F457794

General Info

Members Datasets Scaffolds Average Seq Length
514 156 1028 287

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_347370_c1|nmdc:mga0rr50_347370_c1_225_1175
Length 316
Sequence MRGSTRASGTAERVSTVTARVATLQDEVPPPSVEISRTRALAHALRRQPLGAFSAALIVVIVLTAIFADVLSPYDPLETRPEIRLTRPAWDHPFGTDDIGRDVLSRVIHGARISLWVGLLAVGIGTAAGMVIGLLCGYCEGRLDLIFQRVMDAIQAIPGLMLALAIVSVLRPNTTNAMIAIAIVIIPGNSRIVRGAVMSAKQNRYVEAAQAIGCQHPRIILSHILPNVTAPILIIASIWLGNAILIEATLSFLGVGTQPPTPSWGLMLSSTGRAFMEQAPWLAVFPGLAISLSVLAFNLFGDTLRDAWDPKLRNAR

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
75 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
123 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
124 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
130 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
131 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
134 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
135 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
136 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
152 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
153 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
154 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
155 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
156 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.61
Metatranscriptomes 0
Isolates 0.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 0.19
Rhizosphere 98.64
Stem 0
Stem Tuber 0
Unclassified 2.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_347370_c1 3300050513 Bacteria 1247
2 JGI25406J46586_10004042 3300003203 Bacteria 6858
3 JGI25406J46586_10005962 3300003203 Bacteria 5638
4 Ga0070690_100012309 3300005330 Bacteria 5034
5 Ga0070670_100004977 3300005331 Bacteria 11178
6 Ga0070677_10089822 3300005333 Bacteria 1334
7 Ga0068869_100001075 3300005334 Bacteria 15932
8 Ga0068869_100299019 3300005334 Bacteria 1299
9 Ga0070680_100026431 3300005336 Bacteria 4643
10 Ga0070680_100072581 3300005336 Bacteria 2829
11 Ga0070689_100158627 3300005340 Bacteria 1828
12 Ga0070687_100060673 3300005343 Bacteria 1996
13 Ga0070687_100103277 3300005343 Bacteria 1600
14 Ga0070692_10004648 3300005345 Bacteria 5753
15 Ga0070668_100223108 3300005347 Bacteria 1555
16 Ga0070669_100009417 3300005353 Bacteria 6954
17 Ga0070667_100013739 3300005367 Bacteria 6693
18 Ga0070709_10051782 3300005434 Bacteria 2578
19 Ga0070714_100273839 3300005435 Bacteria 1566
20 Ga0070701_10001110 3300005438 Bacteria 9837
21 Ga0070705_100002703 3300005440 Bacteria 8862
22 Ga0070705_100011731 3300005440 Bacteria 4432
23 Ga0070705_100012954 3300005440 Bacteria 4253
24 Ga0070705_100065950 3300005440 Bacteria 2169
25 Ga0070705_100107517 3300005440 Bacteria 1775
26 Ga0070705_100150522 3300005440 Bacteria 1543
27 Ga0070705_100162458 3300005440 Bacteria 1495
28 Ga0070700_100144566 3300005441 Bacteria 1620
29 Ga0070694_100009398 3300005444 Bacteria 6001
30 Ga0070694_100015760 3300005444 Bacteria 4754
31 Ga0070694_100038546 3300005444 Bacteria 3176
32 Ga0070708_100005287 3300005445 Bacteria 10227
33 Ga0070708_100008492 3300005445 Bacteria 8251
34 Ga0070708_100009294 3300005445 Bacteria 7921
35 Ga0070708_100010505 3300005445 Bacteria 7505
36 Ga0070708_100017473 3300005445 Bacteria 5986
37 Ga0070708_100025115 3300005445 Bacteria 5091
38 Ga0070708_100028954 3300005445 Bacteria 4771
39 Ga0070708_100029108 3300005445 Bacteria 4761
40 Ga0070708_100036362 3300005445 Bacteria 4295
41 Ga0070708_100081939 3300005445 Bacteria 2922
42 Ga0070708_100117593 3300005445 Bacteria 2448
43 Ga0070708_100315348 3300005445 Bacteria 1473
44 Ga0070708_100323634 3300005445 Bacteria 1452
45 Ga0070708_100416265 3300005445 Bacteria 1267
46 Ga0070681_10294606 3300005458 Bacteria 1532
47 Ga0068867_100035091 3300005459 Bacteria 3637
48 Ga0068867_100349034 3300005459 Bacteria 1234
49 Ga0070706_100029391 3300005467 Bacteria 5064
50 Ga0070706_100034533 3300005467 Bacteria 4672
51 Ga0070706_100042379 3300005467 Bacteria 4205
52 Ga0070706_100072133 3300005467 Bacteria 3195
53 Ga0070706_100091769 3300005467 Bacteria 2817
54 Ga0070706_100125486 3300005467 Bacteria 2393
55 Ga0070706_100130228 3300005467 Bacteria 2348
56 Ga0070706_100152068 3300005467 Bacteria 2160
57 Ga0070706_100160141 3300005467 Bacteria 2101
58 Ga0070706_100201610 3300005467 Bacteria 1858
59 Ga0070706_100223489 3300005467 Bacteria 1758
60 Ga0070706_100281313 3300005467 Bacteria 1552
61 Ga0070707_100013227 3300005468 Bacteria 7716
62 Ga0070707_100017904 3300005468 Bacteria 6662
63 Ga0070707_100041534 3300005468 Bacteria 4402
64 Ga0070707_100047673 3300005468 Bacteria 4101
65 Ga0070707_100089644 3300005468 Bacteria 2976
66 Ga0070707_100135558 3300005468 Bacteria 2395
67 Ga0070707_100154753 3300005468 Bacteria 2233
68 Ga0070707_100202520 3300005468 Bacteria 1935
69 Ga0070707_100268741 3300005468 Bacteria 1658
70 Ga0070698_100009575 3300005471 Bacteria 10367
71 Ga0070698_100014052 3300005471 Bacteria 8466
72 Ga0070698_100014522 3300005471 Bacteria 8313
73 Ga0070698_100055236 3300005471 Bacteria 4028
74 Ga0070698_100058087 3300005471 Bacteria 3912
