Ga0105237_109035191 180
193 3300009551 Ga0105238_10002692 Ga0105238_1000269211 180
194 3300009551 Ga0105238_10101590 Ga0105238_101015905 180
195 3300009551 Ga0105238_10276364 Ga0105238_102763642 180
196 3300009551 Ga0105238_10448996 Ga0105238_104489962 180
197 3300009551 Ga0105238_11308374 Ga0105238_113083741 180
198 3300010159 Ga0099796_10133054 Ga0099796_101330542 180
199 3300010375 Ga0105239_10012853 Ga0105239_100128534 180
200 3300010375 Ga0105239_10199854 Ga0105239_101998542 180
201 3300010375 Ga0105239_10483694 Ga0105239_104836942 180
202 3300011119 Ga0105246_10028122 Ga0105246_100281221 180
203 3300011119 Ga0105246_10245880 Ga0105246_102458802 180
204 3300013104 Ga0157370_10142251 Ga0157370_101422512 180
205 3300013104 Ga0157370_10217616 Ga0157370_102176163 180
206 3300013105 Ga0157369_10004292 Ga0157369_100042924 180
207 3300013105 Ga0157369_10008116 Ga0157369_100081166 180
208 3300013105 Ga0157369_10230394 Ga0157369_102303942 180
209 3300013105 Ga0157369_10335451 Ga0157369_103354512 180
210 3300013105 Ga0157369_10451308 Ga0157369_104513081 180
211 3300013105 Ga0157369_10975752 Ga0157369_109757522 180
212 3300013296 Ga0157374_10028994 Ga0157374_100289945 180
213 3300013297 Ga0157378_10237044 Ga0157378_102370442 180
214 3300013306 Ga0163162_10010007 Ga0163162_1001000710 180
215 3300013306 Ga0163162_10074878 Ga0163162_100748783 180
216 3300013306 Ga0163162_10217908 Ga0163162_102179082 180
217 3300013307 Ga0157372_10037750 Ga0157372_100377505 180
218 3300013307 Ga0157372_10196810 Ga0157372_101968104 180
219 3300013307 Ga0157372_10332291 Ga0157372_103322913 180
220 3300013308 Ga0157375_10036503 Ga0157375_100365033 180
221 3300014325 Ga0163163_10004103 Ga0163163_100041038 180
222 3300014326 Ga0157380_11222064 Ga0157380_112220642 180
223 3300014745 Ga0157377_10424403 Ga0157377_104244032 180
224 3300014969 Ga0157376_10006130 Ga0157376_100061305 180
225 3300014969 Ga0157376_11627914 Ga0157376_116279141 180
226 3300020070 Ga0206356_10910912 Ga0206356_109109122 180
227 3300020070 Ga0206356_11251455 Ga0206356_112514552 180
228 3300021384 Ga0213876_10049984 Ga0213876_100499842 180
229 3300025261 Ga0209233_1001233 Ga0209233_10012335 180
230 3300025321 Ga0207656_10348292 Ga0207656_103482921 180
231 3300025900 Ga0207710_10478654 Ga0207710_104786541 180
232 3300025904 Ga0207647_10138605 Ga0207647_101386052 180
233 3300025905 Ga0207685_10109196 Ga0207685_101091962 180
234 3300025906 Ga0207699_10067450 Ga0207699_100674502 180
235 3300025906 Ga0207699_10258155 Ga0207699_102581552 180
236 3300025907 Ga0207645_10364131 Ga0207645_103641311 180
237 3300025909 Ga0207705_10012662 Ga0207705_100126625 180
238 3300025909 Ga0207705_10715385 Ga0207705_107153851 180
239 3300025910 Ga0207684_10962078 Ga0207684_109620781 180
240 3300025911 Ga0207654_10074113 Ga0207654_100741131 180
241 3300025912 Ga0207707_10015318 Ga0207707_100153182 180
242 3300025912 Ga0207707_10040760 Ga0207707_100407602 180
243 3300025912 Ga0207707_10121346 Ga0207707_101213462 180
244 3300025912 Ga0207707_10342301 Ga0207707_103423012 180
