metagRoot

F457533

General Info

Members	Datasets	Scaffolds	Average Seq Length
513	262	503	288

Family's Representative Sequence

Representative Sequence	3300005435\|Ga0070714_100097230\|Ga0070714_1000972301
Length	312
Sequence	VPAGCESQEPNAVEEAATQDHPDFIELLATLDLHRVDDDLFIGSHPSKNPMRTFGGQLMSQSFVASSRSLVRADLPPSALSVHFVNGGDTSKDIEFHVTRLRDERRFANRRVDAMQDGTLLCSALVSYMAGGRGLEHGIEPPKVAEPHTQPTIGELLRGYEETVPHFVNALQPIEWRYTNDPAWVMRTKGDRLPHNRVWVKALGEIPADPVLHTATMVYSSDTTVLDSVITTHGLSWGFDRIFAASANHSIWFHRQVNFNDWVLYSTSSPVAADSRGLGTGHFFDRSGQPLATVAQEGVLKYFPSSGRRNVT

Samples

	Sample ID	Description	Type	Environment
1	2643221687	Mycobacterium sp. Root135	Isolate	Unclassified
2	2643221715	Mycobacterium sp. Root265	Isolate	Unclassified
3	2738541264	Mycobacterium sp. OK889	Isolate	Unclassified
4	2738541356	Mycobacterium sp. OK887	Isolate	Unclassified
5	2842134933	Mycolicibacterium obuense SEMIA 442	Isolate	Nodule
6	2902792274	Mycolicibacterium sp. P9-64	Isolate	Unclassified
7	2902810491	Mycolicibacterium sp. P9-22	Isolate	Unclassified
8	2902837492	Mycolicibacterium sp. P1-18	Isolate	Unclassified
9	2929212328	Mycolicibacterium sp. R-73050 Hybrid assembly	Isolate	Unclassified
10	2939582691	Mycolicibacterium sp. 624	Isolate	Rhizosphere
11	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
12	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
13	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
14	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
15	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
16	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
17	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
18	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
19	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
20	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
21	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
24	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
25	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
26	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
27	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
28	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
29	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
30	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
31	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
32	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
33	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
34	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
35	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
36	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
37	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
38	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
39	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
40	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
41	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
42	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
43	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
47	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
48	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
49	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
50	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
51	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
52	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
53	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
54	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
55	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
56	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
57	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
58	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
59	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
67	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
68	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
69	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
70	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
71	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
72	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
73	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
74	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
75	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
76	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
78	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
79	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
80	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
81	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
82	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
84	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
85	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
86	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
87	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
88	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
90	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
91	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
92	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
93	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
94	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
95	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
96	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
97	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
98	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
99	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
100	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
101	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
102	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
103	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
104	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
105	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
106	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
107	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
108	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
109	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
110	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
154	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
155	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
156	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
157	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
158	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
159	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
160	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
161	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
162	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
163	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
164	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
165	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
166	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
167	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
168	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
169	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
170	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
171	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
172	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