75 Ga0070698_100103031 3300005471 Bacteria 2824
76 Ga0070698_100117308 3300005471 Bacteria 2624
77 Ga0070698_100270798 3300005471 Bacteria 1630
78 Ga0070699_100010567 3300005518 Bacteria 7991
79 Ga0070699_100016408 3300005518 Bacteria 6361
80 Ga0070699_100030174 3300005518 Bacteria 4680
81 Ga0070699_100030323 3300005518 Bacteria 4668
82 Ga0070699_100036865 3300005518 Bacteria 4230
83 Ga0070699_100043509 3300005518 Bacteria 3886
84 Ga0070699_100047625 3300005518 Bacteria 3709
85 Ga0070699_100208442 3300005518 Bacteria 1739
86 Ga0070699_100461129 3300005518 Bacteria 1152
87 Ga0070679_100002223 3300005530 Bacteria 17526
88 Ga0070697_100001306 3300005536 Bacteria 18800
89 Ga0070697_100009238 3300005536 Bacteria 7705
90 Ga0070697_100010498 3300005536 Bacteria 7229
91 Ga0070697_100013824 3300005536 Bacteria 6333
92 Ga0070697_100025490 3300005536 Bacteria 4717
93 Ga0070697_100051641 3300005536 Bacteria 3341
94 Ga0070697_100072286 3300005536 Bacteria 2830
95 Ga0070672_100039417 3300005543 Bacteria 3618
96 Ga0070672_100092385 3300005543 Bacteria 2443
97 Ga0070686_100182329 3300005544 Bacteria 1493
98 Ga0070686_100411899 3300005544 Bacteria 1030
99 Ga0070695_100010527 3300005545 Bacteria 5523
100 Ga0070695_100019539 3300005545 Bacteria 4125
101 Ga0070695_100047251 3300005545 Bacteria 2749
102 Ga0070695_100179707 3300005545 Bacteria 1498
103 Ga0070696_100137733 3300005546 Bacteria 1781
104 Ga0070696_100146719 3300005546 Bacteria 1729
105 Ga0070696_100362233 3300005546 Bacteria 1126
106 Ga0070704_100149071 3300005549 Bacteria 1837
107 Ga0070704_100616467 3300005549 Bacteria 955
108 Ga0070664_100269135 3300005564 Bacteria 1534
109 Ga0068857_100083624 3300005577 Bacteria 2851
110 Ga0068857_100178034 3300005577 Bacteria 1935
111 Ga0068856_100165212 3300005614 Bacteria 2224
112 Ga0068852_100360043 3300005616 Bacteria 1423
113 Ga0068859_100339373 3300005617 Bacteria 1597
114 Ga0068859_100398302 3300005617 Bacteria 1472
115 Ga0068864_100261698 3300005618 Bacteria 1609
116 Ga0068866_10184511 3300005718 Bacteria 1235
117 Ga0068861_100327854 3300005719 Bacteria 1335
118 Ga0068863_100005957 3300005841 Bacteria 11958
119 Ga0068863_100688295 3300005841 Bacteria 1016
120 Ga0068858_100001786 3300005842 Bacteria 21938
121 Ga0068860_100047717 3300005843 Bacteria 4081
122 Ga0068860_100084795 3300005843 Bacteria 3013
123 Ga0068860_100464720 3300005843 Bacteria 1259
124 Ga0068860_100581038 3300005843 Bacteria 1124
125 Ga0068862_100017044 3300005844 Bacteria 6044
126 Ga0068862_100096284 3300005844 Bacteria 2583
127 Ga0068862_100173232 3300005844 Bacteria 1933
128 Ga0068862_100392720 3300005844 Bacteria 1296
129 Ga0081455_10001418 3300005937 Bacteria 29680
130 Ga0081455_10002193 3300005937 Bacteria 23272
131 Ga0081538_10002408 3300005981 Bacteria 18363
132 Ga0081538_10013445 3300005981 Bacteria 6476
133 Ga0081538_10014639 3300005981 Bacteria 6130
134 Ga0081538_10099234 3300005981 Bacteria 1472
135 Ga0081540_1004046 3300005983 Bacteria 11356
136 Ga0081539_10000021 3300005985 Bacteria 360643
137 Ga0081539_10000044 3300005985 Bacteria 284021
138 Ga0081539_10005018 3300005985 Bacteria 13965
139 Ga0075428_100000267 3300006844 Bacteria 51547
140 Ga0075428_100003308 3300006844 Bacteria 17625
141 Ga0075428_100017629 3300006844 Bacteria 7888
142 Ga0075428_100041829 3300006844 Bacteria 5039
143 Ga0075428_100050939 3300006844 Bacteria 4539
144 Ga0075428_100061315 3300006844 Bacteria 4119
145 Ga0075428_100065523 3300006844 Bacteria 3978
146 Ga0075428_100181484 3300006844 Bacteria 2278
147 Ga0075428_100287719 3300006844 Unclassified 1768
148 Ga0075428_100303671 3300006844 Bacteria 1716
149 Ga0075428_100346190 3300006844 Bacteria 1595
150 Ga0075430_100002575 3300006846 Bacteria 15127
151 Ga0075430_100043747 3300006846 Bacteria 3786
152 Ga0075431_100000270 3300006847 Bacteria 40180
153 Ga0075431_100003078 3300006847 Bacteria 16159
154 Ga0075431_100004687 3300006847 Bacteria 13432
155 Ga0075431_100005368 3300006847 Bacteria 12652
156 Ga0075431_100009485 3300006847 Bacteria 9772
157 Ga0075431_100010697 3300006847 Bacteria 9220
158 Ga0075431_100046847 3300006847 Bacteria 4458
159 Ga0075431_100050025 3300006847 Bacteria 4309
160 Ga0075431_100087361 3300006847 Bacteria 3217
161 Ga0075431_100117315 3300006847 Bacteria 2747
162 Ga0075431_100179519 3300006847 Unclassified 2173
163 Ga0075431_100380357 3300006847 Bacteria 1416
164 Ga0075433_10000853 3300006852 Bacteria 21407
165 Ga0075433_10023536 3300006852 Bacteria 5186
166 Ga0075433_10028412 3300006852 Bacteria 4754
167 Ga0075433_10029270 3300006852 Bacteria 4691
168 Ga0075433_10031178 3300006852 Bacteria 4555
169 Ga0075433_10032861 3300006852 Bacteria 4446
170 Ga0075433_10062599 3300006852 Bacteria 3258
171 Ga0075433_10065289 3300006852 Bacteria 3192
172 Ga0075433_10187234 3300006852 Bacteria 1841
173 Ga0075433_10189519 3300006852 Bacteria 1830
174 Ga0075433_10204253 3300006852 Bacteria 1756
175 Ga0075433_10506793 3300006852 Bacteria 1062
176 Ga0075434_100002469 3300006871 Bacteria 16277
177 Ga0075434_100014133 3300006871 Bacteria 7624
178 Ga0075434_100014200 3300006871 Bacteria 7609
179 Ga0075434_100015946 3300006871 Bacteria 7219
