F457696

General Info

Members Datasets Scaffolds Average Seq Length
514 268 1028 114

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10037987|Ga0081538_100379873
Length 113
Sequence MTATRTASQQITDEVTSWPGVEAGIGARGEYGFTVGRRQIGHLHGDHAAHFGFPRSVWEELMAQGRVVRHPIDKPGWAARRIESDADVRDVIALLRLNYDRVVARYGLSEDAA

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
177 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
188 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
189 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
235 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
236 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
237 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
238 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
243 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
244 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
245 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
246 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
247 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
248 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
249 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
250 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
251 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
267 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.81
Metatranscriptomes 0.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0
Rhizoplane 13.04
Rhizosphere 83.66
Stem 0
Stem Tuber 0
Unclassified 8.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10037987 3300005981 Bacteria 3113
2 JGI24737J22298_10214334 3300001990 Bacteria 568
3 JGI25407J50210_10069934 3300003373 Bacteria 877
4 JGI25407J50210_10087104 3300003373 Bacteria 774
5 Ga0070658_10630463 3300005327 Archaea 930
6 Ga0070676_10505970 3300005328 Bacteria 858
7 Ga0070683_100101460 3300005329 Bacteria 2710
8 Ga0070683_100155919 3300005329 Bacteria 2165
9 Ga0070670_100226972 3300005331 Bacteria 1625
10 Ga0070670_100374516 3300005331 Bacteria 1254
11 Ga0070670_100684984 3300005331 Bacteria 921
12 Ga0068868_100006947 3300005338 Bacteria 8044
13 Ga0070660_100005466 3300005339 Bacteria 8796
14 Ga0070660_100441496 3300005339 Bacteria 1079
15 Ga0070687_101251049 3300005343 Unclassified 549
16 Ga0070661_100086494 3300005344 Bacteria 2318
17 Ga0070661_100364492 3300005344 Bacteria 1136
18 Ga0070692_10451910 3300005345 Bacteria 822
19 Ga0070669_100144986 3300005353 Bacteria 1834
20 Ga0070674_100119825 3300005356 Bacteria 1947
21 Ga0070673_100154727 3300005364 Bacteria 1945
22 Ga0070688_100723645 3300005365 Bacteria 773
23 Ga0070659_100136321 3300005366 Bacteria 1996
24 Ga0070659_101128008 3300005366 Bacteria 692
25 Ga0070667_101693572 3300005367 Archaea 595
26 Ga0070709_10114470 3300005434 Bacteria 1818
27 Ga0070714_100050383 3300005435 Bacteria 3547
28 Ga0070714_100050385 3300005435 Bacteria 3547
29 Ga0070714_100351165 3300005435 Bacteria 1385
30 Ga0070714_101746649 3300005435 Bacteria 608
31 Ga0070713_100165472 3300005436 Bacteria 1977
32 Ga0070713_100716614 3300005436 Bacteria 956
33 Ga0070713_101038675 3300005436 Unclassified 791
34 Ga0070710_10137150 3300005437 Bacteria 1497
35 Ga0070701_10128177 3300005438 Bacteria 1439
36 Ga0070701_10143467 3300005438 Bacteria 1368
37 Ga0070701_10178492 3300005438 Bacteria 1241
38 Ga0070711_100620621 3300005439 Bacteria 904
39 Ga0070711_101010637 3300005439 Bacteria 714
40 Ga0070700_100161213 3300005441 Bacteria 1544
41 Ga0070700_100622188 3300005441 Bacteria 849
42 Ga0070700_100981650 3300005441 Bacteria 693
43 Ga0070694_101096247 3300005444 Bacteria 664
44 Ga0070663_100237051 3300005455 Bacteria 1439
45 Ga0070663_101102210 3300005455 Bacteria 694
46 Ga0070678_100094846 3300005456 Bacteria 2298
47 Ga0070678_100631649 3300005456 Bacteria 959
48 Ga0070662_100088184 3300005457 Bacteria 2325
49 Ga0070662_100220298 3300005457 Bacteria 1514
50 Ga0070681_10887296 3300005458 Unclassified 810
51 Ga0068867_100503139 3300005459 Bacteria 1042
52 Ga0070685_10298617 3300005466 Bacteria 1085
53 Ga0070699_101523042 3300005518 Bacteria 613
54 Ga0070679_100162935 3300005530 Bacteria 2204
55 Ga0070684_100722398 3300005535 Bacteria 929
56 Ga0070684_101089355 3300005535 Archaea 751
57 Ga0068853_100294510 3300005539 Bacteria 1499
58 Ga0068853_101578138 3300005539 Unclassified 636
59 Ga0070672_100195595 3300005543 Bacteria 1690
60 Ga0070672_101177621 3300005543 Bacteria 682
61 Ga0070686_100136473 3300005544 Bacteria 1703
62 Ga0070693_100320301 3300005547 Bacteria 1052
63 Ga0070665_100334218 3300005548 Bacteria 1520
64 Ga0070665_100588937 3300005548 Bacteria 1125
65 Ga0068855_100339993 3300005563 Bacteria 1655
66 Ga0068855_100857631 3300005563 Bacteria 962
67 Ga0070664_100082701 3300005564 Bacteria 2769
68 Ga0068857_101576555 3300005577 Bacteria 641
69 Ga0068854_100135211 3300005578 Bacteria 1887
70 Ga0068854_100637171 3300005578 Bacteria 914
71 Ga0068854_102122753 3300005578 Unclassified 519