173	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
174	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
175	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
176	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
177	3300042008	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219	Metagenome	Rhizosphere
178	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
179	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
180	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
181	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
182	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
183	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
184	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
185	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
186	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
187	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
188	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
189	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
190	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
191	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
192	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
193	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
194	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
195	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
196	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
197	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
198	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
199	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
200	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
201	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
202	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
203	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
204	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
205	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
206	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
207	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
208	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
209	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
210	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
211	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
212	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
213	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
214	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
215	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
216	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
217	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
218	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
219	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
220	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
221	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
222	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
223	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
224	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
225	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
226	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
227	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
228	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
229	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
230	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
231	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
232	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
233	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
234	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
235	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
236	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
237	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
240	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
242	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
243	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
244	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
245	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
247	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
248	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
249	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
250	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
251	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
252	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
253	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
254	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
255	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
256	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
257	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
258	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
259	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
260	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
261	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
262	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	98.05
Metatranscriptomes	0
Isolates	1.95

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	14.42
Nodule	0.19
Rhizoplane	12.87
Rhizosphere	62.96
Stem	0
Stem Tuber	0
Unclassified	9.55

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24746J21847_1000920	3300001977	Bacteria	4604
2	JGI24739J22299_10052682	3300001989	Bacteria	1308
3	JGI24738J21930_10008810	3300002075	Bacteria	2288
4	JGI24744J21845_10000225	3300002077	Bacteria	9002
5	JGI24744J21845_10005550	3300002077	Bacteria	2611
6	JGI24742J22300_10001302	3300002244	Bacteria	3918
7	Ga0055540_1000348	3300003792	Bacteria	39249
8	Ga0055540_1000979	3300003792	Bacteria	18445
9	Ga0055540_1004379	3300003792	Bacteria	6399
10	Ga0055540_1013873	3300003792	Bacteria	2436
11	Ga0070676_10011866	3300005328	Bacteria	4747
12	Ga0070690_100016144	3300005330	Bacteria	4468
13	Ga0068869_100012086	3300005334	Bacteria	5691
14	Ga0070666_10046445	3300005335	Bacteria	2913
15	Ga0070682_100002878	3300005337	Bacteria	9543
16	Ga0070682_100104499	3300005337	Bacteria	1876
17	Ga0068868_100002357	3300005338	Bacteria	13081
18	Ga0070689_100085258	3300005340	Bacteria	2484
19	Ga0070691_10002109	3300005341	Bacteria	8803
20	Ga0070668_100006073	3300005347	Bacteria	8956
21	Ga0070668_100007314	3300005347	Bacteria	8190
22	Ga0070668_100041422	3300005347	Bacteria	3528
23	Ga0070669_100007362	3300005353	Bacteria	7895
24	Ga0070671_100005971	3300005355	Bacteria	9702
25	Ga0070671_100093704	3300005355	Bacteria	2517
26	Ga0070671_100188918	3300005355	Bacteria	1746
27	Ga0070674_100000947	3300005356	Bacteria	15132
28	Ga0070674_100040274	3300005356	Bacteria	3160
29	Ga0070673_100472689	3300005364	Bacteria	1130
30	Ga0070688_100011238	3300005365	Bacteria	4970
31	Ga0070667_100000171	3300005367	Bacteria	80660
32	Ga0070667_100004215	3300005367	Bacteria	12137
33	Ga0070667_100093099	3300005367	Bacteria	2595
34	Ga0070667_100199435	3300005367	Bacteria	1775
35	Ga0070667_100454169	3300005367	Bacteria	1171
36	Ga0070709_10082071	3300005434	Bacteria	2106
37	Ga0070714_100097230	3300005435	Bacteria	2588
38	Ga0070710_10001153	3300005437	Bacteria	12511
39	Ga0070701_10000735	3300005438	Bacteria	11616