180 Ga0075434_100056543 3300006871 Bacteria 3899
181 Ga0075434_100091469 3300006871 Bacteria 3044
182 Ga0075434_100094923 3300006871 Bacteria 2988
183 Ga0075429_100003272 3300006880 Bacteria 13808
184 Ga0075429_100015303 3300006880 Bacteria 6647
185 Ga0075429_100021297 3300006880 Bacteria 5620
186 Ga0075429_100040377 3300006880 Bacteria 4062
187 Ga0075429_100042760 3300006880 Bacteria 3942
188 Ga0075429_100067288 3300006880 Bacteria 3117
189 Ga0075429_100104473 3300006880 Bacteria 2474
190 Ga0075429_100110318 3300006880 Bacteria 2405
191 Ga0075429_100166612 3300006880 Bacteria 1930
192 Ga0075429_100177927 3300006880 Bacteria 1864
193 Ga0075429_100226177 3300006880 Bacteria 1639
194 Ga0075429_100248547 3300006880 Unclassified 1557
195 Ga0068865_100041293 3300006881 Bacteria 3138
196 Ga0075436_100001280 3300006914 Bacteria 17074
197 Ga0075436_100013698 3300006914 Bacteria 5555
198 Ga0075436_100095488 3300006914 Bacteria 2068
199 Ga0075436_100199489 3300006914 Bacteria 1417
200 Ga0075436_100250299 3300006914 Bacteria 1262
201 Ga0097620_100339355 3300006931 Bacteria 1597
202 Ga0097620_100398298 3300006931 Bacteria 1472
203 Ga0075435_100006396 3300007076 Bacteria 8328
204 Ga0075435_100008563 3300007076 Bacteria 7352
205 Ga0075435_100022028 3300007076 Bacteria 4912
206 Ga0075435_100087204 3300007076 Bacteria 2571
207 Ga0075435_100108200 3300007076 Bacteria 2309
208 Ga0075435_100128119 3300007076 Bacteria 2122
209 Ga0075435_100199435 3300007076 Bacteria 1695
210 Ga0075435_100230495 3300007076 Bacteria 1573
211 Ga0075435_100303391 3300007076 Bacteria 1366
212 Ga0075435_100327588 3300007076 Bacteria 1311
213 Ga0075435_100345573 3300007076 Archaea 1275
214 Ga0099794_10008546 3300007265 Bacteria 4259
215 Ga0099794_10009430 3300007265 Bacteria 4103
216 Ga0111539_10001174 3300009094 Bacteria 34740
217 Ga0111539_10002256 3300009094 Bacteria 25698
218 Ga0111539_10016910 3300009094 Bacteria 9029
219 Ga0111539_10093562 3300009094 Bacteria 3531
220 Ga0111539_10103955 3300009094 Bacteria 3333
221 Ga0111539_10179150 3300009094 Bacteria 2476
222 Ga0111539_10304614 3300009094 Bacteria 1854
223 Ga0105245_10511946 3300009098 Unclassified 1218
224 Ga0105247_10176488 3300009101 Bacteria 1423
225 Ga0114129_10000211 3300009147 Bacteria 64797
226 Ga0114129_10004188 3300009147 Bacteria 20374
227 Ga0114129_10005678 3300009147 Bacteria 17662
228 Ga0114129_10010715 3300009147 Bacteria 13069
229 Ga0114129_10012300 3300009147 Bacteria 12176
230 Ga0114129_10018847 3300009147 Bacteria 9830
231 Ga0114129_10025130 3300009147 Bacteria 8442
232 Ga0114129_10026023 3300009147 Bacteria 8285
233 Ga0114129_10034662 3300009147 Bacteria 7130
234 Ga0114129_10042118 3300009147 Bacteria 6430
235 Ga0114129_10088864 3300009147 Bacteria 4283
236 Ga0114129_10112228 3300009147 Bacteria 3759
237 Ga0114129_10145155 3300009147 Bacteria 3251
238 Ga0114129_10297907 3300009147 Bacteria 2151
239 Ga0114129_10341682 3300009147 Bacteria 1985
240 Ga0105243_10113226 3300009148 Bacteria 2275
241 Ga0105243_10175821 3300009148 Bacteria 1858
242 Ga0105241_10029745 3300009174 Bacteria 4077
243 Ga0105248_10118225 3300009177 Bacteria 2990
244 Ga0105248_10231908 3300009177 Bacteria 2078
245 Ga0105249_10044517 3300009553 Bacteria 4036
246 Ga0105249_10156112 3300009553 Bacteria 2201
247 Ga0105249_10232726 3300009553 Bacteria 1818
248 Ga0105249_10398809 3300009553 Bacteria 1405
249 Ga0105249_10433286 3300009553 Bacteria 1351
250 Ga0105249_10597266 3300009553 Unclassified 1158
251 Ga0105249_10726550 3300009553 Bacteria 1054
252 Ga0157378_10053302 3300013297 Bacteria 3601
253 Ga0157378_10132452 3300013297 Bacteria 2309
254 Ga0157378_10635592 3300013297 Bacteria 1082
255 Ga0163162_10054760 3300013306 Bacteria 4014
256 Ga0163162_10112979 3300013306 Bacteria 2815
257 Ga0157375_10153263 3300013308 Bacteria 2442
258 Ga0157375_10249930 3300013308 Bacteria 1934
259 Ga0157380_10484090 3300014326 Bacteria 1197
260 Ga0163161_10051149 3300017792 Bacteria 2992
261 Ga0213875_10131072 3300021388 Bacteria 1172
262 Ga0207427_101962 3300025231 Bacteria 6294
263 Ga0209233_1004580 3300025261 Bacteria 4684
264 Ga0207653_10022954 3300025885 Bacteria 1985
265 Ga0207653_10087395 3300025885 Bacteria 1088
266 Ga0207653_10102449 3300025885 Bacteria 1014
267 Ga0207680_10243945 3300025903 Bacteria 1239
268 Ga0207699_10262280 3300025906 Bacteria 1195
269 Ga0207684_10001269 3300025910 Bacteria 27858
270 Ga0207684_10003224 3300025910 Bacteria 16018
271 Ga0207684_10004391 3300025910 Bacteria 13299
272 Ga0207684_10005733 3300025910 Bacteria 11404
273 Ga0207684_10009460 3300025910 Bacteria 8604
274 Ga0207684_10014653 3300025910 Bacteria 6754
275 Ga0207684_10026091 3300025910 Bacteria 4980
276 Ga0207684_10026295 3300025910 Bacteria 4962
277 Ga0207684_10030139 3300025910 Bacteria 4619
278 Ga0207684_10033378 3300025910 Bacteria 4376
279 Ga0207684_10055754 3300025910 Bacteria 3352
280 Ga0207684_10067669 3300025910 Bacteria 3035
281 Ga0207684_10178491 3300025910 Bacteria 1831
282 Ga0207684_10377153 3300025910 Unclassified 1220
283 Ga0207684_10412434 3300025910 Bacteria 1161
284 Ga0207654_10012657 3300025911 Bacteria 4326