72 Ga0068856_100003239 3300005614 Bacteria 16573
73 Ga0068856_100047911 3300005614 Bacteria 4210
74 Ga0068856_100189399 3300005614 Bacteria 2071
75 Ga0068856_101236715 3300005614 Bacteria 763
76 Ga0070702_101287587 3300005615 Bacteria 593
77 Ga0068852_100081538 3300005616 Bacteria 2872
78 Ga0068852_100874383 3300005616 Bacteria 915
79 Ga0068852_101840489 3300005616 Archaea 628
80 Ga0068864_102523830 3300005618 Bacteria 520
81 Ga0068866_11007631 3300005718 Bacteria 592
82 Ga0068861_100424073 3300005719 Bacteria 1186
83 Ga0068861_101928363 3300005719 Bacteria 588
84 Ga0068851_10298365 3300005834 Bacteria 926
85 Ga0068870_10067972 3300005840 Bacteria 1935
86 Ga0068870_10482687 3300005840 Bacteria 823
87 Ga0068870_10610609 3300005840 Unclassified 742
88 Ga0068870_10857187 3300005840 Bacteria 639
89 Ga0068858_100013790 3300005842 Bacteria 7629
90 Ga0068860_100633992 3300005843 Bacteria 1076
91 Ga0068860_101361956 3300005843 Bacteria 731
92 Ga0068862_100700786 3300005844 Bacteria 981
93 Ga0081455_10000746 3300005937 Bacteria 42273
94 Ga0081455_10531345 3300005937 Unclassified 782
95 Ga0081538_10048757 3300005981 Bacteria 2578
96 Ga0081540_1134714 3300005983 Bacteria 1002
97 Ga0070717_10005163 3300006028 Bacteria 9520
98 Ga0070717_10389571 3300006028 Unclassified 1250
99 Ga0075365_10275774 3300006038 Bacteria 1183
100 Ga0075363_100158380 3300006048 Bacteria 1281
101 Ga0075364_11082474 3300006051 Bacteria 544
102 Ga0075432_10251905 3300006058 Unclassified 717
103 Ga0070715_10005654 3300006163 Bacteria 4188
104 Ga0070715_10107930 3300006163 Archaea 1309
105 Ga0070716_100060784 3300006173 Bacteria 2184
106 Ga0070716_100104598 3300006173 Bacteria 1743
107 Ga0070716_101335429 3300006173 Bacteria 581
108 Ga0070712_100129523 3300006175 Bacteria 1910
109 Ga0070712_100241679 3300006175 Archaea 1439
110 Ga0070712_100252374 3300006175 Bacteria 1410
111 Ga0097621_100814277 3300006237 Bacteria 866
112 Ga0097621_101615530 3300006237 Bacteria 616
113 Ga0068871_100522808 3300006358 Bacteria 1072
114 Ga0075428_101168097 3300006844 Bacteria 812
115 Ga0075428_102116645 3300006844 Unclassified 582
116 Ga0075433_10039711 3300006852 Bacteria 4071
117 Ga0075433_10461779 3300006852 Bacteria 1119
118 Ga0075434_100021693 3300006871 Bacteria 6246
119 Ga0075434_100032531 3300006871 Bacteria 5143
120 Ga0075434_101600213 3300006871 Bacteria 660
121 Ga0075429_101400565 3300006880 Unclassified 609
122 Ga0068865_100228497 3300006881 Bacteria 1458
123 Ga0075436_100045795 3300006914 Bacteria 3017
124 Ga0075436_100071339 3300006914 Bacteria 2401
125 Ga0075436_100953365 3300006914 Unclassified 643
126 Ga0075435_100000686 3300007076 Bacteria 20987
127 Ga0075435_100753972 3300007076 Bacteria 847
128 Ga0075435_101979485 3300007076 Bacteria 512
129 Ga0111539_10429693 3300009094 Bacteria 1538
130 Ga0111539_10592360 3300009094 Bacteria 1291
131 Ga0105245_10026423 3300009098 Bacteria 5109
132 Ga0105245_10527541 3300009098 Bacteria 1200
133 Ga0105245_10648371 3300009098 Bacteria 1086
134 Ga0105245_11119731 3300009098 Bacteria 834
135 Ga0105247_10015302 3300009101 Bacteria 4597
136 Ga0105247_11002668 3300009101 Unclassified 652
137 Ga0114129_11133343 3300009147 Bacteria 978
138 Ga0105243_10168688 3300009148 Bacteria 1894
139 Ga0105243_10522931 3300009148 Bacteria 1129
140 Ga0105243_10782976 3300009148 Bacteria 938
141 Ga0105241_10182231 3300009174 Bacteria 1743
142 Ga0105241_11669263 3300009174 Bacteria 618
143 Ga0105242_10268508 3300009176 Bacteria 1544
144 Ga0105242_12832737 3300009176 Bacteria 535
145 Ga0105248_10089177 3300009177 Bacteria 3471
146 Ga0105237_10010182 3300009545 Bacteria 10021
147 Ga0105238_10014541 3300009551 Bacteria 7959
148 Ga0105249_11094152 3300009553 Bacteria 867
149 Ga0105249_11643424 3300009553 Bacteria 715
150 Ga0105239_10217197 3300010375 Bacteria 2144
151 Ga0105239_12717625 3300010375 Bacteria 578
152 Ga0105246_10156720 3300011119 Bacteria 1730
153 Ga0105246_10687616 3300011119 Bacteria 895
154 Ga0105246_11480641 3300011119 Bacteria 637
155 Ga0105246_12525378 3300011119 Unclassified 506
156 Ga0157373_10853633 3300013100 Archaea 674
157 Ga0157371_10091118 3300013102 Bacteria 2159
158 Ga0157370_10294133 3300013104 Bacteria 1500
159 Ga0157374_10006092 3300013296 Bacteria 10208
160 Ga0157374_12814562 3300013296 Bacteria 514
161 Ga0157378_10968786 3300013297 Bacteria 884
162 Ga0163162_10458724 3300013306 Bacteria 1406
163 Ga0157372_10617235 3300013307 Bacteria 1264
164 Ga0157372_10911074 3300013307 Bacteria 1020
165 Ga0157372_11669271 3300013307 Bacteria 733
166 Ga0157375_10019948 3300013308 Bacteria 6113
167 Ga0157375_10882039 3300013308 Bacteria 1039
168 Ga0157375_11851712 3300013308 Archaea 716
169 Ga0157380_12367839 3300014326 Bacteria 596
170 Ga0182008_10839075 3300014497 Unclassified 536
171 Ga0157376_10020427 3300014969 Bacteria 5123
172 Ga0206356_10480351 3300020070 Bacteria 1223
173 Ga0213874_10114738 3300021377 Unclassified 909