40	Ga0070701_10027655	3300005438	Bacteria	2780
41	Ga0070711_100000535	3300005439	Bacteria	19802
42	Ga0070711_100217966	3300005439	Bacteria	1482
43	Ga0070700_100000769	3300005441	Bacteria	15821
44	Ga0070700_100153025	3300005441	Bacteria	1579
45	Ga0070694_100083353	3300005444	Bacteria	2228
46	Ga0070663_100192415	3300005455	Bacteria	1588
47	Ga0070678_100000761	3300005456	Bacteria	16161
48	Ga0070678_100153696	3300005456	Bacteria	1856
49	Ga0070662_100008069	3300005457	Bacteria	6853
50	Ga0068867_100004245	3300005459	Bacteria	10086
51	Ga0070685_10114430	3300005466	Bacteria	1667
52	Ga0070685_10155837	3300005466	Bacteria	1452
53	Ga0068853_100009937	3300005539	Bacteria	7683
54	Ga0068853_100074180	3300005539	Bacteria	2968
55	Ga0068853_100184411	3300005539	Bacteria	1893
56	Ga0070672_100459244	3300005543	Bacteria	1098
57	Ga0070686_100038333	3300005544	Bacteria	2979
58	Ga0070695_100009864	3300005545	Bacteria	5691
59	Ga0070696_100400451	3300005546	Bacteria	1074
60	Ga0070693_100021021	3300005547	Bacteria	3451
61	Ga0070665_100007339	3300005548	Bacteria	11214
62	Ga0070665_100015519	3300005548	Bacteria	7653
63	Ga0070665_100023444	3300005548	Bacteria	6214
64	Ga0070704_100000119	3300005549	Bacteria	28370
65	Ga0068854_100003142	3300005578	Bacteria	10285
66	Ga0068856_100313571	3300005614	Bacteria	1586
67	Ga0070702_100110274	3300005615	Bacteria	1705
68	Ga0068852_100203839	3300005616	Bacteria	1873
69	Ga0068859_100001666	3300005617	Bacteria	22618
70	Ga0068859_100006068	3300005617	Bacteria	12266
71	Ga0068864_100295592	3300005618	Bacteria	1515
72	Ga0068866_10000444	3300005718	Bacteria	19148
73	Ga0068861_100000376	3300005719	Bacteria	25730
74	Ga0068861_100435877	3300005719	Bacteria	1171
75	Ga0068863_100005765	3300005841	Bacteria	12150
76	Ga0068863_100008304	3300005841	Bacteria	10146
77	Ga0068863_100174939	3300005841	Bacteria	2060
78	Ga0068858_100011529	3300005842	Bacteria	8340
79	Ga0068858_100031466	3300005842	Bacteria	4928
80	Ga0068860_100000112	3300005843	Bacteria	130953
81	Ga0068860_100001509	3300005843	Bacteria	25082
82	Ga0068860_100051465	3300005843	Bacteria	3919
83	Ga0068862_100000012	3300005844	Bacteria	267598
84	Ga0068862_100002023	3300005844	Bacteria	18382
85	Ga0081455_10023972	3300005937	Bacteria	5662
86	Ga0081455_10057728	3300005937	Bacteria	3288
87	Ga0081455_10140304	3300005937	Bacteria	1878
88	Ga0070717_10347310	3300006028	Bacteria	1326
89	Ga0075365_10007871	3300006038	Bacteria	6005
90	Ga0075368_10017658	3300006042	Bacteria	2673
91	Ga0075363_100000835	3300006048	Bacteria	10698
92	Ga0075363_100001686	3300006048	Bacteria	8565
93	Ga0075363_100004565	3300006048	Bacteria	6073
94	Ga0075363_100012423	3300006048	Bacteria	4104
95	Ga0075363_100026568	3300006048	Bacteria	2962
96	Ga0075363_100055772	3300006048	Bacteria	2117
97	Ga0075363_100094236	3300006048	Bacteria	1650
98	Ga0075363_100133619	3300006048	Bacteria	1393
99	Ga0075364_10001802	3300006051	Bacteria	11873
100	Ga0075364_10004783	3300006051	Bacteria	7831
101	Ga0075364_10028399	3300006051	Bacteria	3581
102	Ga0075364_10137988	3300006051	Bacteria	1639
103	Ga0075364_10148739	3300006051	Bacteria	1578
104	Ga0070715_10004585	3300006163	Bacteria	4553
105	Ga0070715_10040592	3300006163	Bacteria	1945
106	Ga0070716_100000695	3300006173	Bacteria	14305
107	Ga0070716_100124878	3300006173	Bacteria	1617
108	Ga0070716_100311882	3300006173	Bacteria	1099
109	Ga0070712_100001936	3300006175	Bacteria	12676
110	Ga0070712_100431776	3300006175	Bacteria	1093
111	Ga0075362_10054124	3300006177	Bacteria	1803
112	Ga0075362_10160544	3300006177	Bacteria	1082
113	Ga0075367_10032377	3300006178	Bacteria	3009
114	Ga0075367_10200457	3300006178	Bacteria	1247
115	Ga0075369_10000634	3300006186	Bacteria	11162
116	Ga0075369_10004296	3300006186	Bacteria	5249
117	Ga0075369_10006414	3300006186	Bacteria	4444
118	Ga0075369_10013542	3300006186	Bacteria	3240
119	Ga0075369_10015693	3300006186	Bacteria	3044
120	Ga0075369_10049384	3300006186	Bacteria	1817
121	Ga0075369_10053400	3300006186	Bacteria	1754
122	Ga0075369_10094717	3300006186	Bacteria	1335
123	Ga0097621_100048326	3300006237	Bacteria	3451
124	Ga0075370_10004579	3300006353	Bacteria	6740
125	Ga0075370_10008681	3300006353	Bacteria	5240
126	Ga0075370_10056806	3300006353	Bacteria	2224
127	Ga0075370_10146886	3300006353	Bacteria	1380
128	Ga0075370_10216941	3300006353	Bacteria	1130
129	Ga0068871_100064292	3300006358	Bacteria	3004
130	Ga0068871_100114850	3300006358	Bacteria	2269
131	Ga0075428_100007778	3300006844	Bacteria	11877
132	Ga0075430_100011360	3300006846	Bacteria	7556
133	Ga0075430_100095489	3300006846	Bacteria	2485
134	Ga0068865_100001291	3300006881	Bacteria	14568
135	Ga0068865_100067642	3300006881	Bacteria	2524
136	Ga0097620_100001666	3300006931	Bacteria	22618
137	Ga0097620_100006068	3300006931	Bacteria	12266
138	Ga0105250_10025504	3300009092	Bacteria	2382
139	Ga0105240_10425927	3300009093	Bacteria	1490
140	Ga0111539_10149305	3300009094	Bacteria	2736
141	Ga0105245_10009801	3300009098	Bacteria	8346
142	Ga0105245_10049277	3300009098	Bacteria	3771
143	Ga0105245_10226522	3300009098	Bacteria	1806
144	Ga0105247_10000007	3300009101	Bacteria	409490
145	Ga0105247_10005110	3300009101	Bacteria	8311
146	Ga0114129_10011065	3300009147	Bacteria	12854
147	Ga0105243_10008137	3300009148	Bacteria	8053
148	Ga0105243_10320968	3300009148	Bacteria	1411
149	Ga0105241_10021291	3300009174	Bacteria	4792
150	Ga0105242_10002292	3300009176	Bacteria	15115
151	Ga0105242_10069516	3300009176	Bacteria	2917
152	Ga0105248_10000254	3300009177	Bacteria	62178
153	Ga0105248_10003491	3300009177	Bacteria	17445
154	Ga0105248_10690368	3300009177	Bacteria	1152
155	Ga0105237_10005502	3300009545	Bacteria	14274
156	Ga0105237_10031891	3300009545	Bacteria	5337
157	Ga0105237_10060504	3300009545	Bacteria	3789
158	Ga0105249_10000001	3300009553	Bacteria	504948
159	Ga0105249_10002528	3300009553	Bacteria	15830
160	Ga0105249_10037016	3300009553	Bacteria	4428
161	Ga0105239_10006332	3300010375	Bacteria	13763
162	Ga0105239_10072942	3300010375	Bacteria	3774
163	Ga0105239_10312197	3300010375	Bacteria	1772
164	Ga0157374_10218410	3300013296	Bacteria	1870
165	Ga0157378_10003016	3300013297	Bacteria	14963
166	Ga0157378_10007460	3300013297	Bacteria	9555
167	Ga0163162_10009316	3300013306	Bacteria	9549
168	Ga0163162_10009651	3300013306	Bacteria	9385
169	Ga0157372_10114059	3300013307	Bacteria	3098
170	Ga0157375_10001844	3300013308	Bacteria	18217
171	Ga0157375_10195080	3300013308	Bacteria	2180
172	Ga0163163_10063325	3300014325	Bacteria	3667
173	Ga0163163_10278444	3300014325	Bacteria	1724
174	Ga0157380_10001662	3300014326	Bacteria	14663
175	Ga0157380_10504832	3300014326	Bacteria	1176
176	Ga0157380_10535867	3300014326	Bacteria	1145
177	Ga0157377_10005117	3300014745	Bacteria	6129
178	Ga0157379_10024830	3300014968	Bacteria	5320
179	Ga0157379_10033904	3300014968	Bacteria	4552
180	Ga0157379_10058938	3300014968	Bacteria	3434
181	Ga0157376_10261562	3300014969	Bacteria	1621
182	Ga0163161_10004093	3300017792	Bacteria	10205
183	Ga0163161_10103972	3300017792	Bacteria	2117
184	Ga0213876_10015377	3300021384	Bacteria	4050
185	Ga0213876_10096224	3300021384	Bacteria	1569
186	Ga0209673_1013712	3300025273	Bacteria	3184
187	Ga0209051_1000011	3300025303	Bacteria	610828