285 Ga0207654_10267722 3300025911 Bacteria 1151
286 Ga0207707_10060103 3300025912 Bacteria 3306
287 Ga0207660_10057571 3300025917 Bacteria 2784
288 Ga0207660_10069110 3300025917 Bacteria 2564
289 Ga0207652_10016752 3300025921 Bacteria 5988
290 Ga0207646_10000982 3300025922 Bacteria 36644
291 Ga0207646_10003701 3300025922 Bacteria 17067
292 Ga0207646_10014134 3300025922 Bacteria 7591
293 Ga0207646_10023546 3300025922 Bacteria 5655
294 Ga0207646_10025749 3300025922 Bacteria 5379
295 Ga0207646_10035715 3300025922 Bacteria 4488
296 Ga0207646_10040962 3300025922 Bacteria 4165
297 Ga0207646_10049275 3300025922 Bacteria 3773
298 Ga0207646_10068596 3300025922 Bacteria 3167
299 Ga0207646_10111420 3300025922 Bacteria 2456
300 Ga0207646_10420657 3300025922 Unclassified 1206
301 Ga0207681_10097674 3300025923 Bacteria 2111
302 Ga0207681_10108429 3300025923 Bacteria 2016
303 Ga0207650_10236614 3300025925 Bacteria 1475
304 Ga0207687_10429781 3300025927 Bacteria 1091
305 Ga0207704_10022121 3300025938 Bacteria 3400
306 Ga0207704_10181017 3300025938 Bacteria 1523
307 Ga0207665_10011585 3300025939 Bacteria 5793
308 Ga0207691_10091502 3300025940 Bacteria 2726
309 Ga0207691_10099562 3300025940 Bacteria 2595
310 Ga0207689_10004754 3300025942 Bacteria 12249
311 Ga0207689_10042154 3300025942 Bacteria 3777
312 Ga0207679_10077518 3300025945 Bacteria 2529
313 Ga0207712_10060116 3300025961 Bacteria 2692
314 Ga0207712_10161638 3300025961 Bacteria 1741
315 Ga0207712_10339580 3300025961 Bacteria 1245
316 Ga0207712_10463418 3300025961 Bacteria 1077
317 Ga0207658_10007302 3300025986 Bacteria 7536
318 Ga0207703_10140219 3300026035 Bacteria 2097
319 Ga0207708_10020721 3300026075 Bacteria 4958
320 Ga0207708_10066563 3300026075 Bacteria 2755
321 Ga0207641_10104739 3300026088 Bacteria 2498
322 Ga0207648_10028460 3300026089 Bacteria 4954
323 Ga0207648_10091004 3300026089 Bacteria 2667
324 Ga0207676_10268385 3300026095 Bacteria 1544
325 Ga0207674_10035782 3300026116 Bacteria 5181
326 Ga0207674_10057048 3300026116 Bacteria 3961
327 Ga0207674_10080199 3300026116 Bacteria 3267
328 Ga0209588_1005613 3300027671 Bacteria 3604
329 Ga0209588_1011940 3300027671 Bacteria 2631
330 Ga0207428_10000009 3300027907 Bacteria 410565
331 Ga0207428_10002430 3300027907 Bacteria 18598
332 Ga0207428_10007391 3300027907 Bacteria 10018
333 Ga0268265_10009537 3300028380 Bacteria 6555
334 Ga0268265_10213366 3300028380 Bacteria 1684
335 Ga0268265_10311511 3300028380 Bacteria 1421
336 Ga0268265_10355961 3300028380 Bacteria 1338
337 Ga0268265_10368122 3300028380 Bacteria 1318
338 Ga0268264_10083769 3300028381 Bacteria 2732
339 Ga0268264_10597429 3300028381 Bacteria 1087
340 Ga0307408_100025870 3300031548 Bacteria 4023
341 Ga0307405_10033235 3300031731 Bacteria 3057
342 Ga0307413_10356156 3300031824 Bacteria 1131
343 Ga0307409_100005535 3300031995 Bacteria 7291
344 Ga0307416_100071455 3300032002 Bacteria 2883
345 Ga0373932_0017424 3300035112 Bacteria 1844
346 Ga0373939_0014274 3300035114 Bacteria 2058
347 Ga0373962_0013357 3300035242 Bacteria 2079
348 Ga0373931_0001088 3300035691 Bacteria 11516
349 Ga0373931_0056580 3300035691 Bacteria 2102
350 Ga0373931_0076580 3300035691 Bacteria 1838
351 Ga0395899_0011164 3300037312 Bacteria 6883
352 Ga0395899_0048404 3300037312 Bacteria 3164
353 Ga0395900_0004115 3300037418 Bacteria 15497
354 Ga0395900_0030393 3300037418 Bacteria 5547
355 Ga0395900_0079612 3300037418 Bacteria 3367
356 Ga0395900_0080928 3300037418 Bacteria 3338
357 Ga0395900_0183067 3300037418 Bacteria 2128
358 Ga0395898_0006908 3300037466 Bacteria 12072
359 Ga0395898_0010322 3300037466 Bacteria 9771
360 Ga0395905_0237373 3300037471 Bacteria 1704
361 Ga0436364_0826827 3300037853 Bacteria 12894
362 Ga0395901_0001564 3300038443 Bacteria 23718
363 Ga0395901_0018164 3300038443 Bacteria 7178
364 Ga0395901_0215217 3300038443 Bacteria 2010
365 Ga0436365_1342915 3300039437 Bacteria 4847
366 Ga0439460_0013119 3300042461 Bacteria 2163
367 Ga0451577_0016059 3300042876 Bacteria 6945
368 Ga0451577_0020923 3300042876 Bacteria 5997
369 Ga0451577_0224374 3300042876 Bacteria 1699
370 Ga0451577_0598664 3300042876 Bacteria 1000
371 Ga0453683_0005447 3300044673 Bacteria 8881
372 Ga0453683_0067851 3300044673 Bacteria 2229
373 Ga0453683_0142049 3300044673 Bacteria 1515
374 Ga0453683_0281904 3300044673 Bacteria 1061
375 Ga0453684_0037731 3300044712 Bacteria 6626
376 Ga0451576_0016521 3300045051 Bacteria 8140
377 Ga0451576_0036750 3300045051 Bacteria 5190
378 Ga0451576_0063033 3300045051 Bacteria 3864
379 Ga0451576_0199003 3300045051 Bacteria 2092
380 Ga0466967_0157930 3300045976 Bacteria 2126
381 Ga0495629_0002462 3300046459 Bacteria 14200
382 Ga0495580_0004547 3300046472 Bacteria 11649
383 Ga0495580_0009153 3300046472 Bacteria 7808
384 Ga0495580_0039041 3300046472 Bacteria 3397
385 Ga0495580_0177192 3300046472 Bacteria 1473
386 Ga0495594_0031456 3300046499 Bacteria 2877
387 Ga0495642_0133180 3300046528 Bacteria 1071
388 Ga0495645_0018717 3300046543 Bacteria 4979
389 Ga0495635_0023171 3300046663 Bacteria 4327
390 Ga0495669_0043525 3300046684 Bacteria 1999