245 3300025913 Ga0207695_10021731 Ga0207695_100217312 180
246 3300025913 Ga0207695_10160882 Ga0207695_101608822 180
247 3300025913 Ga0207695_10177540 Ga0207695_101775402 180
248 3300025914 Ga0207671_10041126 Ga0207671_100411264 180
249 3300025914 Ga0207671_10139527 Ga0207671_101395272 180
250 3300025914 Ga0207671_10180431 Ga0207671_101804311 180
251 3300025914 Ga0207671_10186464 Ga0207671_101864642 180
252 3300025914 Ga0207671_10503803 Ga0207671_105038031 180
253 3300025914 Ga0207671_10523695 Ga0207671_105236951 180
254 3300025915 Ga0207693_10018039 Ga0207693_100180392 180
255 3300025915 Ga0207693_10033278 Ga0207693_100332782 180
256 3300025915 Ga0207693_10152028 Ga0207693_101520283 180
257 3300025916 Ga0207663_10004056 Ga0207663_100040562 180
258 3300025917 Ga0207660_10028890 Ga0207660_100288904 180
259 3300025917 Ga0207660_10063549 Ga0207660_100635493 180
260 3300025917 Ga0207660_10179064 Ga0207660_101790642 180
261 3300025917 Ga0207660_10437215 Ga0207660_104372152 180
262 3300025917 Ga0207660_10539576 Ga0207660_105395761 180
263 3300025919 Ga0207657_10034539 Ga0207657_100345392 180
264 3300025919 Ga0207657_10314397 Ga0207657_103143972 180
265 3300025921 Ga0207652_10056918 Ga0207652_100569181 180
266 3300025921 Ga0207652_10064077 Ga0207652_100640773 180
267 3300025921 Ga0207652_10066101 Ga0207652_100661013 180
268 3300025921 Ga0207652_10172646 Ga0207652_101726462 180
269 3300025924 Ga0207694_10259191 Ga0207694_102591913 180
270 3300025926 Ga0207659_10649219 Ga0207659_106492192 180
271 3300025927 Ga0207687_10200730 Ga0207687_102007303 180
272 3300025927 Ga0207687_10296829 Ga0207687_102968292 180
273 3300025928 Ga0207700_10097557 Ga0207700_100975573 180
274 3300025928 Ga0207700_10256597 Ga0207700_102565972 180
275 3300025928 Ga0207700_10267481 Ga0207700_102674811 180
276 3300025934 Ga0207686_10841937 Ga0207686_108419371 180
277 3300025938 Ga0207704_10672753 Ga0207704_106727532 180
278 3300025939 Ga0207665_10105006 Ga0207665_101050064 180
279 3300025940 Ga0207691_10094970 Ga0207691_100949702 180
280 3300025942 Ga0207689_10183786 Ga0207689_101837862 180
281 3300025944 Ga0207661_10001312 Ga0207661_1000131212 180
282 3300025944 Ga0207661_10019448 Ga0207661_100194483 180
283 3300025944 Ga0207661_10162045 Ga0207661_101620452 180
284 3300025944 Ga0207661_10582610 Ga0207661_105826102 180
285 3300025945 Ga0207679_10048078 Ga0207679_100480782 180
286 3300025949 Ga0207667_10073039 Ga0207667_100730392 180
287 3300025949 Ga0207667_10162936 Ga0207667_101629362 180
288 3300025949 Ga0207667_10207601 Ga0207667_102076011 180
289 3300025949 Ga0207667_10317367 Ga0207667_103173673 180
290 3300025981 Ga0207640_10189323 Ga0207640_101893233 180
291 3300025981 Ga0207640_11182924 Ga0207640_111829241 180
292 3300026023 Ga0207677_11011456 Ga0207677_110114561 180
293 3300026035 Ga0207703_10711951 Ga0207703_107119511 180
294 3300026041 Ga0207639_10017229 Ga0207639_100172293 180
295 3300026041 Ga0207639_10377992 Ga0207639_103779923 180
296 3300026067 Ga0207678_10011003 Ga0207678_100110032 180
297 3300026078 Ga0207702_10182239 Ga0207702_101822392 180