188	Ga0209051_1000651	3300025303	Bacteria	39360
189	Ga0209051_1002280	3300025303	Bacteria	14029
190	Ga0209051_1003613	3300025303	Bacteria	10042
191	Ga0207642_10007873	3300025899	Bacteria	3621
192	Ga0207710_10000013	3300025900	Bacteria	409402
193	Ga0207710_10020213	3300025900	Bacteria	2846
194	Ga0207688_10000958	3300025901	Bacteria	14666
195	Ga0207647_10025811	3300025904	Bacteria	3853
196	Ga0207647_10094617	3300025904	Bacteria	1779
197	Ga0207685_10030733	3300025905	Bacteria	1915
198	Ga0207699_10261573	3300025906	Bacteria	1196
199	Ga0207654_10011134	3300025911	Bacteria	4578
200	Ga0207693_10000746	3300025915	Bacteria	29275
201	Ga0207693_10003092	3300025915	Bacteria	14343
202	Ga0207663_10010211	3300025916	Bacteria	4988
203	Ga0207663_10073997	3300025916	Bacteria	2206
204	Ga0207663_10141278	3300025916	Bacteria	1678
205	Ga0207687_10005364	3300025927	Bacteria	8483
206	Ga0207700_10142471	3300025928	Bacteria	1971
207	Ga0207664_10029743	3300025929	Bacteria	4164
208	Ga0207644_10139964	3300025931	Bacteria	1862
209	Ga0207706_10012375	3300025933	Bacteria	7772
210	Ga0207686_10014624	3300025934	Bacteria	4374
211	Ga0207686_10278476	3300025934	Bacteria	1234
212	Ga0207709_10002527	3300025935	Bacteria	11408
213	Ga0207670_10035649	3300025936	Bacteria	3228
214	Ga0207669_10025522	3300025937	Bacteria	3196
215	Ga0207704_10003483	3300025938	Bacteria	7158
216	Ga0207665_10004414	3300025939	Bacteria	9348
217	Ga0207665_10004959	3300025939	Bacteria	8881
218	Ga0207665_10277375	3300025939	Bacteria	1246
219	Ga0207691_10034540	3300025940	Bacteria	4701
220	Ga0207711_10000509	3300025941	Bacteria	40017
221	Ga0207711_10016167	3300025941	Bacteria	6194
222	Ga0207711_10016585	3300025941	Bacteria	6116
223	Ga0207689_10004958	3300025942	Bacteria	11987
224	Ga0207661_10136125	3300025944	Bacteria	2110
225	Ga0207712_10000006	3300025961	Bacteria	573204
226	Ga0207712_10005515	3300025961	Bacteria	7981
227	Ga0207712_10011492	3300025961	Bacteria	5642
228	Ga0207668_10002920	3300025972	Bacteria	10027
229	Ga0207668_10083415	3300025972	Bacteria	2325
230	Ga0207668_10259098	3300025972	Bacteria	1416
231	Ga0207668_10421552	3300025972	Bacteria	1133
232	Ga0207640_10196557	3300025981	Bacteria	1525
233	Ga0207658_10000249	3300025986	Bacteria	56248
234	Ga0207658_10002065	3300025986	Bacteria	14940
235	Ga0207658_10025451	3300025986	Bacteria	4144
236	Ga0207658_10055322	3300025986	Bacteria	2940
237	Ga0207658_10413184	3300025986	Bacteria	1188
238	Ga0207677_10007582	3300026023	Bacteria	6019
239	Ga0207703_10022349	3300026035	Bacteria	4960
240	Ga0207639_10018557	3300026041	Bacteria	4945
241	Ga0207639_10232719	3300026041	Bacteria	1598
242	Ga0207678_10226040	3300026067	Bacteria	1602
243	Ga0207708_10024937	3300026075	Bacteria	4524
244	Ga0207702_10172033	3300026078	Bacteria	1987
245	Ga0207641_10003056	3300026088	Bacteria	15083
246	Ga0207641_10011112	3300026088	Bacteria	7386
247	Ga0207648_10008145	3300026089	Bacteria	10193
248	Ga0207676_10244344	3300026095	Bacteria	1612
249	Ga0207675_100001770	3300026118	Bacteria	21580
250	Ga0207675_100034675	3300026118	Bacteria	4706
251	Ga0207675_100394257	3300026118	Bacteria	1363
252	Ga0207683_10000886	3300026121	Bacteria	27514
253	Ga0207698_10437692	3300026142	Bacteria	1259
254	Ga0268266_10009620	3300028379	Bacteria	8501
255	Ga0268266_10016903	3300028379	Bacteria	6233
256	Ga0268266_10023497	3300028379	Bacteria	5249
257	Ga0268265_10000016	3300028380	Bacteria	299380
258	Ga0268264_10000026	3300028381	Bacteria	459088
259	Ga0268264_10002290	3300028381	Bacteria	16957
260	Ga0265327_10002543	3300031251	Bacteria	18976
261	Ga0307413_10010419	3300031824	Bacteria	4509
262	Ga0307410_10173664	3300031852	Bacteria	1626
263	Ga0307406_10101257	3300031901	Bacteria	1963
264	Ga0307407_10003073	3300031903	Bacteria	6736
265	Ga0307409_100028265	3300031995	Bacteria	3991
266	Ga0307409_100399819	3300031995	Bacteria	1312
267	Ga0307416_100036705	3300032002	Bacteria	3762
268	Ga0307415_100044861	3300032126	Bacteria	2959
269	Ga0373932_0024261	3300035112	Bacteria	1631
270	Ga0373941_0065001	3300035115	Bacteria	1197
271	Ga0436364_0153728	3300037853	Bacteria	2803
272	Ga0436364_0849434	3300037853	Bacteria	8305
273	Ga0436364_1374512	3300037853	Bacteria	4248
274	Ga0436365_0233085	3300039437	Bacteria	55703
275	Ga0436365_1138315	3300039437	Bacteria	15926
276	Ga0436365_1274540	3300039437	Bacteria	44756
277	Ga0436365_1318036	3300039437	Bacteria	7588
278	Ga0436360_0161687	3300039438	Bacteria	1689
279	Ga0436360_1324365	3300039438	Bacteria	2363
280	Ga0436363_0218180	3300039450	Bacteria	1833
281	Ga0436363_0826660	3300039450	Bacteria	5861
282	Ga0436363_1132585	3300039450	Bacteria	1062
283	Ga0439461_0011071	3300041410	Bacteria	1668
284	Ga0439466_0015911	3300041411	Bacteria	2728
285	Ga0439465_0002062	3300041413	Bacteria	6587
286	Ga0439465_0031974	3300041413	Bacteria	1678
287	Ga0451793_0844185	3300041452	Bacteria	3771
288	Ga0451795_1582305	3300041456	Bacteria	1514
289	Ga0451802_1306544	3300041460	Bacteria	1550
290	Ga0439431_0034483	3300041997	Bacteria	1269
291	Ga0439442_028033	3300042002	Bacteria	1174
292	Ga0439445_0001143	3300042004	Bacteria	5690
293	Ga0439445_0016058	3300042004	Bacteria	1839
294	Ga0439448_0005915	3300042005	Bacteria	3499
295	Ga0439450_007366	3300042008	Bacteria	2014
296	Ga0439434_0004287	3300042435	Bacteria	4168
297	Ga0466972_0014572	3300044658	Bacteria	3936
298	Ga0466972_0053055	3300044658	Bacteria	1953
299	Ga0466965_0001494	3300044683	Bacteria	9475
300	Ga0466965_0015309	3300044683	Bacteria	3643
301	Ga0466966_0002634	3300044684	Bacteria	11752
302	Ga0466966_0004859	3300044684	Bacteria	8841
303	Ga0466961_0006557	3300044693	Bacteria	7397
304	Ga0466961_0039058	3300044693	Bacteria	3043
305	Ga0466961_0104208	3300044693	Bacteria	1786
306	Ga0466963_0071391	3300044694	Bacteria	2337
307	Ga0466963_0342704	3300044694	Bacteria	1052
308	Ga0466971_0020876	3300044719	Bacteria	2911
309	Ga0466971_0025522	3300044719	Bacteria	2639
310	Ga0466971_0110562	3300044719	Bacteria	1268
311	Ga0466968_0001683	3300044735	Bacteria	7965
312	Ga0466968_0004897	3300044735	Bacteria	5010
313	Ga0466968_0029216	3300044735	Bacteria	2279
314	Ga0466970_0006422	3300044765	Bacteria	5879
315	Ga0466970_0019897	3300044765	Bacteria	3483
316	Ga0466970_0034382	3300044765	Bacteria	2682
317	Ga0466957_0001371	3300044842	Bacteria	12717
318	Ga0466957_0004117	3300044842	Bacteria	8056
319	Ga0466957_0090628	3300044842	Bacteria	1915
320	Ga0466957_0101313	3300044842	Bacteria	1816
321	Ga0466960_0000160	3300044901	Bacteria	22849
322	Ga0466960_0000261	3300044901	Bacteria	18170
323	Ga0466960_0021402	3300044901	Bacteria	2878
324	Ga0466959_0000940	3300045049	Bacteria	17285
325	Ga0466959_0014091	3300045049	Bacteria	5804
326	Ga0466959_0014094	3300045049	Bacteria	5801
327	Ga0466958_0009417	3300045836	Bacteria	5443
328	Ga0466958_0020975	3300045836	Bacteria	3814
329	Ga0466958_0059965	3300045836	Bacteria	2316
330	Ga0466967_0018135	3300045976	Bacteria	5615
331	Ga0466967_0027971	3300045976	Bacteria	4699
332	Ga0466967_0052079	3300045976	Bacteria	3591
333	Ga0466967_0060875	3300045976	Bacteria	3348
334	Ga0466967_0087792	3300045976	Bacteria	2820
335	Ga0466967_0547914	3300045976	Bacteria	1138
336	Ga0495629_0015212	3300046459	Bacteria	5529