391 Ga0495669_0053675 3300046684 Bacteria 1813
392 Ga0496102_0004695 3300048905 Bacteria 11559
393 Ga0501033_0066374 3300049570 Bacteria 2653
394 Ga0501034_0011924 3300049571 Bacteria 8987
395 Ga0501039_0187048 3300049575 Bacteria 1629
396 Ga0501040_0001737 3300049576 Bacteria 13987
397 Ga0501042_0436096 3300049578 Unclassified 950
398 Ga0501046_0253487 3300049580 Unclassified 1295
399 Ga0501070_0115855 3300049586 Bacteria 2213
400 Ga0501075_0053822 3300049591 Bacteria 3027
401 Ga0501081_0114734 3300049743 Bacteria 1914
402 nmdc:mga05p37_132134_c1 3300050507 Bacteria 3063
403 nmdc:mga05p37_14135_c1 3300050507 Bacteria 9580
404 nmdc:mga05p37_14182_c1 3300050507 Bacteria 9568
405 nmdc:mga05p37_191568_c1 3300050507 Bacteria 2482
406 nmdc:mga05p37_198372_c1 3300050507 Bacteria 2432
407 nmdc:mga05p37_24503_c1 3300050507 Bacteria 7335
408 nmdc:mga05p37_26439_c1 3300050507 Bacteria 7060
409 nmdc:mga05p37_277127_c1 3300050507 Bacteria 2002
410 nmdc:mga05p37_29725_c1 3300050507 Bacteria 6667
411 nmdc:mga05p37_29925_c1 3300050507 Bacteria 6646
412 nmdc:mga05p37_30339_c1 3300050507 Bacteria 6597
413 nmdc:mga05p37_35680_c1 3300050507 Bacteria 6099
414 nmdc:mga05p37_38748_c1 3300050507 Bacteria 5848
415 nmdc:mga05p37_41561_c1 3300050507 Bacteria 5645
416 nmdc:mga05p37_47312_c1 3300050507 Bacteria 5291
417 nmdc:mga05p37_5196_c1 3300050507 Bacteria 15276
418 nmdc:mga05p37_64992_c1 3300050507 Bacteria 4490
419 nmdc:mga05p37_713588_c1 3300050507 Bacteria 1112
420 nmdc:mga05p37_725527_c1 3300050507 Bacteria 1100
421 nmdc:mga05p37_834839_c1 3300050507 Bacteria 1003
422 nmdc:mga05p37_885734_c1 3300050507 Unclassified 964
423 nmdc:mga05p37_91028_c1 3300050507 Bacteria 3759
424 nmdc:mga05p37_91491_c1 3300050507 Bacteria 3749
425 nmdc:mga05p37_91949_c1 3300050507 Bacteria 3738
426 nmdc:mga05p37_9364_c1 3300050507 Bacteria 11592
427 nmdc:mga09592_11137_c1 3300050508 Bacteria 7316
428 nmdc:mga09592_12462_c1 3300050508 Bacteria 6927
429 nmdc:mga09592_139365_c1 3300050508 Bacteria 2090
430 nmdc:mga09592_16034_c1 3300050508 Bacteria 6125
431 nmdc:mga09592_16135_c1 3300050508 Bacteria 6105
432 nmdc:mga09592_180919_c1 3300050508 Unclassified 1824
433 nmdc:mga09592_204355_c1 3300050508 Bacteria 1711
434 nmdc:mga09592_329865_c1 3300050508 Bacteria 1321
435 nmdc:mga09592_402570_c1 3300050508 Bacteria 1183
436 nmdc:mga09592_5707_c1 3300050508 Bacteria 10151
437 nmdc:mga09592_65601_c1 3300050508 Bacteria 3076
438 nmdc:mga0qj67_104469_c1 3300050509 Unclassified 2285
439 nmdc:mga0qj67_14010_c1 3300050509 Bacteria 6058
440 nmdc:mga0qj67_215219_c1 3300050509 Bacteria 1560
441 nmdc:mga0qj67_265085_c1 3300050509 Bacteria 1393
442 nmdc:mga0qj67_277999_c1 3300050509 Bacteria 1357
443 nmdc:mga0qj67_7878_c1 3300050509 Bacteria 7873
444 nmdc:mga06r32_107266_c1 3300050510 Bacteria 2744
445 nmdc:mga06r32_10964_c1 3300050510 Bacteria 8161
446 nmdc:mga06r32_155212_c1 3300050510 Bacteria 2270
447 nmdc:mga06r32_166026_c1 3300050510 Bacteria 2191
448 nmdc:mga06r32_176642_c1 3300050510 Unclassified 2120
449 nmdc:mga06r32_19719_c1 3300050510 Bacteria 6196
450 nmdc:mga06r32_30001_c1 3300050510 Bacteria 5101
451 nmdc:mga06r32_391616_c1 3300050510 Bacteria 1372
452 nmdc:mga06r32_4676_c1 3300050510 Bacteria 12289
453 nmdc:mga06r32_8147_c1 3300050510 Bacteria 9431
454 nmdc:mga06r32_87_c1 3300050510 Bacteria 63774
455 nmdc:mga06r32_886_c1 3300050510 Bacteria 26660
456 nmdc:mga08y16_139889_c1 3300050511 Bacteria 2516
457 nmdc:mga08y16_192867_c1 3300050511 Bacteria 2113
458 nmdc:mga08y16_40635_c1 3300050511 Bacteria 4874
459 nmdc:mga08y16_468_c1 3300050511 Bacteria 37480
460 nmdc:mga08y16_75793_c1 3300050511 Bacteria 3506
461 nmdc:mga08y16_9863_c1 3300050511 Bacteria 10028
462 nmdc:mga0n895_102426_c1 3300050512 Bacteria 2874
463 nmdc:mga0n895_13251_c1 3300050512 Bacteria 7431
464 nmdc:mga0n895_14211_c1 3300050512 Bacteria 7221
465 nmdc:mga0n895_142290_c1 3300050512 Bacteria 2428
466 nmdc:mga0n895_15041_c1 3300050512 Bacteria 7051
467 nmdc:mga0n895_176429_c1 3300050512 Bacteria 2168
468 nmdc:mga0n895_190720_c1 3300050512 Bacteria 2081
469 nmdc:mga0n895_191984_c1 3300050512 Bacteria 2073
470 nmdc:mga0n895_21883_c1 3300050512 Bacteria 5988
471 nmdc:mga0n895_31512_c1 3300050512 Bacteria 5078
472 nmdc:mga0n895_333574_c1 3300050512 Bacteria 1537
473 nmdc:mga0n895_41804_c1 3300050512 Bacteria 4458
474 nmdc:mga0n895_57259_c1 3300050512 Bacteria 3842
475 nmdc:mga0n895_667_c1 3300050512 Bacteria 24029
476 nmdc:mga0n895_802607_c1 3300050512 Bacteria 931
477 nmdc:mga0rr50_131826_c1 3300050513 Bacteria 2002
478 nmdc:mga0rr50_136731_c2 3300050513 Bacteria 1410
479 nmdc:mga0rr50_190115_c1 3300050513 Bacteria 1682
480 nmdc:mga0rr50_205673_c1 3300050513 Bacteria 1620
481 nmdc:mga0rr50_262206_c1 3300050513 Bacteria 1438
482 nmdc:mga0rr50_264532_c1 3300050513 Bacteria 1432
483 nmdc:mga0rr50_31750_c1 3300050513 Bacteria 3756
484 nmdc:mga0rr50_380113_c1 3300050513 Bacteria 1191
485 nmdc:mga0rr50_45552_c1 3300050513 Bacteria 3225
486 nmdc:mga0rr50_511980_c1 3300050513 Unclassified 1021
487 nmdc:mga0rr50_768_c1 3300050513 Bacteria 17272
488 nmdc:mga0rr50_79644_c1 3300050513 Bacteria 2524