174 Ga0213875_10009468 3300021388 Bacteria 4935
175 Ga0207656_10204579 3300025321 Bacteria 955
176 Ga0207656_10230217 3300025321 Bacteria 903
177 Ga0207656_10375363 3300025321 Bacteria 712
178 Ga0207692_10129441 3300025898 Bacteria 1423
179 Ga0207692_10469621 3300025898 Unclassified 794
180 Ga0207692_10982068 3300025898 Unclassified 557
181 Ga0207642_10629468 3300025899 Bacteria 670
182 Ga0207710_10759589 3300025900 Unclassified 509
183 Ga0207688_10021682 3300025901 Bacteria 3513
184 Ga0207688_10248613 3300025901 Bacteria 1077
185 Ga0207699_10103488 3300025906 Bacteria 1811
186 Ga0207643_10031867 3300025908 Bacteria 2941
187 Ga0207643_10086457 3300025908 Bacteria 1822
188 Ga0207705_10454646 3300025909 Unclassified 993
189 Ga0207654_10454219 3300025911 Bacteria 899
190 Ga0207707_10646407 3300025912 Bacteria 892
191 Ga0207671_10402437 3300025914 Bacteria 1089
192 Ga0207693_10024823 3300025915 Bacteria 4754
193 Ga0207693_10922781 3300025915 Archaea 669
194 Ga0207663_10270988 3300025916 Bacteria 1257
195 Ga0207663_10674619 3300025916 Bacteria 817
196 Ga0207663_10921247 3300025916 Unclassified 699
197 Ga0207660_10412458 3300025917 Unclassified 1089
198 Ga0207662_10504811 3300025918 Unclassified 833
199 Ga0207657_10002421 3300025919 Bacteria 20160
200 Ga0207657_11211084 3300025919 Bacteria 573
201 Ga0207649_10667541 3300025920 Unclassified 804
202 Ga0207649_11300259 3300025920 Bacteria 575
203 Ga0207652_11197768 3300025921 Bacteria 661
204 Ga0207694_10036483 3300025924 Bacteria 3774
205 Ga0207694_11272100 3300025924 Bacteria 622
206 Ga0207650_10370291 3300025925 Bacteria 1182
207 Ga0207659_10515178 3300025926 Bacteria 1014
208 Ga0207687_10005422 3300025927 Bacteria 8435
209 Ga0207687_10072975 3300025927 Bacteria 2456
210 Ga0207687_10085417 3300025927 Bacteria 2289
211 Ga0207687_10351257 3300025927 Bacteria 1201
212 Ga0207700_10180233 3300025928 Bacteria 1768
213 Ga0207700_10218591 3300025928 Bacteria 1614
214 Ga0207664_10034554 3300025929 Bacteria 3894
215 Ga0207664_10492136 3300025929 Bacteria 1098
216 Ga0207664_11555699 3300025929 Unclassified 583
217 Ga0207706_10107455 3300025933 Bacteria 2456
218 Ga0207706_10156673 3300025933 Bacteria 2002
219 Ga0207686_10283735 3300025934 Bacteria 1223
220 Ga0207709_10126648 3300025935 Bacteria 1733
221 Ga0207709_10534544 3300025935 Bacteria 920
222 Ga0207670_10201892 3300025936 Bacteria 1511
223 Ga0207669_10058142 3300025937 Bacteria 2358
224 Ga0207704_10181094 3300025938 Bacteria 1523
225 Ga0207704_10628499 3300025938 Bacteria 882
226 Ga0207665_10018342 3300025939 Bacteria 4599
227 Ga0207665_10070580 3300025939 Bacteria 2384
228 Ga0207665_10101374 3300025939 Bacteria 2010
229 Ga0207691_10265230 3300025940 Bacteria 1480
230 Ga0207691_10964006 3300025940 Bacteria 712
231 Ga0207711_10359277 3300025941 Bacteria 1349
232 Ga0207711_11608545 3300025941 Bacteria 593
233 Ga0207689_10271309 3300025942 Bacteria 1405
234 Ga0207689_10451428 3300025942 Bacteria 1074
235 Ga0207689_11728261 3300025942 Bacteria 518
236 Ga0207661_10087524 3300025944 Bacteria 2587
237 Ga0207679_10020820 3300025945 Bacteria 4434
238 Ga0207679_10053821 3300025945 Bacteria 2960
239 Ga0207667_10014202 3300025949 Bacteria 9087
240 Ga0207651_10205172 3300025960 Bacteria 1583
241 Ga0207651_10212319 3300025960 Bacteria 1559
242 Ga0207712_10411160 3300025961 Bacteria 1139
243 Ga0207640_10015398 3300025981 Bacteria 4426
244 Ga0207640_10177465 3300025981 Bacteria 1594
245 Ga0207640_10814245 3300025981 Bacteria 810
246 Ga0207658_11081058 3300025986 Bacteria 733
247 Ga0207677_10005989 3300026023 Bacteria 6624
248 Ga0207677_10142094 3300026023 Bacteria 1839
249 Ga0207677_10399183 3300026023 Bacteria 1166
250 Ga0207703_10027981 3300026035 Bacteria 4439
251 Ga0207639_10267340 3300026041 Bacteria 1498
252 Ga0207678_10196372 3300026067 Bacteria 1725
253 Ga0207708_10347439 3300026075 Bacteria 1216
254 Ga0207708_10741936 3300026075 Bacteria 842
255 Ga0207702_10001802 3300026078 Bacteria 21101
256 Ga0207702_11077239 3300026078 Bacteria 797
257 Ga0207702_11831611 3300026078 Bacteria 599
258 Ga0207641_10248972 3300026088 Bacteria 1659
259 Ga0207641_11390677 3300026088 Unclassified 703
260 Ga0207648_10042164 3300026089 Bacteria 4007
261 Ga0207648_10600026 3300026089 Bacteria 1015
262 Ga0207674_11580099 3300026116 Bacteria 625
263 Ga0207675_100225147 3300026118 Bacteria 1808
264 Ga0207675_101138106 3300026118 Bacteria 800
265 Ga0207683_10117757 3300026121 Bacteria 2382
266 Ga0207683_10655709 3300026121 Bacteria 972
267 Ga0207698_10251114 3300026142 Bacteria 1619
268 Ga0207698_11293746 3300026142 Archaea 744
269 Ga0207428_10089127 3300027907 Bacteria 2398
270 Ga0268266_10103792 3300028379 Bacteria 2509
271 Ga0268264_10302572 3300028381 Bacteria 1506
272 Ga0268264_10981604 3300028381 Bacteria 851
273 Ga0307413_10246887 3300031824 Unclassified 1322
274 Ga0307413_11052684 3300031824 Bacteria 700