298 3300026088 Ga0207641_10739890 Ga0207641_107398902 180
299 3300026095 Ga0207676_10110007 Ga0207676_101100072 180
300 3300026116 Ga0207674_10028112 Ga0207674_100281127 180
301 3300026121 Ga0207683_10206076 Ga0207683_102060762 180
302 3300026142 Ga0207698_10062739 Ga0207698_100627392 180
303 3300026142 Ga0207698_10068099 Ga0207698_100680992 180
304 3300026142 Ga0207698_10641720 Ga0207698_106417201 180
305 3300027357 Ga0209589_1000004 Ga0209589_10000048 180
306 3300027361 Ga0209489_100004 Ga0209489_1000048 180
307 3300027363 Ga0209700_100004 Ga0209700_1000048 180
308 3300028573 Ga0265334_10030027 Ga0265334_100300272 180
309 3300031238 Ga0265332_10006468 Ga0265332_100064686 180
310 3300031239 Ga0265328_10211662 Ga0265328_102116621 180
311 3300031247 Ga0265340_10013940 Ga0265340_100139406 180
312 3300031247 Ga0265340_10098077 Ga0265340_100980771 180
313 3300031249 Ga0265339_10011794 Ga0265339_100117945 180
314 3300031249 Ga0265339_10152007 Ga0265339_101520071 180
315 3300031250 Ga0265331_10074035 Ga0265331_100740352 180
316 3300031616 Ga0307508_10001617 Ga0307508_1000161712 180
317 3300031616 Ga0307508_10106805 Ga0307508_101068054 180
318 3300031712 Ga0265342_10087235 Ga0265342_100872351 180
319 3300031712 Ga0265342_10133107 Ga0265342_101331072 180
320 3300033180 Ga0307510_10026735 Ga0307510_100267355 180
321 3300033442 Ga0315911_1000011 Ga0315911_1000011237 180
322 3300033544 Ga0316215_1004538 Ga0316215_10045382 180
323 3300033544 Ga0316215_1015855 Ga0316215_10158551 180
324 3300035083 Ga0373926_0009066 Ga0373926_0009066_50_592 180
325 3300035084 Ga0373928_0114881 Ga0373928_0114881_85_627 180
326 3300035086 Ga0373934_0001081 Ga0373934_0001081_8483_9025 180
327 3300035086 Ga0373934_0158005 Ga0373934_0158005_68_610 180
328 3300035089 Ga0373944_0009877 Ga0373944_0009877_1691_2233 180
329 3300035111 Ga0373923_0009768 Ga0373923_0009768_758_1300 180
330 3300035111 Ga0373923_0025745 Ga0373923_0025745_160_702 180
331 3300035112 Ga0373932_0102275 Ga0373932_0102275_153_695 180
332 3300035113 Ga0373936_0011831 Ga0373936_0011831_446_988 180
333 3300035117 Ga0373953_0027234 Ga0373953_0027234_1605_2147 180
334 3300035117 Ga0373953_0028946 Ga0373953_0028946_1544_2086 180
335 3300035118 Ga0373954_0008459 Ga0373954_0008459_2295_2837 180
336 3300035119 Ga0373956_0014367 Ga0373956_0014367_1816_2358 180
337 3300035120 Ga0373957_0010028 Ga0373957_0010028_444_986 180
338 3300035170 Ga0373943_0013493 Ga0373943_0013493_1817_2359 180
339 3300035170 Ga0373943_0130166 Ga0373943_0130166_369_917 180
340 3300035171 Ga0373946_0008767 Ga0373946_0008767_1445_1987 180
341 3300035172 Ga0373955_0024390 Ga0373955_0024390_1902_2444 180
342 3300035172 Ga0373955_0070777 Ga0373955_0070777_573_1115 180
343 3300035172 Ga0373955_0147914 Ga0373955_0147914_64_606 180
344 3300035410 Ga0373924_0074161 Ga0373924_0074161_155_697 180
345 3300035692 Ga0373935_0046996 Ga0373935_0046996_1071_1613 180
346 3300035695 Ga0373927_0109956 Ga0373927_0109956_366_908 180
347 3300035724 Ga0373933_0067407 Ga0373933_0067407_883_1425 180