489 nmdc:mga08x19_129665_c1 3300050514 Bacteria 1695
490 nmdc:mga08x19_1535_c1 3300050514 Bacteria 14323
491 nmdc:mga08x19_212475_c1 3300050514 Bacteria 1328
492 nmdc:mga08x19_367_c1 3300050514 Bacteria 31883
493 nmdc:mga08x19_390572_c1 3300050514 Bacteria 975
494 nmdc:mga0a205_11113_c1 3300050515 Bacteria 8285
495 nmdc:mga0a205_1148_c2 3300050515 Bacteria 20760
496 nmdc:mga0a205_11859_c1 3300050515 Bacteria 8044
497 nmdc:mga0a205_1474_c1 3300050515 Bacteria 20069
498 nmdc:mga0a205_15064_c1 3300050515 Bacteria 7220
499 nmdc:mga0a205_1557_c1 3300050515 Bacteria 19626
500 nmdc:mga0a205_276435_c1 3300050515 Bacteria 1555
501 nmdc:mga0a205_29133_c1 3300050515 Bacteria 5284
502 nmdc:mga0a205_2937_c1 3300050515 Bacteria 15102
503 nmdc:mga0a205_2991_c1 3300050515 Bacteria 14987
504 nmdc:mga0a205_304939_c1 3300050515 Bacteria 1465
505 nmdc:mga0a205_337771_c1 3300050515 Bacteria 1375
506 nmdc:mga0a205_33965_c1 3300050515 Bacteria 4893
507 nmdc:mga0a205_367997_c1 3300050515 Bacteria 1304
508 nmdc:mga0a205_54750_c1 3300050515 Bacteria 3852
509 nmdc:mga0a205_5801_c1 3300050515 Bacteria 11133
510 nmdc:mga0a205_87484_c1 3300050515 Bacteria 3010
511 Ga0495619_0029530 3300053085 Bacteria 3543
512 Ga0530510_0165121 3300061734 Bacteria 1639
513 2906799977 2906799679 Bacteria 4031749
514 8055038843 8055037949 Bacteria 3337834
515 nmdc:mga0rr50_347370_c1
516 JGI25406J46586_10004042
517 JGI25406J46586_10005962
518 Ga0070690_100012309
519 Ga0070670_100004977
520 Ga0070677_10089822
521 Ga0068869_100001075
522 Ga0068869_100299019
523 Ga0070680_100026431
524 Ga0070680_100072581
525 Ga0070689_100158627
526 Ga0070687_100060673
527 Ga0070687_100103277
528 Ga0070692_10004648
529 Ga0070668_100223108
530 Ga0070669_100009417
531 Ga0070667_100013739
532 Ga0070709_10051782
533 Ga0070714_100273839
534 Ga0070701_10001110
535 Ga0070705_100002703
536 Ga0070705_100011731
537 Ga0070705_100012954
538 Ga0070705_100065950
539 Ga0070705_100107517
540 Ga0070705_100150522
541 Ga0070705_100162458
542 Ga0070700_100144566
543 Ga0070694_100009398
544 Ga0070694_100015760
545 Ga0070694_100038546
546 Ga0070708_100005287
547 Ga0070708_100008492
548 Ga0070708_100009294
549 Ga0070708_100010505
550 Ga0070708_100017473
551 Ga0070708_100025115
552 Ga0070708_100028954
553 Ga0070708_100029108
554 Ga0070708_100036362
555 Ga0070708_100081939
556 Ga0070708_100117593
557 Ga0070708_100315348
558 Ga0070708_100323634
559 Ga0070708_100416265
560 Ga0070681_10294606
561 Ga0068867_100035091
562 Ga0068867_100349034
563 Ga0070706_100029391
564 Ga0070706_100034533
565 Ga0070706_100042379
566 Ga0070706_100072133
567 Ga0070706_100091769
568 Ga0070706_100125486
569 Ga0070706_100130228
570 Ga0070706_100152068
571 Ga0070706_100160141
572 Ga0070706_100201610
573 Ga0070706_100223489
574 Ga0070706_100281313
575 Ga0070707_100013227
576 Ga0070707_100017904
577 Ga0070707_100041534
578 Ga0070707_100047673
579 Ga0070707_100089644
580 Ga0070707_100135558
581 Ga0070707_100154753
582 Ga0070707_100202520
583 Ga0070707_100268741
584 Ga0070698_100009575
585 Ga0070698_100014052
586 Ga0070698_100014522
587 Ga0070698_100055236
588 Ga0070698_100058087
589 Ga0070698_100103031
590 Ga0070698_100117308
591 Ga0070698_100270798
592 Ga0070699_100010567
593 Ga0070699_100016408
594 Ga0070699_100030174
595 Ga0070699_100030323
596 Ga0070699_100036865
597 Ga0070699_100043509
598 Ga0070699_100047625
599 Ga0070699_100208442
600 Ga0070699_100461129
601 Ga0070679_100002223
602 Ga0070697_100001306
603 Ga0070697_100009238
604 Ga0070697_100010498
605 Ga0070697_100013824
606 Ga0070697_100025490
607 Ga0070697_100051641
608 Ga0070697_100072286
609 Ga0070672_100039417
610 Ga0070672_100092385
611 Ga0070686_100182329
612 Ga0070686_100411899
613 Ga0070695_100010527
614 Ga0070695_100019539
615 Ga0070695_100047251
616 Ga0070695_100179707
617 Ga0070696_100137733
618 Ga0070696_100146719
619 Ga0070696_100362233
620 Ga0070704_100149071
621 Ga0070704_100616467
622 Ga0070664_100269135
623 Ga0068857_100083624
624 Ga0068857_100178034
625 Ga0068856_100165212
626 Ga0068852_100360043
627 Ga0068859_100339373
628 Ga0068859_100398302
629 Ga0068864_100261698
630 Ga0068866_10184511
631 Ga0068861_100327854
632 Ga0068863_100005957
633 Ga0068863_100688295
634 Ga0068858_100001786
635 Ga0068860_100047717
636 Ga0068860_100084795
637 Ga0068860_100464720
638 Ga0068860_100581038
639 Ga0068862_100017044
640 Ga0068862_100096284
641 Ga0068862_100173232
642 Ga0068862_100392720
643 Ga0081455_10001418
644 Ga0081455_10002193
645 Ga0081538_10002408
646 Ga0081538_10013445
647 Ga0081538_10014639
648 Ga0081538_10099234
649 Ga0081540_1004046
650 Ga0081539_10000021
651 Ga0081539_10000044
652 Ga0081539_10005018
653 Ga0075428_100000267
654 Ga0075428_100003308
655 Ga0075428_100017629
656 Ga0075428_100041829
657 Ga0075428_100050939
658 Ga0075428_100061315
659 Ga0075428_100065523
660 Ga0075428_100181484
661 Ga0075428_100287719
662 Ga0075428_100303671
663 Ga0075428_100346190
664 Ga0075430_100002575
665 Ga0075430_100043747
666 Ga0075431_100000270
667 Ga0075431_100003078
668 Ga0075431_100004687
669 Ga0075431_100005368
670 Ga0075431_100009485
671 Ga0075431_100010697