275 Ga0307410_11732069 3300031852 Bacteria 554
276 Ga0307407_10609337 3300031903 Bacteria 814
277 Ga0307409_100603678 3300031995 Bacteria 1085
278 Ga0307409_101762567 3300031995 Bacteria 648
279 Ga0307416_103565601 3300032002 Bacteria 521
280 Ga0307415_100031791 3300032126 Bacteria 3405
281 Ga0373926_0002388 3300035083 Bacteria 5950
282 Ga0373934_0028302 3300035086 Bacteria 2183
283 Ga0373923_0054226 3300035111 Bacteria 1687
284 Ga0373936_0227750 3300035113 Bacteria 828
285 Ga0373953_0279112 3300035117 Unclassified 728
286 Ga0373956_0090303 3300035119 Bacteria 1413
287 Ga0373943_0000824 3300035170 Bacteria 13643
288 Ga0373943_0880706 3300035170 Unclassified 534
289 Ga0373946_0013696 3300035171 Bacteria 3051
290 Ga0373924_0011806 3300035410 Bacteria 3251
291 Ga0373924_0123981 3300035410 Bacteria 1122
292 Ga0373935_0037787 3300035692 Bacteria 3022
293 Ga0373935_0082193 3300035692 Bacteria 2095
294 Ga0373927_0020198 3300035695 Bacteria 4367
295 Ga0373927_0568640 3300035695 Bacteria 749
296 Ga0373933_0120654 3300035724 Bacteria 1642
297 Ga0373947_0003569 3300035725 Bacteria 9182
298 Ga0373947_0043936 3300035725 Bacteria 2670
299 Ga0373947_0050307 3300035725 Bacteria 2506
300 Ga0373937_0055775 3300036401 Bacteria 3628
301 Ga0373925_0002730 3300037068 Bacteria 13964
302 Ga0395899_0329759 3300037312 Bacteria 1026
303 Ga0395899_0847933 3300037312 Bacteria 561
304 Ga0395900_0152956 3300037418 Bacteria 2357
305 Ga0395900_0379809 3300037418 Bacteria 1381
306 Ga0395900_0719098 3300037418 Bacteria 931
307 Ga0395898_0017901 3300037466 Bacteria 7229
308 Ga0395898_0057038 3300037466 Bacteria 3806
309 Ga0395898_0259037 3300037466 Bacteria 1659
310 Ga0395898_1614025 3300037466 Bacteria 573
311 Ga0395905_0102624 3300037471 Bacteria 2685
312 Ga0395905_1128892 3300037471 Bacteria 687
313 Ga0436364_1393669 3300037853 Bacteria 5987
314 Ga0395901_0163029 3300038443 Bacteria 2341
315 Ga0395901_0629892 3300038443 Bacteria 1078
316 Ga0395901_1339364 3300038443 Unclassified 676
317 Ga0436365_1924606 3300039437 Bacteria 1126
318 Ga0436363_1440169 3300039450 Unclassified 946
319 Ga0436363_1443983 3300039450 Unclassified 645
320 Ga0451853_0086124 3300041512 Bacteria 732
321 Ga0451853_1315295 3300041512 Bacteria 882
322 Ga0466961_0115903 3300044693 Bacteria 1684
323 Ga0466959_0729290 3300045049 Unclassified 664
324 Ga0466967_0218959 3300045976 Bacteria 1808
325 Ga0466967_0266924 3300045976 Bacteria 1639
326 Ga0466967_0309424 3300045976 Bacteria 1522
327 Ga0466967_0537950 3300045976 Bacteria 1149
328 Ga0466967_2598972 3300045976 Bacteria 501
329 Ga0495592_0023211 3300046454 Bacteria 4719
330 Ga0495592_0095276 3300046454 Bacteria 2129
331 Ga0495592_0550942 3300046454 Archaea 709
332 Ga0495603_0028762 3300046455 Bacteria 3353
333 Ga0495603_0128818 3300046455 Bacteria 1474
334 Ga0495629_0006733 3300046459 Bacteria 8493
335 Ga0495641_0020604 3300046461 Bacteria 3338
336 Ga0495641_0028215 3300046461 Bacteria 2718
337 Ga0495641_0195623 3300046461 Archaea 906
338 Ga0495651_0095344 3300046462 Bacteria 2225
339 Ga0495651_0147200 3300046462 Bacteria 1701
340 Ga0495653_0000785 3300046463 Bacteria 24390
341 Ga0495653_0118409 3300046463 Bacteria 1891
342 Ga0495650_0000055 3300046471 Bacteria 308438
343 Ga0495580_0032741 3300046472 Bacteria 3748
344 Ga0495582_0003092 3300046473 Bacteria 9329
345 Ga0495582_0234353 3300046473 Bacteria 1051
346 Ga0495639_0005438 3300046475 Bacteria 5487
347 Ga0495662_0004033 3300046476 Bacteria 7398
348 Ga0495662_0049409 3300046476 Bacteria 2030
349 Ga0495664_0012060 3300046477 Bacteria 4887
350 Ga0495596_0128035 3300046500 Archaea 986
351 Ga0495596_0185129 3300046500 Bacteria 810
352 Ga0495608_0010204 3300046511 Bacteria 6556
353 Ga0495608_0065460 3300046511 Bacteria 2380
354 Ga0495608_0325611 3300046511 Archaea 949
355 Ga0495608_0785667 3300046511 Bacteria 563
356 Ga0495618_0004496 3300046514 Bacteria 8576
357 Ga0495618_0205600 3300046514 Unclassified 1245
358 Ga0495618_0608859 3300046514 Bacteria 649
359 Ga0495628_0099334 3300046516 Bacteria 2248
360 Ga0495630_0015680 3300046517 Bacteria 5537
361 Ga0495630_0142418 3300046517 Bacteria 1823
362 Ga0495630_0656243 3300046517 Bacteria 803
363 Ga0495630_0806166 3300046517 Unclassified 717
364 Ga0495666_0002907 3300046526 Bacteria 8583
365 Ga0495652_0116724 3300046529 Bacteria 2136
366 Ga0495652_0137173 3300046529 Bacteria 1928
367 Ga0495665_0004804 3300046531 Bacteria 7293
368 Ga0495665_0075818 3300046531 Bacteria 1770
369 Ga0495665_0527434 3300046531 Unclassified 594
370 Ga0495640_0004159 3300046533 Bacteria 11579
371 Ga0495640_0127499 3300046533 Bacteria 1649
372 Ga0495586_0100696 3300046535 Bacteria 1603
373 Ga0495587_0036020 3300046536 Bacteria 2978
374 Ga0495587_0038397 3300046536 Bacteria 2871
375 Ga0495645_0159462 3300046543 Unclassified 1561
376 Ga0495622_0259472 3300046557 Bacteria 763
377 Ga0495667_0005734 3300046559 Bacteria 8408
378 Ga0495667_0024425 3300046559 Bacteria 4069