348 3300035724 Ga0373933_0081634 Ga0373933_0081634_757_1299 180
349 3300035724 Ga0373933_0232950 Ga0373933_0232950_288_830 180
350 3300035725 Ga0373947_0056739 Ga0373947_0056739_995_1537 180
351 3300035725 Ga0373947_0090355 Ga0373947_0090355_1009_1551 180
352 3300035725 Ga0373947_0215701 Ga0373947_0215701_417_965 180
353 3300036401 Ga0373937_0030893 Ga0373937_0030893_107_649 180
354 3300036401 Ga0373937_0293018 Ga0373937_0293018_149_691 180
355 3300036401 Ga0373937_0300953 Ga0373937_0300953_647_1189 180
356 3300036459 Ga0372808_003696 Ga0372808_003696_655_1197 180
357 3300037068 Ga0373925_0070463 Ga0373925_0070463_1921_2469 180
358 3300037068 Ga0373925_0140935 Ga0373925_0140935_766_1308 180
359 3300037068 Ga0373925_0169723 Ga0373925_0169723_1019_1561 180
360 3300037418 Ga0395900_0057479 Ga0395900_0057479_157_699 180
361 3300037418 Ga0395900_0442408 Ga0395900_0442408_145_687 180
362 3300037466 Ga0395898_0076506 Ga0395898_0076506_785_1327 180
363 3300037466 Ga0395898_0505642 Ga0395898_0505642_71_613 180
364 3300037853 Ga0436364_0384534 Ga0436364_0384534_4314_4856 180
365 3300037853 Ga0436364_1255264 Ga0436364_1255264_1878_2420 180
366 3300038443 Ga0395901_0474403 Ga0395901_0474403_652_1194 180
367 3300038443 Ga0395901_0907886 Ga0395901_0907886_66_608 180
368 3300039437 Ga0436365_0572673 Ga0436365_0572673_155_697 180
369 3300039437 Ga0436365_1697229 Ga0436365_1697229_1885_2427 180
370 3300039438 Ga0436360_0275470 Ga0436360_0275470_955_1497 180
371 3300039447 Ga0436361_0725474 Ga0436361_0725474_8857_9399 180
372 3300039450 Ga0436363_0938134 Ga0436363_0938134_33_575 180
373 3300039450 Ga0436363_1401514 Ga0436363_1401514_205_747 180
374 3300041507 Ga0451851_0713221 Ga0451851_0713221_431_973 180
375 3300044684 Ga0466966_0147135 Ga0466966_0147135_609_1151 180
376 3300045049 Ga0466959_0050741 Ga0466959_0050741_1840_2403 180
377 3300046454 Ga0495592_0001055 Ga0495592_0001055_10020_10562 180
378 3300046454 Ga0495592_0057172 Ga0495592_0057172_915_1457 180
379 3300046454 Ga0495592_0066154 Ga0495592_0066154_48_590 180
380 3300046455 Ga0495603_0459049 Ga0495603_0459049_166_708 180
381 3300046459 Ga0495629_0004163 Ga0495629_0004163_10236_10778 180
382 3300046459 Ga0495629_0040163 Ga0495629_0040163_776_1318 180
383 3300046459 Ga0495629_0254433 Ga0495629_0254433_33_575 180
384 3300046461 Ga0495641_0080234 Ga0495641_0080234_107_649 180
385 3300046462 Ga0495651_0115143 Ga0495651_0115143_123_665 180
386 3300046462 Ga0495651_0122565 Ga0495651_0122565_888_1430 180
387 3300046463 Ga0495653_0013831 Ga0495653_0013831_5994_6536 180
388 3300046463 Ga0495653_0107935 Ga0495653_0107935_1207_1749 180
389 3300046472 Ga0495580_0023995 Ga0495580_0023995_1596_2138 180
390 3300046473 Ga0495582_0092591 Ga0495582_0092591_698_1240 180
391 3300046475 Ga0495639_0004720 Ga0495639_0004720_798_1340 180
392 3300046475 Ga0495639_0133578 Ga0495639_0133578_247_789 180
393 3300046477 Ga0495664_0021707 Ga0495664_0021707_1469_2011 180
394 3300046499 Ga0495594_0259940 Ga0495594_0259940_276_818 180
395 3300046511 Ga0495608_0007611 Ga0495608_0007611_1357_1899 180