672 Ga0075431_100046847
673 Ga0075431_100050025
674 Ga0075431_100087361
675 Ga0075431_100117315
676 Ga0075431_100179519
677 Ga0075431_100380357
678 Ga0075433_10000853
679 Ga0075433_10023536
680 Ga0075433_10028412
681 Ga0075433_10029270
682 Ga0075433_10031178
683 Ga0075433_10032861
684 Ga0075433_10062599
685 Ga0075433_10065289
686 Ga0075433_10187234
687 Ga0075433_10189519
688 Ga0075433_10204253
689 Ga0075433_10506793
690 Ga0075434_100002469
691 Ga0075434_100014133
692 Ga0075434_100014200
693 Ga0075434_100015946
694 Ga0075434_100056543
695 Ga0075434_100091469
696 Ga0075434_100094923
697 Ga0075429_100003272
698 Ga0075429_100015303
699 Ga0075429_100021297
700 Ga0075429_100040377
701 Ga0075429_100042760
702 Ga0075429_100067288
703 Ga0075429_100104473
704 Ga0075429_100110318
705 Ga0075429_100166612
706 Ga0075429_100177927
707 Ga0075429_100226177
708 Ga0075429_100248547
709 Ga0068865_100041293
710 Ga0075436_100001280
711 Ga0075436_100013698
712 Ga0075436_100095488
713 Ga0075436_100199489
714 Ga0075436_100250299
715 Ga0097620_100339355
716 Ga0097620_100398298
717 Ga0075435_100006396
718 Ga0075435_100008563
719 Ga0075435_100022028
720 Ga0075435_100087204
721 Ga0075435_100108200
722 Ga0075435_100128119
723 Ga0075435_100199435
724 Ga0075435_100230495
725 Ga0075435_100303391
726 Ga0075435_100327588
727 Ga0075435_100345573
728 Ga0099794_10008546
729 Ga0099794_10009430
730 Ga0111539_10001174
731 Ga0111539_10002256
732 Ga0111539_10016910
733 Ga0111539_10093562
734 Ga0111539_10103955
735 Ga0111539_10179150
736 Ga0111539_10304614
737 Ga0105245_10511946
738 Ga0105247_10176488
739 Ga0114129_10000211
740 Ga0114129_10004188
741 Ga0114129_10005678
742 Ga0114129_10010715
743 Ga0114129_10012300
744 Ga0114129_10018847
745 Ga0114129_10025130
746 Ga0114129_10026023
747 Ga0114129_10034662
748 Ga0114129_10042118
749 Ga0114129_10088864
750 Ga0114129_10112228
751 Ga0114129_10145155
752 Ga0114129_10297907
753 Ga0114129_10341682
754 Ga0105243_10113226
755 Ga0105243_10175821
756 Ga0105241_10029745
757 Ga0105248_10118225
758 Ga0105248_10231908
759 Ga0105249_10044517
760 Ga0105249_10156112
761 Ga0105249_10232726
762 Ga0105249_10398809
763 Ga0105249_10433286
764 Ga0105249_10597266
765 Ga0105249_10726550
766 Ga0157378_10053302
767 Ga0157378_10132452
768 Ga0157378_10635592
769 Ga0163162_10054760
770 Ga0163162_10112979
771 Ga0157375_10153263
772 Ga0157375_10249930
773 Ga0157380_10484090
774 Ga0163161_10051149
775 Ga0213875_10131072
776 Ga0207427_101962
777 Ga0209233_1004580
778 Ga0207653_10022954
779 Ga0207653_10087395
780 Ga0207653_10102449
781 Ga0207680_10243945
782 Ga0207699_10262280
783 Ga0207684_10001269
784 Ga0207684_10003224
785 Ga0207684_10004391
786 Ga0207684_10005733
787 Ga0207684_10009460
788 Ga0207684_10014653
789 Ga0207684_10026091
790 Ga0207684_10026295
791 Ga0207684_10030139
792 Ga0207684_10033378
793 Ga0207684_10055754
794 Ga0207684_10067669
795 Ga0207684_10178491
796 Ga0207684_10377153
797 Ga0207684_10412434
798 Ga0207654_10012657
799 Ga0207654_10267722
800 Ga0207707_10060103
801 Ga0207660_10057571
802 Ga0207660_10069110
803 Ga0207652_10016752
804 Ga0207646_10000982
805 Ga0207646_10003701
806 Ga0207646_10014134
807 Ga0207646_10023546
808 Ga0207646_10025749
809 Ga0207646_10035715
810 Ga0207646_10040962
811 Ga0207646_10049275
812 Ga0207646_10068596
813 Ga0207646_10111420
814 Ga0207646_10420657
815 Ga0207681_10097674
816 Ga0207681_10108429
817 Ga0207650_10236614
818 Ga0207687_10429781
819 Ga0207704_10022121
820 Ga0207704_10181017
821 Ga0207665_10011585
822 Ga0207691_10091502
823 Ga0207691_10099562
824 Ga0207689_10004754
825 Ga0207689_10042154
826 Ga0207679_10077518
827 Ga0207712_10060116
828 Ga0207712_10161638
829 Ga0207712_10339580
830 Ga0207712_10463418
831 Ga0207658_10007302
832 Ga0207703_10140219
833 Ga0207708_10020721
834 Ga0207708_10066563
835 Ga0207641_10104739
836 Ga0207648_10028460
837 Ga0207648_10091004
838 Ga0207676_10268385
839 Ga0207674_10035782
840 Ga0207674_10057048
841 Ga0207674_10080199
842 Ga0209588_1005613
843 Ga0209588_1011940
844 Ga0207428_10000009
845 Ga0207428_10002430
846 Ga0207428_10007391
847 Ga0268265_10009537
848 Ga0268265_10213366
849 Ga0268265_10311511
850 Ga0268265_10355961
851 Ga0268265_10368122
852 Ga0268264_10083769
853 Ga0268264_10597429
854 Ga0307408_100025870
855 Ga0307405_10033235
856 Ga0307413_10356156
857 Ga0307409_100005535
858 Ga0307416_100071455
859 Ga0373932_0017424
860 Ga0373939_0014274
861 Ga0373962_0013357
862 Ga0373931_0001088
863 Ga0373931_0056580
864 Ga0373931_0076580
865 Ga0395899_0011164
866 Ga0395899_0048404
867 Ga0395900_0004115
868 Ga0395900_0030393
869 Ga0395900_0079612
870 Ga0395900_0080928
871 Ga0395900_0183067
872 Ga0395898_0006908
873 Ga0395898_0010322
874 Ga0395905_0237373
875 Ga0436364_0826827
876 Ga0395901_0001564
877 Ga0395901_0018164
878 Ga0395901_0215217
879 Ga0436365_1342915
880 Ga0439460_0013119
881 Ga0451577_0016059
882 Ga0451577_0020923
883 Ga0451577_0224374
884 Ga0451577_0598664
885 Ga0453683_0005447
886 Ga0453683_0067851
887 Ga0453683_0142049
888 Ga0453683_0281904
889 Ga0453684_0037731
890 Ga0451576_0016521
891 Ga0451576_0036750
892 Ga0451576_0063033