379 Ga0495667_0274817 3300046559 Unclassified 1070
380 Ga0495634_0067208 3300046642 Bacteria 2371
381 Ga0495634_0101802 3300046642 Bacteria 1855
382 Ga0495634_0523715 3300046642 Archaea 693
383 Ga0495657_0006314 3300046675 Bacteria 9288
384 Ga0495657_0050960 3300046675 Bacteria 2781
385 Ga0495623_0229504 3300046679 Bacteria 1054
386 Ga0495623_0287554 3300046679 Archaea 912
387 Ga0495646_0044305 3300046680 Bacteria 2721
388 Ga0495646_0424951 3300046680 Archaea 688
389 Ga0495647_0017420 3300046681 Bacteria 2541
390 Ga0495647_0258036 3300046681 Bacteria 777
391 Ga0495658_0004915 3300046683 Bacteria 6556
392 Ga0495658_0278896 3300046683 Bacteria 1054
393 Ga0495658_0762084 3300046683 Bacteria 620
394 Ga0495613_0005848 3300046689 Bacteria 9200
395 Ga0495613_0240934 3300046689 Bacteria 1265
396 Ga0495624_0006826 3300046690 Bacteria 8059
397 Ga0495624_0490172 3300046690 Bacteria 735
398 Ga0495624_0588137 3300046690 Bacteria 664
399 Ga0495600_0005287 3300046809 Bacteria 7776
400 Ga0495600_0068257 3300046809 Bacteria 2323
401 Ga0495581_0002369 3300047315 Bacteria 10634
402 Ga0495581_0097628 3300047315 Bacteria 1706
403 Ga0495604_0025076 3300047317 Bacteria 4754
404 Ga0495604_0249759 3300047317 Unclassified 1210
405 Ga0495604_0471770 3300047317 Bacteria 817
406 Ga0495674_0024853 3300047319 Bacteria 5499
407 Ga0495674_0138328 3300047319 Bacteria 2048
408 Ga0495674_0502824 3300047319 Bacteria 969
409 Ga0495676_0020040 3300047321 Bacteria 5875
410 Ga0495676_0024907 3300047321 Bacteria 5171
411 Ga0495680_0015889 3300047322 Bacteria 6480
412 Ga0495680_0062463 3300047322 Bacteria 2863
413 Ga0495680_0527711 3300047322 Bacteria 798
414 Ga0495675_0020911 3300047444 Bacteria 4165
415 Ga0495684_0010897 3300047471 Bacteria 7030
416 Ga0495684_0030675 3300047471 Bacteria 4128
417 Ga0495593_0058207 3300047673 Bacteria 2027
418 Ga0495602_0248346 3300048088 Bacteria 1327
419 Ga0495614_0017458 3300048089 Bacteria 3117
420 Ga0496100_0082388 3300048903 Bacteria 2175
421 Ga0496100_0775137 3300048903 Bacteria 751
422 Ga0496100_1163976 3300048903 Bacteria 608
423 Ga0496101_0011843 3300048904 Bacteria 5803
424 Ga0496101_0051418 3300048904 Bacteria 2969
425 Ga0496102_0005185 3300048905 Bacteria 11065
426 Ga0496102_0019309 3300048905 Bacteria 6005
427 Ga0496102_0061196 3300048905 Bacteria 3445
428 Ga0496102_0348491 3300048905 Bacteria 1394
429 Ga0496102_0913073 3300048905 Bacteria 800
430 Ga0496103_0004748 3300048906 Bacteria 8217
431 Ga0496103_0038326 3300048906 Bacteria 2940
432 Ga0496103_0113338 3300048906 Bacteria 1723
433 Ga0496104_0095918 3300048907 Bacteria 2837
434 Ga0496104_0199932 3300048907 Bacteria 1910
435 Ga0496104_0876737 3300048907 Bacteria 803
436 Ga0496104_1566534 3300048907 Bacteria 562
437 Ga0496105_0035498 3300048908 Bacteria 4103
438 Ga0496105_0134254 3300048908 Bacteria 2039
439 Ga0496105_0215899 3300048908 Bacteria 1562
440 Ga0496105_0560802 3300048908 Archaea 890
441 Ga0496106_0007940 3300048909 Bacteria 7840
442 Ga0496106_0014525 3300048909 Bacteria 5819
443 Ga0496106_0338745 3300048909 Bacteria 1208
444 Ga0496106_0859883 3300048909 Bacteria 717
445 Ga0496107_0002272 3300048910 Bacteria 12403
446 Ga0496107_0161026 3300048910 Bacteria 1663
447 Ga0496107_0314518 3300048910 Bacteria 1165
448 Ga0496108_0000471 3300048911 Bacteria 32268
449 Ga0496108_0005439 3300048911 Bacteria 10290
450 Ga0496108_0010339 3300048911 Bacteria 7578
451 Ga0496108_0190413 3300048911 Bacteria 1778
452 Ga0496108_0242479 3300048911 Bacteria 1568
453 Ga0496108_0458873 3300048911 Bacteria 1113
454 Ga0496109_0002595 3300048912 Bacteria 15136
455 Ga0496109_0042773 3300048912 Bacteria 4105
456 Ga0496109_0046887 3300048912 Bacteria 3927
457 Ga0496109_0870366 3300048912 Bacteria 839
458 Ga0496109_1929438 3300048912 Archaea 523
459 Ga0496110_0000285 3300048913 Bacteria 33083
460 Ga0496110_0025725 3300048913 Bacteria 5032
461 Ga0496110_0047633 3300048913 Bacteria 3755
462 Ga0496110_0113364 3300048913 Bacteria 2438
463 Ga0496110_0153431 3300048913 Bacteria 2086
464 Ga0496110_0562191 3300048913 Bacteria 1036
465 Ga0496110_1703291 3300048913 Unclassified 540
466 Ga0496111_0000283 3300048914 Bacteria 24566
467 Ga0496111_0158984 3300048914 Bacteria 1677
468 Ga0496111_0581270 3300048914 Unclassified 821
469 Ga0496111_1086948 3300048914 Bacteria 570
470 Ga0496112_0000903 3300048915 Bacteria 21392
471 Ga0496112_0018135 3300048915 Bacteria 6624
472 Ga0496112_0224086 3300048915 Bacteria 1836
473 Ga0496112_0429911 3300048915 Bacteria 1259
474 Ga0496112_1638393 3300048915 Bacteria 556
475 Ga0496113_0004945 3300048916 Bacteria 8255
476 Ga0496113_0025672 3300048916 Bacteria 4203
477 Ga0496113_0052528 3300048916 Bacteria 3044
478 Ga0496113_0153140 3300048916 Bacteria 1820
479 Ga0496113_0158947 3300048916 Bacteria 1786
480 Ga0496113_1454399 3300048916 Bacteria 530
481 Ga0496114_0020635 3300048917 Bacteria 5348
482 Ga0496114_0055421 3300048917 Bacteria 3306