337	Ga0495638_0018325	3300046460	Bacteria	4651
338	Ga0495662_0102430	3300046476	Bacteria	1401
339	Ga0495583_0028356	3300046506	Bacteria	2754
340	Ga0495606_0039006	3300046507	Bacteria	3208
341	Ga0495648_0003152	3300046524	Bacteria	14671
342	Ga0495640_0020023	3300046533	Bacteria	4932
343	Ga0495668_0006910	3300046616	Bacteria	7347
344	Ga0495624_0034170	3300046690	Bacteria	3291
345	Ga0495672_0000716	3300047320	Bacteria	36436
346	Ga0495676_0199897	3300047321	Bacteria	1389
347	Ga0495673_0000337	3300047469	Bacteria	60179
348	Ga0495686_0018497	3300047472	Bacteria	4673
349	Ga0496100_0000060	3300048903	Bacteria	64789
350	Ga0496100_0000571	3300048903	Bacteria	17512
351	Ga0496100_0000643	3300048903	Bacteria	16574
352	Ga0496100_0003615	3300048903	Bacteria	8074
353	Ga0496101_0000046	3300048904	Bacteria	155997
354	Ga0496101_0000116	3300048904	Bacteria	78303
355	Ga0496101_0001312	3300048904	Bacteria	14867
356	Ga0496101_0003049	3300048904	Bacteria	10337
357	Ga0496101_0003626	3300048904	Bacteria	9639
358	Ga0496101_0018333	3300048904	Bacteria	4758
359	Ga0496101_0176908	3300048904	Bacteria	1642
360	Ga0496102_0000025	3300048905	Bacteria	227201
361	Ga0496102_0000124	3300048905	Bacteria	110030
362	Ga0496102_0001287	3300048905	Bacteria	22607
363	Ga0496102_0007868	3300048905	Bacteria	9108
364	Ga0496102_0493721	3300048905	Bacteria	1146
365	Ga0496103_0000022	3300048906	Bacteria	227208
366	Ga0496103_0000560	3300048906	Bacteria	29543
367	Ga0496103_0000933	3300048906	Bacteria	20968
368	Ga0496103_0004044	3300048906	Bacteria	8913
369	Ga0496103_0033652	3300048906	Bacteria	3131
370	Ga0496104_0003506	3300048907	Bacteria	13533
371	Ga0496104_0011118	3300048907	Bacteria	8054
372	Ga0496105_0001389	3300048908	Bacteria	16994
373	Ga0496105_0029839	3300048908	Bacteria	4465
374	Ga0496106_0002145	3300048909	Bacteria	14735
375	Ga0496106_0002275	3300048909	Bacteria	14321
376	Ga0496106_0003171	3300048909	Bacteria	12290
377	Ga0496106_0003263	3300048909	Bacteria	12136
378	Ga0496106_0266520	3300048909	Bacteria	1371
379	Ga0496106_0427763	3300048909	Bacteria	1064
380	Ga0496107_0000786	3300048910	Bacteria	18338
381	Ga0496107_0000917	3300048910	Bacteria	17358
382	Ga0496107_0001093	3300048910	Bacteria	16305
383	Ga0496107_0040244	3300048910	Bacteria	3355
384	Ga0496107_0051819	3300048910	Bacteria	2961
385	Ga0496107_0189061	3300048910	Bacteria	1530
386	Ga0496107_0211737	3300048910	Bacteria	1441
387	Ga0496108_0006082	3300048911	Bacteria	9760
388	Ga0496108_0013527	3300048911	Bacteria	6660
389	Ga0496108_0016072	3300048911	Bacteria	6102
390	Ga0496108_0033443	3300048911	Bacteria	4272
391	Ga0496108_0137634	3300048911	Bacteria	2102
392	Ga0496109_0000829	3300048912	Bacteria	25810
393	Ga0496109_0005081	3300048912	Bacteria	10993
394	Ga0496109_0028785	3300048912	Bacteria	4972
395	Ga0496110_0001604	3300048913	Bacteria	16547
396	Ga0496110_0003811	3300048913	Bacteria	11622
397	Ga0496110_0071874	3300048913	Bacteria	3069
398	Ga0496111_0193471	3300048914	Bacteria	1512
399	Ga0496112_0007475	3300048915	Bacteria	9698
400	Ga0496112_0010248	3300048915	Bacteria	8496
401	Ga0496112_0022384	3300048915	Bacteria	6024
402	Ga0496112_0345862	3300048915	Bacteria	1430
403	Ga0496113_0012631	3300048916	Bacteria	5683
404	Ga0496113_0214627	3300048916	Bacteria	1532
405	Ga0496113_0307745	3300048916	Bacteria	1269
406	Ga0496114_0000215	3300048917	Bacteria	42076
407	Ga0496114_0002963	3300048917	Bacteria	13019
408	Ga0496114_0092849	3300048917	Bacteria	2565
409	Ga0496115_0003338	3300048918	Bacteria	11517
410	Ga0496115_0009385	3300048918	Bacteria	7270
411	Ga0496115_0291487	3300048918	Bacteria	1339
412	Ga0496116_0000059	3300048919	Bacteria	274491
413	Ga0496116_0001159	3300048919	Bacteria	31113
414	Ga0496116_0005941	3300048919	Bacteria	11191
415	Ga0496117_0000055	3300048920	Bacteria	274518
416	Ga0496117_0000496	3300048920	Bacteria	64935
417	Ga0496117_0011200	3300048920	Bacteria	8052
418	Ga0496117_0050660	3300048920	Bacteria	2943
419	Ga0496118_0000058	3300048921	Bacteria	227245
420	Ga0496118_0001104	3300048921	Bacteria	41942
421	Ga0496118_0001433	3300048921	Bacteria	35920
422	Ga0496118_0007845	3300048921	Bacteria	11191
423	Ga0496119_0001302	3300048922	Bacteria	30815
424	Ga0496119_0004905	3300048922	Bacteria	13084
425	Ga0496119_0049812	3300048922	Bacteria	2586
426	Ga0496121_0000016	3300048924	Bacteria	562911
427	Ga0496121_0000113	3300048924	Bacteria	181807
428	Ga0496121_0020229	3300048924	Bacteria	6602
429	Ga0496122_0000250	3300048925	Bacteria	121043
430	Ga0496122_0058663	3300048925	Bacteria	2846
431	Ga0496123_0005844	3300048926	Bacteria	12194
432	Ga0496123_0046889	3300048926	Bacteria	2925
433	Ga0496124_0000015	3300048927	Bacteria	460700
434	Ga0496124_0087276	3300048927	Bacteria	2551
435	Ga0496125_0000021	3300048928	Bacteria	460688
436	Ga0496126_0000015	3300048929	Bacteria	663212
437	Ga0496126_0003135	3300048929	Bacteria	21318
438	Ga0496126_0008410	3300048929	Bacteria	11133
439	Ga0496126_0008876	3300048929	Bacteria	10771
440	Ga0496126_0010978	3300048929	Bacteria	9428
441	Ga0501032_0005484	3300049569	Bacteria	9412
442	Ga0501032_0027257	3300049569	Bacteria	3927
443	Ga0501033_0315628	3300049570	Bacteria	1098
444	Ga0501034_0016788	3300049571	Bacteria	7506
445	Ga0501034_0041046	3300049571	Bacteria	4681
446	Ga0501034_0326396	3300049571	Bacteria	1467
447	Ga0501036_0048720	3300049572	Bacteria	3587
448	Ga0501037_0000060	3300049573	Bacteria	100831
449	Ga0501037_0290120	3300049573	Bacteria	1138
450	Ga0501038_0005039	3300049574	Bacteria	12272
451	Ga0501039_0000956	3300049575	Bacteria	21028
452	Ga0501043_0001080	3300049579	Bacteria	23972
453	Ga0501043_0447808	3300049579	Bacteria	971
454	Ga0501046_0013438	3300049580	Bacteria	6931
455	Ga0501048_0001407	3300049582	Bacteria	18259
456	Ga0501069_0031838	3300049585	Bacteria	2903
457	Ga0501070_0006373	3300049586	Bacteria	10043
458	Ga0501070_0016402	3300049586	Bacteria	6223
459	Ga0501073_0131093	3300049589	Bacteria	1738
460	Ga0501035_0000279	3300049822	Bacteria	60584
461	Ga0501035_0008277	3300049822	Bacteria	9691
462	Ga0501044_0000637	3300049823	Bacteria	42365
463	Ga0501044_0007594	3300049823	Bacteria	11919
464	Ga0501044_0084157	3300049823	Bacteria	3215
465	nmdc:mga03683_10321_c1	3300050489	Bacteria	3347
466	nmdc:mga03n38_106388_c1	3300050490	Bacteria	1360
467	nmdc:mga03n38_206432_c1	3300050490	Bacteria	1019
468	nmdc:mga03n38_249969_c1	3300050490	Bacteria	936
469	nmdc:mga03n38_35411_c1	3300050490	Bacteria	2138
470	nmdc:mga03n38_636_c1	3300050490	Bacteria	9001
471	nmdc:mga03n38_8175_c1	3300050490	Bacteria	3741
472	nmdc:mga00v17_1056_c1	3300050491	Bacteria	14539
473	nmdc:mga00v17_131512_c1	3300050491	Bacteria	1600
474	nmdc:mga00v17_144985_c1	3300050491	Bacteria	1524
475	nmdc:mga00v17_260053_c1	3300050491	Bacteria	1126
476	nmdc:mga00v17_61135_c1	3300050491	Bacteria	2315
477	nmdc:mga0yw44_127764_c1	3300050492	Bacteria	1643
478	nmdc:mga0yw44_86208_c1	3300050492	Bacteria	1977
479	nmdc:mga06z11_200287_c1	3300050494	Bacteria	1159
480	nmdc:mga04h51_96381_c1	3300050495	Bacteria	1072
481	nmdc:mga07m45_115586_c1	3300050496	Bacteria	1547
482	nmdc:mga07m45_13669_c1	3300050496	Bacteria	4311
483	nmdc:mga07m45_163379_c1	3300050496	Bacteria	1293
484	nmdc:mga07m45_6402_c2	3300050496	Bacteria	1389