396 3300046511 Ga0495608_0046596 Ga0495608_0046596_565_1107 180
397 3300046514 Ga0495618_0028872 Ga0495618_0028872_1256_1798 180
398 3300046514 Ga0495618_0249246 Ga0495618_0249246_174_716 180
399 3300046516 Ga0495628_0007764 Ga0495628_0007764_291_833 180
400 3300046516 Ga0495628_0295854 Ga0495628_0295854_473_1015 180
401 3300046517 Ga0495630_0494318 Ga0495630_0494318_298_840 180
402 3300046529 Ga0495652_0093148 Ga0495652_0093148_661_1203 180
403 3300046529 Ga0495652_0189706 Ga0495652_0189706_478_1020 180
404 3300046533 Ga0495640_0006867 Ga0495640_0006867_3350_3892 180
405 3300046535 Ga0495586_0087781 Ga0495586_0087781_374_916 180
406 3300046543 Ga0495645_0024430 Ga0495645_0024430_2372_2914 180
407 3300046543 Ga0495645_0097198 Ga0495645_0097198_380_922 180
408 3300046559 Ga0495667_0137410 Ga0495667_0137410_216_758 180
409 3300046559 Ga0495667_0202444 Ga0495667_0202444_164_706 180
410 3300046559 Ga0495667_0409694 Ga0495667_0409694_211_753 180
411 3300046616 Ga0495668_0065320 Ga0495668_0065320_1234_1776 180
412 3300046642 Ga0495634_0121474 Ga0495634_0121474_331_873 180
413 3300046642 Ga0495634_0146073 Ga0495634_0146073_527_1069 180
414 3300046663 Ga0495635_0010764 Ga0495635_0010764_1946_2488 180
415 3300046663 Ga0495635_0064224 Ga0495635_0064224_856_1398 180
416 3300046675 Ga0495657_0052411 Ga0495657_0052411_216_758 180
417 3300046675 Ga0495657_0066866 Ga0495657_0066866_25_567 180
418 3300046675 Ga0495657_0599103 Ga0495657_0599103_58_600 180
419 3300046678 Ga0495599_0196325 Ga0495599_0196325_483_1025 180
420 3300046679 Ga0495623_0047788 Ga0495623_0047788_251_793 180
421 3300046679 Ga0495623_0145534 Ga0495623_0145534_363_905 180
422 3300046679 Ga0495623_0196600 Ga0495623_0196600_524_1072 180
423 3300046680 Ga0495646_0005624 Ga0495646_0005624_7295_7837 180
424 3300046680 Ga0495646_0011556 Ga0495646_0011556_3223_3765 180
425 3300046681 Ga0495647_0025122 Ga0495647_0025122_1596_2138 180
426 3300046684 Ga0495669_0385876 Ga0495669_0385876_124_666 180
427 3300046689 Ga0495613_0247960 Ga0495613_0247960_484_1026 180
428 3300046689 Ga0495613_0683489 Ga0495613_0683489_35_577 180
429 3300046690 Ga0495624_0387958 Ga0495624_0387958_31_573 180
430 3300046809 Ga0495600_0145955 Ga0495600_0145955_216_758 180
431 3300047315 Ga0495581_0005564 Ga0495581_0005564_5256_5798 180
432 3300047317 Ga0495604_0175939 Ga0495604_0175939_759_1301 180
433 3300047319 Ga0495674_0041199 Ga0495674_0041199_2101_2643 180
434 3300047319 Ga0495674_0088150 Ga0495674_0088150_1711_2253 180
435 3300047319 Ga0495674_0382063 Ga0495674_0382063_496_1038 180
436 3300047322 Ga0495680_0043560 Ga0495680_0043560_1391_1933 180
437 3300047322 Ga0495680_0066622 Ga0495680_0066622_1455_1997 180
438 3300047444 Ga0495675_0093480 Ga0495675_0093480_1129_1671 180
439 3300047444 Ga0495675_0277308 Ga0495675_0277308_25_567 180
440 3300047469 Ga0495673_0021944 Ga0495673_0021944_1868_2410 180
441 3300047471 Ga0495684_0003999 Ga0495684_0003999_10229_10771 180
442 3300047471 Ga0495684_0007513 Ga0495684_0007513_6823_7365 180
443 3300047471 Ga0495684_0111090 Ga0495684_0111090_311_853 180