483 Ga0496114_1063215 3300048917 Unclassified 694
484 Ga0496115_0011430 3300048918 Bacteria 6655
485 Ga0496115_0020181 3300048918 Bacteria 5137
486 Ga0496115_0584248 3300048918 Bacteria 890
487 Ga0496119_0128180 3300048922 Bacteria 1386
488 Ga0496121_0002395 3300048924 Bacteria 28736
489 Ga0501077_0735910 3300049593 Bacteria 634
490 nmdc:mga0yw44_378885_c1 3300050492 Bacteria 955
491 nmdc:mga0yw44_709386_c1 3300050492 Bacteria 683
492 nmdc:mga09592_975321_c1 3300050508 Unclassified 709
493 nmdc:mga08y16_60720_c1 3300050511 Bacteria 3948
494 nmdc:mga0n895_199738_c1 3300050512 Bacteria 2031
495 nmdc:mga0n895_387838_c1 3300050512 Bacteria 1413
496 nmdc:mga0n895_4132_c2 3300050512 Bacteria 3619
497 nmdc:mga0rr50_1062009_c1 3300050513 Bacteria 689
498 nmdc:mga0rr50_2139_c1 3300050513 Bacteria 11044
499 nmdc:mga0rr50_371740_c1 3300050513 Bacteria 1204
500 nmdc:mga08x19_480855_c1 3300050514 Bacteria 876
501 nmdc:mga08x19_81034_c1 3300050514 Bacteria 2131
502 nmdc:mga0a205_85373_c1 3300050515 Bacteria 3048
503 nmdc:mga0a205_89164_c1 3300050515 Bacteria 2981
504 Ga0495601_0012455 3300053077 Bacteria 5102
505 Ga0495601_0040644 3300053077 Bacteria 2913
506 Ga0495601_0145814 3300053077 Bacteria 1545
507 Ga0495612_0015815 3300053078 Bacteria 3024
508 Ga0495595_0010485 3300053084 Bacteria 3852
509 Ga0495595_0033676 3300053084 Bacteria 2313
510 Ga0495619_0005070 3300053085 Bacteria 8364
511 Ga0495619_0128682 3300053085 Bacteria 1739
512 Ga0500614_205930 3300053123 Bacteria 607
513 Ga0500616_0170112 3300053153 Bacteria 990
514 Ga0530510_0903285 3300061734 Bacteria 675
515 Ga0081538_10037987
516 JGI24737J22298_10214334
517 JGI25407J50210_10069934
518 JGI25407J50210_10087104
519 Ga0070658_10630463
520 Ga0070676_10505970
521 Ga0070683_100101460
522 Ga0070683_100155919
523 Ga0070670_100226972
524 Ga0070670_100374516
525 Ga0070670_100684984
526 Ga0068868_100006947
527 Ga0070660_100005466
528 Ga0070660_100441496
529 Ga0070687_101251049
530 Ga0070661_100086494
531 Ga0070661_100364492
532 Ga0070692_10451910
533 Ga0070669_100144986
534 Ga0070674_100119825
535 Ga0070673_100154727
536 Ga0070688_100723645
537 Ga0070659_100136321
538 Ga0070659_101128008
539 Ga0070667_101693572
540 Ga0070709_10114470
541 Ga0070714_100050383
542 Ga0070714_100050385
543 Ga0070714_100351165
544 Ga0070714_101746649
545 Ga0070713_100165472
546 Ga0070713_100716614
547 Ga0070713_101038675
548 Ga0070710_10137150
549 Ga0070701_10128177
550 Ga0070701_10143467
551 Ga0070701_10178492
552 Ga0070711_100620621
553 Ga0070711_101010637
554 Ga0070700_100161213
555 Ga0070700_100622188
556 Ga0070700_100981650
557 Ga0070694_101096247
558 Ga0070663_100237051
559 Ga0070663_101102210
560 Ga0070678_100094846
561 Ga0070678_100631649
562 Ga0070662_100088184
563 Ga0070662_100220298
564 Ga0070681_10887296
565 Ga0068867_100503139
566 Ga0070685_10298617
567 Ga0070699_101523042
568 Ga0070679_100162935
569 Ga0070684_100722398
570 Ga0070684_101089355
571 Ga0068853_100294510
572 Ga0068853_101578138
573 Ga0070672_100195595
574 Ga0070672_101177621
575 Ga0070686_100136473
576 Ga0070693_100320301
577 Ga0070665_100334218
578 Ga0070665_100588937
579 Ga0068855_100339993
580 Ga0068855_100857631
581 Ga0070664_100082701
582 Ga0068857_101576555
583 Ga0068854_100135211
584 Ga0068854_100637171
585 Ga0068854_102122753
586 Ga0068856_100003239
587 Ga0068856_100047911
588 Ga0068856_100189399
589 Ga0068856_101236715
590 Ga0070702_101287587
591 Ga0068852_100081538
592 Ga0068852_100874383
593 Ga0068852_101840489
594 Ga0068864_102523830
595 Ga0068866_11007631
596 Ga0068861_100424073
597 Ga0068861_101928363
598 Ga0068851_10298365
599 Ga0068870_10067972
600 Ga0068870_10482687
601 Ga0068870_10610609
602 Ga0068870_10857187
603 Ga0068858_100013790
604 Ga0068860_100633992
605 Ga0068860_101361956
606 Ga0068862_100700786
607 Ga0081455_10000746
608 Ga0081455_10531345
609 Ga0081538_10048757
610 Ga0081540_1134714
611 Ga0070717_10005163
612 Ga0070717_10389571
613 Ga0075365_10275774
614 Ga0075363_100158380
615 Ga0075364_11082474
616 Ga0075432_10251905
617 Ga0070715_10005654
618 Ga0070715_10107930
619 Ga0070716_100060784
620 Ga0070716_100104598
621 Ga0070716_101335429
622 Ga0070712_100129523
623 Ga0070712_100241679
624 Ga0070712_100252374
625 Ga0097621_100814277
626 Ga0097621_101615530
627 Ga0068871_100522808
628 Ga0075428_101168097
629 Ga0075428_102116645
630 Ga0075433_10039711
631 Ga0075433_10461779
632 Ga0075434_100021693
633 Ga0075434_100032531
634 Ga0075434_101600213
635 Ga0075429_101400565
636 Ga0068865_100228497
637 Ga0075436_100045795
638 Ga0075436_100071339
639 Ga0075436_100953365
640 Ga0075435_100000686
641 Ga0075435_100753972
642 Ga0075435_101979485
643 Ga0111539_10429693
644 Ga0111539_10592360
645 Ga0105245_10026423
646 Ga0105245_10527541
647 Ga0105245_10648371
648 Ga0105245_11119731
649 Ga0105247_10015302
650 Ga0105247_11002668
651 Ga0114129_11133343
652 Ga0105243_10168688
653 Ga0105243_10522931
654 Ga0105243_10782976
655 Ga0105241_10182231