485	nmdc:mga07m45_9478_c1	3300050496	Bacteria	5053
486	nmdc:mga07m45_97741_c1	3300050496	Bacteria	1685
487	nmdc:mga05p37_29305_c2	3300050507	Bacteria	4973
488	nmdc:mga0qj67_10438_c1	3300050509	Bacteria	6939
489	nmdc:mga0qj67_3816_c1	3300050509	Bacteria	10887
490	nmdc:mga08y16_392106_c1	3300050511	Bacteria	1422
491	nmdc:mga0sz30_18946_c1	3300050516	Bacteria	2759
492	nmdc:mga0sz30_21602_c1	3300050516	Bacteria	2606
493	nmdc:mga0sz30_3408_c2	3300050516	Bacteria	5417
494	nmdc:mga0sz30_38091_c1	3300050516	Bacteria	1527
495	nmdc:mga0sz30_61899_c1	3300050516	Bacteria	1600
496	nmdc:mga0sz30_6691_c2	3300050516	Bacteria	3045
497	nmdc:mga0sz30_898_c1	3300050516	Bacteria	10713
498	Ga0500635_0006433	3300053080	Bacteria	3137
499	Ga0495619_0326993	3300053085	Bacteria	1061
500	Ga0500643_003541	3300053087	Bacteria	7442
501	Ga0500646_0045617	3300053090	Bacteria	1248
502	Ga0500604_0062636	3300053151	Bacteria	1171
503	Ga0466962_0048160	3300061719	Bacteria	2037

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300041456	Ga0451795_1582305	Ga0451795_1582305_234_1013	245
2	3300021384	Ga0213876_10015377	Ga0213876_100153774	248
3	3300039437	Ga0436365_1274540	Ga0436365_1274540_8276_9151	248
4	3300003792	Ga0055540_1000979	Ga0055540_10009794	250
5	3300005364	Ga0070673_100472689	Ga0070673_1004726892	250
6	3300005441	Ga0070700_100153025	Ga0070700_1001530252	250
7	3300005456	Ga0070678_100153696	Ga0070678_1001536962	250
8	3300005466	Ga0070685_10155837	Ga0070685_101558372	250
9	3300005539	Ga0068853_100184411	Ga0068853_1001844112	250
10	3300005843	Ga0068860_100051465	Ga0068860_1000514653	250
11	3300006186	Ga0075369_10015693	Ga0075369_100156932	250
12	3300025273	Ga0209673_1013712	Ga0209673_10137123	250
13	3300025303	Ga0209051_1002280	Ga0209051_100228011	250
14	3300050490	nmdc:mga03n38_249969_c1	nmdc:mga03n38_249969_c1_32_793	250
15	3300050496	nmdc:mga07m45_115586_c1	nmdc:mga07m45_115586_c1_537_1295	250
16	3300050516	nmdc:mga0sz30_21602_c1	nmdc:mga0sz30_21602_c1_702_1460	250
17	3300039450	Ga0436363_0826660	Ga0436363_0826660_3730_4581	253
18	3300050491	nmdc:mga00v17_260053_c1	nmdc:mga00v17_260053_c1_137_997	253
19	3300003792	Ga0055540_1000348	Ga0055540_10003485	254
20	3300006042	Ga0075368_10017658	Ga0075368_100176582	254
21	3300006048	Ga0075363_100000835	Ga0075363_1000008354	254
22	3300006048	Ga0075363_100004565	Ga0075363_1000045655	254
23	3300006048	Ga0075363_100012423	Ga0075363_1000124233	254
24	3300006048	Ga0075363_100055772	Ga0075363_1000557722	254
25	3300006051	Ga0075364_10004783	Ga0075364_100047832	254
26	3300006051	Ga0075364_10148739	Ga0075364_101487392	254
27	3300006177	Ga0075362_10054124	Ga0075362_100541242	254
28	3300006178	Ga0075367_10032377	Ga0075367_100323773	254
29	3300006178	Ga0075367_10200457	Ga0075367_102004572	254
30	3300006186	Ga0075369_10004296	Ga0075369_100042963	254
31	3300006186	Ga0075369_10053400	Ga0075369_100534003	254
32	3300006353	Ga0075370_10004579	Ga0075370_100045794	254
33	3300006353	Ga0075370_10008681	Ga0075370_100086814	254
34	3300006353	Ga0075370_10146886	Ga0075370_101468862	254
35	3300006353	Ga0075370_10216941	Ga0075370_102169411	254
36	3300025303	Ga0209051_1000011	Ga0209051_1000011104	254
37	3300025986	Ga0207658_10002065	Ga0207658_100020659	254
38	3300031251	Ga0265327_10002543	Ga0265327_100025434	254
39	3300031852	Ga0307410_10173664	Ga0307410_101736642	254
40	3300031995	Ga0307409_100399819	Ga0307409_1003998192	254
41	3300042005	Ga0439448_0005915	Ga0439448_0005915_593_1453	254
42	3300045976	Ga0466967_0547914	Ga0466967_0547914_52_912	254
43	3300048903	Ga0496100_0000060	Ga0496100_0000060_45400_46260	254
44	3300048904	Ga0496101_0000116	Ga0496101_0000116_44300_45160	254
45	3300048905	Ga0496102_0001287	Ga0496102_0001287_1041_1901	254
46	3300048906	Ga0496103_0000933	Ga0496103_0000933_8376_9236	254
47	3300048909	Ga0496106_0002145	Ga0496106_0002145_7483_8343	254
48	3300048910	Ga0496107_0001093	Ga0496107_0001093_3775_4635	254
49	3300048911	Ga0496108_0013527	Ga0496108_0013527_5036_5896	254
50	3300048912	Ga0496109_0000829	Ga0496109_0000829_22572_23432	254
51	3300048913	Ga0496110_0001604	Ga0496110_0001604_14763_15623	254
52	3300048916	Ga0496113_0307745	Ga0496113_0307745_81_941	254
53	3300048919	Ga0496116_0005941	Ga0496116_0005941_9971_10831	254
54	3300048920	Ga0496117_0011200	Ga0496117_0011200_489_1349	254
55	3300048921	Ga0496118_0007845	Ga0496118_0007845_9971_10831	254
56	3300048922	Ga0496119_0001302	Ga0496119_0001302_26490_27350	254
57	3300048924	Ga0496121_0000016	Ga0496121_0000016_16422_17282	254
58	3300048925	Ga0496122_0000250	Ga0496122_0000250_70463_71323	254
59	3300048926	Ga0496123_0005844	Ga0496123_0005844_6468_7328	254
60	3300048927	Ga0496124_0000015	Ga0496124_0000015_361108_361968	254
61	3300048928	Ga0496125_0000021	Ga0496125_0000021_98733_99593	254
62	3300048929	Ga0496126_0000015	Ga0496126_0000015_98733_99593	254
63	3300050490	nmdc:mga03n38_206432_c1	nmdc:mga03n38_206432_c1_42_887	254
64	3300050490	nmdc:mga03n38_35411_c1	nmdc:mga03n38_35411_c1_1108_1965	254
65	3300050490	nmdc:mga03n38_636_c1	nmdc:mga03n38_636_c1_4137_4997	254
66	3300050490	nmdc:mga03n38_8175_c1	nmdc:mga03n38_8175_c1_446_1306	254
67	3300050491	nmdc:mga00v17_131512_c1	nmdc:mga00v17_131512_c1_404_1264	254
68	3300050491	nmdc:mga00v17_144985_c1	nmdc:mga00v17_144985_c1_253_1146	254
69	3300050492	nmdc:mga0yw44_127764_c1	nmdc:mga0yw44_127764_c1_470_1330	254
70	3300050494	nmdc:mga06z11_200287_c1	nmdc:mga06z11_200287_c1_161_1021	254
71	3300050496	nmdc:mga07m45_6402_c2	nmdc:mga07m45_6402_c2_51_944	254
72	3300050496	nmdc:mga07m45_97741_c1	nmdc:mga07m45_97741_c1_330_1190	254
73	3300050516	nmdc:mga0sz30_38091_c1	nmdc:mga0sz30_38091_c1_456_1316	254
74	3300050516	nmdc:mga0sz30_61899_c1	nmdc:mga0sz30_61899_c1_696_1541	254
75	3300050516	nmdc:mga0sz30_898_c1	nmdc:mga0sz30_898_c1_4315_5202	254
76	iso_pu_bacteria	2738541264	2738665067	254
77	iso_pu_bacteria	2738541356	2739144201	254
78	3300005337	Ga0070682_100002878	Ga0070682_1000028782	255
79	3300005455	Ga0070663_100192415	Ga0070663_1001924152	255
80	3300006048	Ga0075363_100133619	Ga0075363_1001336192	255
81	3300006051	Ga0075364_10137988	Ga0075364_101379882	255
82	3300009098	Ga0105245_10049277	Ga0105245_100492772	255
83	3300009177	Ga0105248_10690368	Ga0105248_106903682	255
84	3300014325	Ga0163163_10278444	Ga0163163_102784442	255
85	3300025944	Ga0207661_10136125	Ga0207661_101361252	255
86	3300025981	Ga0207640_10196557	Ga0207640_101965572	255
87	3300026067	Ga0207678_10226040	Ga0207678_102260402	255
88	3300031901	Ga0307406_10101257	Ga0307406_101012572	255
89	3300041411	Ga0439466_0015911	Ga0439466_0015911_555_1418	255
90	3300042004	Ga0439445_0001143	Ga0439445_0001143_811_1674	255
91	3300042435	Ga0439434_0004287	Ga0439434_0004287_1517_2380	255
92	3300044658	Ga0466972_0014572	Ga0466972_0014572_923_1786	255
93	3300044683	Ga0466965_0015309	Ga0466965_0015309_2650_3513	255
94	3300044684	Ga0466966_0002634	Ga0466966_0002634_2898_3755	255
95	3300044693	Ga0466961_0006557	Ga0466961_0006557_3481_4338	255
96	3300044735	Ga0466968_0001683	Ga0466968_0001683_4363_5226	255
97	3300044735	Ga0466968_0029216	Ga0466968_0029216_759_1616	255
98	3300044765	Ga0466970_0034382	Ga0466970_0034382_1689_2552	255
99	3300044842	Ga0466957_0001371	Ga0466957_0001371_9547_10404	255