444 3300047472 Ga0495686_0061810 Ga0495686_0061810_366_908 180
445 3300047472 Ga0495686_0091375 Ga0495686_0091375_731_1273 180
446 3300047673 Ga0495593_0011503 Ga0495593_0011503_3636_4178 180
447 3300047673 Ga0495593_0035667 Ga0495593_0035667_1559_2101 180
448 3300048088 Ga0495602_0087506 Ga0495602_0087506_1345_1887 180
449 3300048903 Ga0496100_0168677 Ga0496100_0168677_477_1019 180
450 3300048903 Ga0496100_0390058 Ga0496100_0390058_379_921 180
451 3300048904 Ga0496101_0037617 Ga0496101_0037617_1906_2448 180
452 3300048904 Ga0496101_0271355 Ga0496101_0271355_159_701 180
453 3300048904 Ga0496101_0697786 Ga0496101_0697786_36_578 180
454 3300048905 Ga0496102_0003066 Ga0496102_0003066_5606_6148 180
455 3300048905 Ga0496102_0082282 Ga0496102_0082282_200_742 180
456 3300048905 Ga0496102_0252034 Ga0496102_0252034_667_1209 180
457 3300048907 Ga0496104_0008842 Ga0496104_0008842_4534_5076 180
458 3300048907 Ga0496104_0074804 Ga0496104_0074804_2168_2710 180
459 3300048908 Ga0496105_0016158 Ga0496105_0016158_929_1471 180
460 3300048908 Ga0496105_0169585 Ga0496105_0169585_395_937 180
461 3300048909 Ga0496106_0096534 Ga0496106_0096534_562_1104 180
462 3300048909 Ga0496106_0580143 Ga0496106_0580143_289_831 180
463 3300048910 Ga0496107_0070336 Ga0496107_0070336_819_1361 180
464 3300048911 Ga0496108_0025410 Ga0496108_0025410_2281_2823 180
465 3300048911 Ga0496108_0061696 Ga0496108_0061696_1585_2127 180
466 3300048912 Ga0496109_0039242 Ga0496109_0039242_1353_1895 180
467 3300048912 Ga0496109_1557405 Ga0496109_1557405_21_563 180
468 3300048913 Ga0496110_0071118 Ga0496110_0071118_1988_2530 180
469 3300048914 Ga0496111_0063449 Ga0496111_0063449_793_1335 180
470 3300048914 Ga0496111_0118540 Ga0496111_0118540_587_1129 180
471 3300048915 Ga0496112_0000059 Ga0496112_0000059_52461_53003 180
472 3300048915 Ga0496112_0037238 Ga0496112_0037238_3824_4366 180
473 3300048915 Ga0496112_0054565 Ga0496112_0054565_1279_1821 180
474 3300048915 Ga0496112_0534192 Ga0496112_0534192_292_834 180
475 3300048916 Ga0496113_0025039 Ga0496113_0025039_845_1387 180
476 3300048916 Ga0496113_0027493 Ga0496113_0027493_2597_3139 180
477 3300048917 Ga0496114_0006343 Ga0496114_0006343_994_1536 180
478 3300048917 Ga0496114_0140466 Ga0496114_0140466_410_952 180
479 3300048917 Ga0496114_0229387 Ga0496114_0229387_788_1330 180
480 3300048918 Ga0496115_0001279 Ga0496115_0001279_9834_10376 180
481 3300048918 Ga0496115_0057665 Ga0496115_0057665_207_749 180
482 3300048918 Ga0496115_0200370 Ga0496115_0200370_185_727 180
483 3300048918 Ga0496115_0244761 Ga0496115_0244761_170_712 180
484 3300048918 Ga0496115_0325291 Ga0496115_0325291_446_988 180
485 3300048918 Ga0496115_0456210 Ga0496115_0456210_471_1013 180
486 3300048924 Ga0496121_0000300 Ga0496121_0000300_93886_94428 180
487 3300048924 Ga0496121_0054766 Ga0496121_0054766_45_587 180
488 3300048924 Ga0496121_0103354 Ga0496121_0103354_1575_2117 180
489 3300048924 Ga0496121_0276112 Ga0496121_0276112_308_850 180
490 3300048929 Ga0496126_0029427 Ga0496126_0029427_4438_4980 180
491 3300048929 Ga0496126_0115100 Ga0496126_0115100_1279_1821 180