656 Ga0105241_11669263
657 Ga0105242_10268508
658 Ga0105242_12832737
659 Ga0105248_10089177
660 Ga0105237_10010182
661 Ga0105238_10014541
662 Ga0105249_11094152
663 Ga0105249_11643424
664 Ga0105239_10217197
665 Ga0105239_12717625
666 Ga0105246_10156720
667 Ga0105246_10687616
668 Ga0105246_11480641
669 Ga0105246_12525378
670 Ga0157373_10853633
671 Ga0157371_10091118
672 Ga0157370_10294133
673 Ga0157374_10006092
674 Ga0157374_12814562
675 Ga0157378_10968786
676 Ga0163162_10458724
677 Ga0157372_10617235
678 Ga0157372_10911074
679 Ga0157372_11669271
680 Ga0157375_10019948
681 Ga0157375_10882039
682 Ga0157375_11851712
683 Ga0157380_12367839
684 Ga0182008_10839075
685 Ga0157376_10020427
686 Ga0206356_10480351
687 Ga0213874_10114738
688 Ga0213875_10009468
689 Ga0207656_10204579
690 Ga0207656_10230217
691 Ga0207656_10375363
692 Ga0207692_10129441
693 Ga0207692_10469621
694 Ga0207692_10982068
695 Ga0207642_10629468
696 Ga0207710_10759589
697 Ga0207688_10021682
698 Ga0207688_10248613
699 Ga0207699_10103488
700 Ga0207643_10031867
701 Ga0207643_10086457
702 Ga0207705_10454646
703 Ga0207654_10454219
704 Ga0207707_10646407
705 Ga0207671_10402437
706 Ga0207693_10024823
707 Ga0207693_10922781
708 Ga0207663_10270988
709 Ga0207663_10674619
710 Ga0207663_10921247
711 Ga0207660_10412458
712 Ga0207662_10504811
713 Ga0207657_10002421
714 Ga0207657_11211084
715 Ga0207649_10667541
716 Ga0207649_11300259
717 Ga0207652_11197768
718 Ga0207694_10036483
719 Ga0207694_11272100
720 Ga0207650_10370291
721 Ga0207659_10515178
722 Ga0207687_10005422
723 Ga0207687_10072975
724 Ga0207687_10085417
725 Ga0207687_10351257
726 Ga0207700_10180233
727 Ga0207700_10218591
728 Ga0207664_10034554
729 Ga0207664_10492136
730 Ga0207664_11555699
731 Ga0207706_10107455
732 Ga0207706_10156673
733 Ga0207686_10283735
734 Ga0207709_10126648
735 Ga0207709_10534544
736 Ga0207670_10201892
737 Ga0207669_10058142
738 Ga0207704_10181094
739 Ga0207704_10628499
740 Ga0207665_10018342
741 Ga0207665_10070580
742 Ga0207665_10101374
743 Ga0207691_10265230
744 Ga0207691_10964006
745 Ga0207711_10359277
746 Ga0207711_11608545
747 Ga0207689_10271309
748 Ga0207689_10451428
749 Ga0207689_11728261
750 Ga0207661_10087524
751 Ga0207679_10020820
752 Ga0207679_10053821
753 Ga0207667_10014202
754 Ga0207651_10205172
755 Ga0207651_10212319
756 Ga0207712_10411160
757 Ga0207640_10015398
758 Ga0207640_10177465
759 Ga0207640_10814245
760 Ga0207658_11081058
761 Ga0207677_10005989
762 Ga0207677_10142094
763 Ga0207677_10399183
764 Ga0207703_10027981
765 Ga0207639_10267340
766 Ga0207678_10196372
767 Ga0207708_10347439
768 Ga0207708_10741936
769 Ga0207702_10001802
770 Ga0207702_11077239
771 Ga0207702_11831611
772 Ga0207641_10248972
773 Ga0207641_11390677
774 Ga0207648_10042164
775 Ga0207648_10600026
776 Ga0207674_11580099
777 Ga0207675_100225147
778 Ga0207675_101138106
779 Ga0207683_10117757
780 Ga0207683_10655709
781 Ga0207698_10251114
782 Ga0207698_11293746
783 Ga0207428_10089127
784 Ga0268266_10103792
785 Ga0268264_10302572
786 Ga0268264_10981604
787 Ga0307413_10246887
788 Ga0307413_11052684
789 Ga0307410_11732069
790 Ga0307407_10609337
791 Ga0307409_100603678
792 Ga0307409_101762567
793 Ga0307416_103565601
794 Ga0307415_100031791
795 Ga0373926_0002388
796 Ga0373934_0028302
797 Ga0373923_0054226
798 Ga0373936_0227750
799 Ga0373953_0279112
800 Ga0373956_0090303
801 Ga0373943_0000824
802 Ga0373943_0880706
803 Ga0373946_0013696
804 Ga0373924_0011806
805 Ga0373924_0123981
806 Ga0373935_0037787
807 Ga0373935_0082193
808 Ga0373927_0020198
809 Ga0373927_0568640
810 Ga0373933_0120654
811 Ga0373947_0003569
812 Ga0373947_0043936
813 Ga0373947_0050307
814 Ga0373937_0055775
815 Ga0373925_0002730
816 Ga0395899_0329759
817 Ga0395899_0847933
818 Ga0395900_0152956
819 Ga0395900_0379809
820 Ga0395900_0719098
821 Ga0395898_0017901
822 Ga0395898_0057038
823 Ga0395898_0259037
824 Ga0395898_1614025
825 Ga0395905_0102624
826 Ga0395905_1128892
827 Ga0436364_1393669
828 Ga0395901_0163029
829 Ga0395901_0629892
830 Ga0395901_1339364
831 Ga0436365_1924606
832 Ga0436363_1440169
833 Ga0436363_1443983
834 Ga0451853_0086124
835 Ga0451853_1315295
836 Ga0466961_0115903
837 Ga0466959_0729290
838 Ga0466967_0218959
839 Ga0466967_0266924
840 Ga0466967_0309424
841 Ga0466967_0537950
842 Ga0466967_2598972
843 Ga0495592_0023211
844 Ga0495592_0095276
845 Ga0495592_0550942
846 Ga0495603_0028762
847 Ga0495603_0128818
848 Ga0495629_0006733
849 Ga0495641_0020604
850 Ga0495641_0028215
851 Ga0495641_0195623
852 Ga0495651_0095344
853 Ga0495651_0147200
854 Ga0495653_0000785
855 Ga0495653_0118409
856 Ga0495650_0000055
857 Ga0495580_0032741
858 Ga0495582_0003092
859 Ga0495582_0234353
860 Ga0495639_0005438
861 Ga0495662_0004033
862 Ga0495662_0049409
863 Ga0495664_0012060
864 Ga0495596_0128035
865 Ga0495596_0185129
866 Ga0495608_0010204
867 Ga0495608_0065460
868 Ga0495608_0325611
869 Ga0495608_0785667
870 Ga0495618_0004496
871 Ga0495618_0205600