100	3300044901	Ga0466960_0021402	Ga0466960_0021402_691_1554	255
101	3300045049	Ga0466959_0014091	Ga0466959_0014091_908_1771	255
102	3300045049	Ga0466959_0014094	Ga0466959_0014094_669_1526	255
103	3300045836	Ga0466958_0009417	Ga0466958_0009417_923_1780	255
104	3300045976	Ga0466967_0052079	Ga0466967_0052079_1397_2296	255
105	3300048904	Ga0496101_0018333	Ga0496101_0018333_1823_2686	255
106	3300048910	Ga0496107_0189061	Ga0496107_0189061_18_881	255
107	3300048911	Ga0496108_0033443	Ga0496108_0033443_698_1561	255
108	3300048912	Ga0496109_0028785	Ga0496109_0028785_1985_2848	255
109	3300048914	Ga0496111_0193471	Ga0496111_0193471_316_1179	255
110	3300048915	Ga0496112_0022384	Ga0496112_0022384_4530_5393	255
111	3300048916	Ga0496113_0012631	Ga0496113_0012631_4305_5168	255
112	3300048925	Ga0496122_0058663	Ga0496122_0058663_1768_2631	255
113	3300048926	Ga0496123_0046889	Ga0496123_0046889_1547_2410	255
114	3300048929	Ga0496126_0008410	Ga0496126_0008410_1506_2369	255
115	iso_pu_bacteria	2842134933	2842137725	255
116	iso_pu_bacteria	2902810491	2902812900	255
117	iso_pu_bacteria	2929212328	2929215543	255
118	3300005353	Ga0070669_100007362	Ga0070669_1000073624	256
119	3300005367	Ga0070667_100000171	Ga0070667_1000001714	256
120	3300005539	Ga0068853_100074180	Ga0068853_1000741803	256
121	3300005548	Ga0070665_100015519	Ga0070665_1000155196	256
122	3300005617	Ga0068859_100006068	Ga0068859_1000060684	256
123	3300005841	Ga0068863_100005765	Ga0068863_10000576512	256
124	3300005842	Ga0068858_100031466	Ga0068858_1000314663	256
125	3300005843	Ga0068860_100000112	Ga0068860_100000112107	256
126	3300005844	Ga0068862_100000012	Ga0068862_10000001278	256
127	3300006173	Ga0070716_100124878	Ga0070716_1001248782	256
128	3300006931	Ga0097620_100006068	Ga0097620_1000060684	256
129	3300009093	Ga0105240_10425927	Ga0105240_104259272	256
130	3300009094	Ga0111539_10149305	Ga0111539_101493052	256
131	3300009101	Ga0105247_10000007	Ga0105247_10000007101	256
132	3300009177	Ga0105248_10000254	Ga0105248_100002549	256
133	3300009553	Ga0105249_10000001	Ga0105249_10000001384	256
134	3300013306	Ga0163162_10009651	Ga0163162_100096516	256
135	3300014325	Ga0163163_10063325	Ga0163163_100633252	256
136	3300014968	Ga0157379_10058938	Ga0157379_100589382	256
137	3300025900	Ga0207710_10000013	Ga0207710_10000013101	256
138	3300025916	Ga0207663_10141278	Ga0207663_101412782	256
139	3300025928	Ga0207700_10142471	Ga0207700_101424711	256
140	3300025939	Ga0207665_10277375	Ga0207665_102773752	256
141	3300025941	Ga0207711_10000509	Ga0207711_1000050911	256
142	3300025961	Ga0207712_10000006	Ga0207712_10000006107	256
143	3300025986	Ga0207658_10000249	Ga0207658_100002494	256
144	3300026035	Ga0207703_10022349	Ga0207703_100223493	256
145	3300026041	Ga0207639_10232719	Ga0207639_102327192	256
146	3300026088	Ga0207641_10003056	Ga0207641_1000305613	256
147	3300028379	Ga0268266_10016903	Ga0268266_100169032	256
148	3300028380	Ga0268265_10000016	Ga0268265_10000016103	256
149	3300028381	Ga0268264_10000026	Ga0268264_10000026105	256
150	3300039437	Ga0436365_1138315	Ga0436365_1138315_4854_5738	256
151	3300039438	Ga0436360_0161687	Ga0436360_0161687_801_1643	256
152	3300044683	Ga0466965_0001494	Ga0466965_0001494_1312_2178	256
153	3300044901	Ga0466960_0000261	Ga0466960_0000261_12257_13123	256
154	3300047472	Ga0495686_0018497	Ga0495686_0018497_2888_3751	256
155	3300048903	Ga0496100_0003615	Ga0496100_0003615_3772_4638	256
156	3300048904	Ga0496101_0003626	Ga0496101_0003626_728_1594	256
157	3300048905	Ga0496102_0000124	Ga0496102_0000124_93633_94499	256
158	3300048906	Ga0496103_0000560	Ga0496103_0000560_17620_18486	256
159	3300048909	Ga0496106_0266520	Ga0496106_0266520_466_1335	256
160	3300048910	Ga0496107_0211737	Ga0496107_0211737_305_1171	256
161	3300048919	Ga0496116_0001159	Ga0496116_0001159_1681_2547	256
162	3300048920	Ga0496117_0000496	Ga0496117_0000496_23983_24849	256
163	3300048921	Ga0496118_0001104	Ga0496118_0001104_30038_30904	256
164	3300048922	Ga0496119_0049812	Ga0496119_0049812_1655_2521	256
165	3300048924	Ga0496121_0020229	Ga0496121_0020229_1237_2103	256
166	3300048927	Ga0496124_0087276	Ga0496124_0087276_1214_2080	256
167	3300048929	Ga0496126_0008876	Ga0496126_0008876_7884_8750	256
168	3300049569	Ga0501032_0005484	Ga0501032_0005484_5932_6798	256
169	3300049569	Ga0501032_0027257	Ga0501032_0027257_2413_3273	256
170	3300049570	Ga0501033_0315628	Ga0501033_0315628_169_1029	256
171	3300049571	Ga0501034_0016788	Ga0501034_0016788_4329_5195	256
172	3300049572	Ga0501036_0048720	Ga0501036_0048720_49_915	256
173	3300049573	Ga0501037_0000060	Ga0501037_0000060_15844_16710	256
174	3300049573	Ga0501037_0290120	Ga0501037_0290120_81_941	256
175	3300049574	Ga0501038_0005039	Ga0501038_0005039_9465_10331	256
176	3300049575	Ga0501039_0000956	Ga0501039_0000956_15486_16352	256
177	3300049579	Ga0501043_0001080	Ga0501043_0001080_11578_12444	256
178	3300049579	Ga0501043_0447808	Ga0501043_0447808_87_947	256
179	3300049586	Ga0501070_0006373	Ga0501070_0006373_9166_10032	256
180	3300049822	Ga0501035_0000279	Ga0501035_0000279_22358_23218	256
181	3300049823	Ga0501044_0000637	Ga0501044_0000637_11779_12639	256
182	3300050489	nmdc:mga03683_10321_c1	nmdc:mga03683_10321_c1_589_1458	256
183	3300053080	Ga0500635_0006433	Ga0500635_0006433_782_1648	256
184	3300053090	Ga0500646_0045617	Ga0500646_0045617_187_1053	256
185	iso_pu_bacteria	2939582691	2939588142	256
186	3300001977	JGI24746J21847_1000920	JGI24746J21847_10009204	257
187	3300001989	JGI24739J22299_10052682	JGI24739J22299_100526822	257
188	3300002075	JGI24738J21930_10008810	JGI24738J21930_100088102	257
189	3300002077	JGI24744J21845_10000225	JGI24744J21845_100002254	257
190	3300002077	JGI24744J21845_10005550	JGI24744J21845_100055501	257
191	3300002244	JGI24742J22300_10001302	JGI24742J22300_100013023	257
192	3300003792	Ga0055540_1004379	Ga0055540_10043792	257
193	3300003792	Ga0055540_1013873	Ga0055540_10138733	257
194	3300005328	Ga0070676_10011866	Ga0070676_100118662	257
195	3300005330	Ga0070690_100016144	Ga0070690_1000161442	257
196	3300005334	Ga0068869_100012086	Ga0068869_1000120862	257
197	3300005335	Ga0070666_10046445	Ga0070666_100464453	257
198	3300005337	Ga0070682_100104499	Ga0070682_1001044992	257
199	3300005338	Ga0068868_100002357	Ga0068868_1000023575	257
200	3300005340	Ga0070689_100085258	Ga0070689_1000852582	257
201	3300005341	Ga0070691_10002109	Ga0070691_100021095	257
202	3300005347	Ga0070668_100006073	Ga0070668_1000060732	257
203	3300005347	Ga0070668_100007314	Ga0070668_1000073142	257
204	3300005347	Ga0070668_100041422	Ga0070668_1000414222	257
205	3300005355	Ga0070671_100005971	Ga0070671_1000059714	257
206	3300005355	Ga0070671_100093704	Ga0070671_1000937042	257
207	3300005355	Ga0070671_100188918	Ga0070671_1001889181	257
208	3300005356	Ga0070674_100000947	Ga0070674_10000094713	257
209	3300005356	Ga0070674_100040274	Ga0070674_1000402743	257
210	3300005365	Ga0070688_100011238	Ga0070688_1000112383	257
211	3300005367	Ga0070667_100004215	Ga0070667_1000042156	257
212	3300005367	Ga0070667_100093099	Ga0070667_1000930992	257
213	3300005367	Ga0070667_100199435	Ga0070667_1001994352	257
214	3300005367	Ga0070667_100454169	Ga0070667_1004541691	257
215	3300005434	Ga0070709_10082071	Ga0070709_100820712	257