893 Ga0451576_0199003
894 Ga0466967_0157930
895 Ga0495629_0002462
896 Ga0495580_0004547
897 Ga0495580_0009153
898 Ga0495580_0039041
899 Ga0495580_0177192
900 Ga0495594_0031456
901 Ga0495642_0133180
902 Ga0495645_0018717
903 Ga0495635_0023171
904 Ga0495669_0043525
905 Ga0495669_0053675
906 Ga0496102_0004695
907 Ga0501033_0066374
908 Ga0501034_0011924
909 Ga0501039_0187048
910 Ga0501040_0001737
911 Ga0501042_0436096
912 Ga0501046_0253487
913 Ga0501070_0115855
914 Ga0501075_0053822
915 Ga0501081_0114734
916 nmdc:mga05p37_132134_c1
917 nmdc:mga05p37_14135_c1
918 nmdc:mga05p37_14182_c1
919 nmdc:mga05p37_191568_c1
920 nmdc:mga05p37_198372_c1
921 nmdc:mga05p37_24503_c1
922 nmdc:mga05p37_26439_c1
923 nmdc:mga05p37_277127_c1
924 nmdc:mga05p37_29725_c1
925 nmdc:mga05p37_29925_c1
926 nmdc:mga05p37_30339_c1
927 nmdc:mga05p37_35680_c1
928 nmdc:mga05p37_38748_c1
929 nmdc:mga05p37_41561_c1
930 nmdc:mga05p37_47312_c1
931 nmdc:mga05p37_5196_c1
932 nmdc:mga05p37_64992_c1
933 nmdc:mga05p37_713588_c1
934 nmdc:mga05p37_725527_c1
935 nmdc:mga05p37_834839_c1
936 nmdc:mga05p37_885734_c1
937 nmdc:mga05p37_91028_c1
938 nmdc:mga05p37_91491_c1
939 nmdc:mga05p37_91949_c1
940 nmdc:mga05p37_9364_c1
941 nmdc:mga09592_11137_c1
942 nmdc:mga09592_12462_c1
943 nmdc:mga09592_139365_c1
944 nmdc:mga09592_16034_c1
945 nmdc:mga09592_16135_c1
946 nmdc:mga09592_180919_c1
947 nmdc:mga09592_204355_c1
948 nmdc:mga09592_329865_c1
949 nmdc:mga09592_402570_c1
950 nmdc:mga09592_5707_c1
951 nmdc:mga09592_65601_c1
952 nmdc:mga0qj67_104469_c1
953 nmdc:mga0qj67_14010_c1
954 nmdc:mga0qj67_215219_c1
955 nmdc:mga0qj67_265085_c1
956 nmdc:mga0qj67_277999_c1
957 nmdc:mga0qj67_7878_c1
958 nmdc:mga06r32_107266_c1
959 nmdc:mga06r32_10964_c1
960 nmdc:mga06r32_155212_c1
961 nmdc:mga06r32_166026_c1
962 nmdc:mga06r32_176642_c1
963 nmdc:mga06r32_19719_c1
964 nmdc:mga06r32_30001_c1
965 nmdc:mga06r32_391616_c1
966 nmdc:mga06r32_4676_c1
967 nmdc:mga06r32_8147_c1
968 nmdc:mga06r32_87_c1
969 nmdc:mga06r32_886_c1
970 nmdc:mga08y16_139889_c1
971 nmdc:mga08y16_192867_c1
972 nmdc:mga08y16_40635_c1
973 nmdc:mga08y16_468_c1
974 nmdc:mga08y16_75793_c1
975 nmdc:mga08y16_9863_c1
976 nmdc:mga0n895_102426_c1
977 nmdc:mga0n895_13251_c1
978 nmdc:mga0n895_14211_c1
979 nmdc:mga0n895_142290_c1
980 nmdc:mga0n895_15041_c1
981 nmdc:mga0n895_176429_c1
982 nmdc:mga0n895_190720_c1
983 nmdc:mga0n895_191984_c1
984 nmdc:mga0n895_21883_c1
985 nmdc:mga0n895_31512_c1
986 nmdc:mga0n895_333574_c1
987 nmdc:mga0n895_41804_c1
988 nmdc:mga0n895_57259_c1
989 nmdc:mga0n895_667_c1
990 nmdc:mga0n895_802607_c1
991 nmdc:mga0rr50_131826_c1
992 nmdc:mga0rr50_136731_c2
993 nmdc:mga0rr50_190115_c1
994 nmdc:mga0rr50_205673_c1
995 nmdc:mga0rr50_262206_c1
996 nmdc:mga0rr50_264532_c1
997 nmdc:mga0rr50_31750_c1
998 nmdc:mga0rr50_380113_c1
999 nmdc:mga0rr50_45552_c1
1000 nmdc:mga0rr50_511980_c1
1001 nmdc:mga0rr50_768_c1
1002 nmdc:mga0rr50_79644_c1
1003 nmdc:mga08x19_129665_c1
1004 nmdc:mga08x19_1535_c1
1005 nmdc:mga08x19_212475_c1
1006 nmdc:mga08x19_367_c1
1007 nmdc:mga08x19_390572_c1
1008 nmdc:mga0a205_11113_c1
1009 nmdc:mga0a205_1148_c2
1010 nmdc:mga0a205_11859_c1
1011 nmdc:mga0a205_1474_c1
1012 nmdc:mga0a205_15064_c1
1013 nmdc:mga0a205_1557_c1
1014 nmdc:mga0a205_276435_c1
1015 nmdc:mga0a205_29133_c1
1016 nmdc:mga0a205_2937_c1
1017 nmdc:mga0a205_2991_c1
1018 nmdc:mga0a205_304939_c1
1019 nmdc:mga0a205_337771_c1
1020 nmdc:mga0a205_33965_c1
1021 nmdc:mga0a205_367997_c1
1022 nmdc:mga0a205_54750_c1
1023 nmdc:mga0a205_5801_c1
1024 nmdc:mga0a205_87484_c1
1025 Ga0495619_0029530
1026 Ga0530510_0165121
1027 2906799977
1028 8055038843

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

129

314

0.98

PF12911

OppC_N

N-terminal TM domain of oligopeptide transport permease C

36

88

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7605 70 255
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7576 69 255
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.7387 68 252
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.7276 66 252
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.7136 68 252
ID Description Score Start End Superfamily
af_P0AGH5_85_292_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9085 64 255 1.10.3720.10
af_Q2FVE9_63_269_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8953 64 251 1.10.3720.10
af_P0AEG1_88_295_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.878 64 256 1.10.3720.10
af_Q2G1F6_179_383_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8761 68 256 1.10.3720.10
af_P75799_92_298_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.855 65 256 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V6GLS0-F1-model_v4 ABC transporter permease 0.912 2 260 GO:0005886
GO:0055085
AF-A0A2V6VJU5-F1-model_v4 Peptide ABC transporter permease 0.9095 2 262 GO:0005886
GO:0055085
AF-A0A354FHP1-F1-model_v4 Peptide ABC transporter permease 0.9089 105 260 GO:0005886
GO:0055085
AF-A0A383EZG3-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9075 47 260 GO:0005886
GO:0055085
AF-A0A399XRL1-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9071 3 257 GO:0005886
GO:0055085

Map