872 Ga0495618_0608859
873 Ga0495628_0099334
874 Ga0495630_0015680
875 Ga0495630_0142418
876 Ga0495630_0656243
877 Ga0495630_0806166
878 Ga0495666_0002907
879 Ga0495652_0116724
880 Ga0495652_0137173
881 Ga0495665_0004804
882 Ga0495665_0075818
883 Ga0495665_0527434
884 Ga0495640_0004159
885 Ga0495640_0127499
886 Ga0495586_0100696
887 Ga0495587_0036020
888 Ga0495587_0038397
889 Ga0495645_0159462
890 Ga0495622_0259472
891 Ga0495667_0005734
892 Ga0495667_0024425
893 Ga0495667_0274817
894 Ga0495634_0067208
895 Ga0495634_0101802
896 Ga0495634_0523715
897 Ga0495657_0006314
898 Ga0495657_0050960
899 Ga0495623_0229504
900 Ga0495623_0287554
901 Ga0495646_0044305
902 Ga0495646_0424951
903 Ga0495647_0017420
904 Ga0495647_0258036
905 Ga0495658_0004915
906 Ga0495658_0278896
907 Ga0495658_0762084
908 Ga0495613_0005848
909 Ga0495613_0240934
910 Ga0495624_0006826
911 Ga0495624_0490172
912 Ga0495624_0588137
913 Ga0495600_0005287
914 Ga0495600_0068257
915 Ga0495581_0002369
916 Ga0495581_0097628
917 Ga0495604_0025076
918 Ga0495604_0249759
919 Ga0495604_0471770
920 Ga0495674_0024853
921 Ga0495674_0138328
922 Ga0495674_0502824
923 Ga0495676_0020040
924 Ga0495676_0024907
925 Ga0495680_0015889
926 Ga0495680_0062463
927 Ga0495680_0527711
928 Ga0495675_0020911
929 Ga0495684_0010897
930 Ga0495684_0030675
931 Ga0495593_0058207
932 Ga0495602_0248346
933 Ga0495614_0017458
934 Ga0496100_0082388
935 Ga0496100_0775137
936 Ga0496100_1163976
937 Ga0496101_0011843
938 Ga0496101_0051418
939 Ga0496102_0005185
940 Ga0496102_0019309
941 Ga0496102_0061196
942 Ga0496102_0348491
943 Ga0496102_0913073
944 Ga0496103_0004748
945 Ga0496103_0038326
946 Ga0496103_0113338
947 Ga0496104_0095918
948 Ga0496104_0199932
949 Ga0496104_0876737
950 Ga0496104_1566534
951 Ga0496105_0035498
952 Ga0496105_0134254
953 Ga0496105_0215899
954 Ga0496105_0560802
955 Ga0496106_0007940
956 Ga0496106_0014525
957 Ga0496106_0338745
958 Ga0496106_0859883
959 Ga0496107_0002272
960 Ga0496107_0161026
961 Ga0496107_0314518
962 Ga0496108_0000471
963 Ga0496108_0005439
964 Ga0496108_0010339
965 Ga0496108_0190413
966 Ga0496108_0242479
967 Ga0496108_0458873
968 Ga0496109_0002595
969 Ga0496109_0042773
970 Ga0496109_0046887
971 Ga0496109_0870366
972 Ga0496109_1929438
973 Ga0496110_0000285
974 Ga0496110_0025725
975 Ga0496110_0047633
976 Ga0496110_0113364
977 Ga0496110_0153431
978 Ga0496110_0562191
979 Ga0496110_1703291
980 Ga0496111_0000283
981 Ga0496111_0158984
982 Ga0496111_0581270
983 Ga0496111_1086948
984 Ga0496112_0000903
985 Ga0496112_0018135
986 Ga0496112_0224086
987 Ga0496112_0429911
988 Ga0496112_1638393
989 Ga0496113_0004945
990 Ga0496113_0025672
991 Ga0496113_0052528
992 Ga0496113_0153140
993 Ga0496113_0158947
994 Ga0496113_1454399
995 Ga0496114_0020635
996 Ga0496114_0055421
997 Ga0496114_1063215
998 Ga0496115_0011430
999 Ga0496115_0020181
1000 Ga0496115_0584248
1001 Ga0496119_0128180
1002 Ga0496121_0002395
1003 Ga0501077_0735910
1004 nmdc:mga0yw44_378885_c1
1005 nmdc:mga0yw44_709386_c1
1006 nmdc:mga09592_975321_c1
1007 nmdc:mga08y16_60720_c1
1008 nmdc:mga0n895_199738_c1
1009 nmdc:mga0n895_387838_c1
1010 nmdc:mga0n895_4132_c2
1011 nmdc:mga0rr50_1062009_c1
1012 nmdc:mga0rr50_2139_c1
1013 nmdc:mga0rr50_371740_c1
1014 nmdc:mga08x19_480855_c1
1015 nmdc:mga08x19_81034_c1
1016 nmdc:mga0a205_85373_c1
1017 nmdc:mga0a205_89164_c1
1018 Ga0495601_0012455
1019 Ga0495601_0040644
1020 Ga0495601_0145814
1021 Ga0495612_0015815
1022 Ga0495595_0010485
1023 Ga0495595_0033676
1024 Ga0495619_0005070
1025 Ga0495619_0128682
1026 Ga0500614_205930
1027 Ga0500616_0170112
1028 Ga0530510_0903285

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17648

Luciferase

Luciferase

7

101

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6988 5 106
4uc6-assembly2.cif.gz_B n-terminal globular domain of the rsv nucleoprotein 0.6863 76 112
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6567 5 113
2fki-assembly1.cif.gz_A nmr structure of protein yjbr from escherichia coli; northeast structural genomics consortium target er226 0.6315 5 106
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6289 5 113
ID Description Score Start End Superfamily
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.76 5 106 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.741 8 107 3.90.1150.30
af_Q5ADY1_4_286_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.7328 20 47 2.130.10.10
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6864 5 106 3.90.1150.30
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6591 8 107 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A2T4UJ97-F1-model_v4 DUF5519 domain-containing protein 0.9938 1 107
AF-A0A660L063-F1-model_v4 DUF5519 domain-containing protein 0.9919 11 112
AF-A0A5B8U9M4-F1-model_v4 DUF5519 domain-containing protein 0.9912 1 107
AF-A0A7V8WBN1-F1-model_v4 DUF5519 family protein 0.9896 11 114
AF-A0A7W0LKE4-F1-model_v4 DUF5519 family protein 0.9874 19 113

Map