492 3300048929 Ga0496126_0136684 Ga0496126_0136684_1075_1617 180
493 3300048929 Ga0496126_0220369 Ga0496126_0220369_220_762 180
494 3300048929 Ga0496126_0316796 Ga0496126_0316796_537_1079 180
495 3300049580 Ga0501046_0271486 Ga0501046_0271486_95_637 180
496 3300049581 Ga0501047_0555089 Ga0501047_0555089_382_924 180
497 3300050512 nmdc:mga0n895_34674_c1 nmdc:mga0n895_34674_c1_2376_2918 180
498 3300050514 nmdc:mga08x19_413730_c1 nmdc:mga08x19_413730_c1_48_590 180
499 3300053077 Ga0495601_0035582 Ga0495601_0035582_771_1313 180
500 3300053077 Ga0495601_0038496 Ga0495601_0038496_500_1048 180
501 3300053077 Ga0495601_0083012 Ga0495601_0083012_42_584 180
502 3300053078 Ga0495612_0025319 Ga0495612_0025319_1627_2169 180
503 3300053078 Ga0495612_0038058 Ga0495612_0038058_1191_1733 180
504 3300053080 Ga0500635_0003001 Ga0500635_0003001_1551_2093 180
505 3300053084 Ga0495595_0052569 Ga0495595_0052569_1090_1632 180
506 3300053084 Ga0495595_0114225 Ga0495595_0114225_12_554 180
507 3300053085 Ga0495619_0022919 Ga0495619_0022919_618_1160 180
508 3300053085 Ga0495619_0064822 Ga0495619_0064822_1733_2275 180
509 3300053085 Ga0495619_0439520 Ga0495619_0439520_273_815 180
510 3300053094 Ga0500566_0347466 Ga0500566_0347466_58_600 180
511 3300053104 Ga0500556_0024589 Ga0500556_0024589_1175_1717 180
512 3300053119 Ga0500595_003666 Ga0500595_003666_6362_6904 180
513 3300053139 Ga0500568_0004707 Ga0500568_0004707_158_700 180
514 3300053150 Ga0500603_000154 Ga0500603_000154_9096_9638 180
515 3300053178 Ga0500637_0000127 Ga0500637_0000127_14332_14874 180

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

4

116

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rfl-assembly4.cif.gz_D crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.7699 6 171
4hbz-assembly1.cif.gz_A the structure of putative phosphohistidine phosphatase sixa from nakamurella multipartitia. 0.7513 4 171
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.7461 6 171
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.744 6 171
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.7397 6 171
ID Description Score Start End Superfamily
af_O44899_1_131_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8844 25 85 3.40.50.1240
af_Q9LW33_109_250_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8541 25 86 3.40.50.1240
af_I1MNN7_108_282_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8536 25 86 3.40.50.1240
af_K7TSF9_113_270_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8508 25 86 3.40.50.1240
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8077 7 171 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A0G0SDM2-F1-model_v4 Phosphoglycerate mutase 0.9141 21 85
AF-A0A3B9QGN6-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9016 24 85 GO:0006096
GO:0016868
AF-A0A6I2AEU5-F1-model_v4 deleted 0.9009 23 88
AF-A0A3B8ULG0-F1-model_v4 Histidine phosphatase 0.8945 21 96
AF-A0A2B4MAW0-F1-model_v4 deleted 0.8933 23 85

Feature Viewer

pLDDT pTM Quality
76.38 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map