216	3300005435	Ga0070714_100097230	Ga0070714_1000972301	257
217	3300005437	Ga0070710_10001153	Ga0070710_100011532	257
218	3300005438	Ga0070701_10000735	Ga0070701_100007357	257
219	3300005438	Ga0070701_10027655	Ga0070701_100276552	257
220	3300005439	Ga0070711_100000535	Ga0070711_1000005357	257
221	3300005439	Ga0070711_100217966	Ga0070711_1002179662	257
222	3300005441	Ga0070700_100000769	Ga0070700_10000076912	257
223	3300005444	Ga0070694_100083353	Ga0070694_1000833532	257
224	3300005456	Ga0070678_100000761	Ga0070678_1000007618	257
225	3300005457	Ga0070662_100008069	Ga0070662_1000080693	257
226	3300005459	Ga0068867_100004245	Ga0068867_1000042457	257
227	3300005466	Ga0070685_10114430	Ga0070685_101144302	257
228	3300005539	Ga0068853_100009937	Ga0068853_1000099372	257
229	3300005543	Ga0070672_100459244	Ga0070672_1004592441	257
230	3300005544	Ga0070686_100038333	Ga0070686_1000383331	257
231	3300005545	Ga0070695_100009864	Ga0070695_1000098643	257
232	3300005546	Ga0070696_100400451	Ga0070696_1004004511	257
233	3300005547	Ga0070693_100021021	Ga0070693_1000210214	257
234	3300005548	Ga0070665_100007339	Ga0070665_1000073392	257
235	3300005548	Ga0070665_100023444	Ga0070665_1000234443	257
236	3300005549	Ga0070704_100000119	Ga0070704_1000001198	257
237	3300005578	Ga0068854_100003142	Ga0068854_1000031427	257
238	3300005614	Ga0068856_100313571	Ga0068856_1003135712	257
239	3300005615	Ga0070702_100110274	Ga0070702_1001102742	257
240	3300005616	Ga0068852_100203839	Ga0068852_1002038392	257
241	3300005617	Ga0068859_100001666	Ga0068859_1000016668	257
242	3300005618	Ga0068864_100295592	Ga0068864_1002955922	257
243	3300005718	Ga0068866_10000444	Ga0068866_100004448	257
244	3300005719	Ga0068861_100000376	Ga0068861_10000037620	257
245	3300005719	Ga0068861_100435877	Ga0068861_1004358771	257
246	3300005841	Ga0068863_100008304	Ga0068863_1000083046	257
247	3300005841	Ga0068863_100174939	Ga0068863_1001749392	257
248	3300005842	Ga0068858_100011529	Ga0068858_1000115295	257
249	3300005843	Ga0068860_100001509	Ga0068860_10000150919	257
250	3300005844	Ga0068862_100002023	Ga0068862_1000020238	257
251	3300005937	Ga0081455_10023972	Ga0081455_100239724	257
252	3300005937	Ga0081455_10057728	Ga0081455_100577283	257
253	3300005937	Ga0081455_10140304	Ga0081455_101403042	257
254	3300006028	Ga0070717_10347310	Ga0070717_103473101	257
255	3300006038	Ga0075365_10007871	Ga0075365_100078714	257
256	3300006048	Ga0075363_100001686	Ga0075363_1000016861	257
257	3300006048	Ga0075363_100026568	Ga0075363_1000265684	257
258	3300006048	Ga0075363_100094236	Ga0075363_1000942362	257
259	3300006051	Ga0075364_10001802	Ga0075364_100018023	257
260	3300006051	Ga0075364_10028399	Ga0075364_100283992	257
261	3300006163	Ga0070715_10004585	Ga0070715_100045854	257
262	3300006163	Ga0070715_10040592	Ga0070715_100405921	257
263	3300006173	Ga0070716_100000695	Ga0070716_10000069513	257
264	3300006173	Ga0070716_100311882	Ga0070716_1003118822	257
265	3300006175	Ga0070712_100001936	Ga0070712_1000019365	257
266	3300006175	Ga0070712_100431776	Ga0070712_1004317761	257
267	3300006177	Ga0075362_10160544	Ga0075362_101605441	257
268	3300006186	Ga0075369_10000634	Ga0075369_100006344	257
269	3300006186	Ga0075369_10006414	Ga0075369_100064143	257
270	3300006186	Ga0075369_10013542	Ga0075369_100135421	257
271	3300006186	Ga0075369_10049384	Ga0075369_100493843	257
272	3300006186	Ga0075369_10094717	Ga0075369_100947172	257
273	3300006237	Ga0097621_100048326	Ga0097621_1000483264	257
274	3300006353	Ga0075370_10056806	Ga0075370_100568062	257
275	3300006358	Ga0068871_100064292	Ga0068871_1000642922	257
276	3300006358	Ga0068871_100114850	Ga0068871_1001148502	257
277	3300006844	Ga0075428_100007778	Ga0075428_1000077787	257
278	3300006846	Ga0075430_100011360	Ga0075430_1000113604	257
279	3300006846	Ga0075430_100095489	Ga0075430_1000954892	257
280	3300006881	Ga0068865_100001291	Ga0068865_1000012914	257
281	3300006881	Ga0068865_100067642	Ga0068865_1000676422	257
282	3300006931	Ga0097620_100001666	Ga0097620_10000166611	257
283	3300009092	Ga0105250_10025504	Ga0105250_100255043	257
284	3300009098	Ga0105245_10009801	Ga0105245_100098017	257
285	3300009098	Ga0105245_10226522	Ga0105245_102265221	257
286	3300009101	Ga0105247_10005110	Ga0105247_100051102	257
287	3300009147	Ga0114129_10011065	Ga0114129_100110658	257
288	3300009148	Ga0105243_10008137	Ga0105243_100081377	257
289	3300009148	Ga0105243_10320968	Ga0105243_103209682	257
290	3300009174	Ga0105241_10021291	Ga0105241_100212912	257
291	3300009176	Ga0105242_10002292	Ga0105242_100022924	257
292	3300009176	Ga0105242_10069516	Ga0105242_100695162	257
293	3300009177	Ga0105248_10003491	Ga0105248_100034919	257
294	3300009545	Ga0105237_10005502	Ga0105237_1000550210	257
295	3300009545	Ga0105237_10031891	Ga0105237_100318911	257
296	3300009545	Ga0105237_10060504	Ga0105237_100605044	257
297	3300009553	Ga0105249_10002528	Ga0105249_100025284	257
298	3300009553	Ga0105249_10037016	Ga0105249_100370164	257
299	3300010375	Ga0105239_10006332	Ga0105239_100063323	257
300	3300010375	Ga0105239_10072942	Ga0105239_100729422	257
301	3300010375	Ga0105239_10312197	Ga0105239_103121971	257
302	3300013296	Ga0157374_10218410	Ga0157374_102184102	257
303	3300013297	Ga0157378_10003016	Ga0157378_100030164	257
304	3300013297	Ga0157378_10007460	Ga0157378_100074606	257
305	3300013306	Ga0163162_10009316	Ga0163162_100093167	257
306	3300013307	Ga0157372_10114059	Ga0157372_101140591	257
307	3300013308	Ga0157375_10001844	Ga0157375_1000184416	257
308	3300013308	Ga0157375_10195080	Ga0157375_101950802	257
309	3300014326	Ga0157380_10001662	Ga0157380_100016629	257
310	3300014326	Ga0157380_10504832	Ga0157380_105048322	257
311	3300014326	Ga0157380_10535867	Ga0157380_105358672	257
312	3300014745	Ga0157377_10005117	Ga0157377_100051175	257
313	3300014968	Ga0157379_10024830	Ga0157379_100248304	257
314	3300014968	Ga0157379_10033904	Ga0157379_100339044	257
315	3300014969	Ga0157376_10261562	Ga0157376_102615622	257
316	3300017792	Ga0163161_10004093	Ga0163161_100040933	257
317	3300017792	Ga0163161_10103972	Ga0163161_101039722	257
318	3300021384	Ga0213876_10096224	Ga0213876_100962242	257
319	3300025303	Ga0209051_1000651	Ga0209051_100065131	257
320	3300025303	Ga0209051_1003613	Ga0209051_10036133	257
321	3300025899	Ga0207642_10007873	Ga0207642_100078734	257
322	3300025900	Ga0207710_10020213	Ga0207710_100202132	257
323	3300025901	Ga0207688_10000958	Ga0207688_1000095811	257
324	3300025904	Ga0207647_10025811	Ga0207647_100258111	257
325	3300025904	Ga0207647_10094617	Ga0207647_100946172	257
326	3300025905	Ga0207685_10030733	Ga0207685_100307332	257
327	3300025906	Ga0207699_10261573	Ga0207699_102615732	257
328	3300025911	Ga0207654_10011134	Ga0207654_100111342	257
329	3300025915	Ga0207693_10000746	Ga0207693_100007467	257
330	3300025915	Ga0207693_10003092	Ga0207693_100030927	257
331	3300025916	Ga0207663_10010211	Ga0207663_100102113	257
332	3300025916	Ga0207663_10073997	Ga0207663_100739972	257
333	3300025927	Ga0207687_10005364	Ga0207687_100053643	257
334	3300025929	Ga0207664_10029743	Ga0207664_100297433	257
335	3300025931	Ga0207644_10139964	Ga0207644_101399642	257
336	3300025933	Ga0207706_10012375	Ga0207706_100123757	257
337	3300025934	Ga0207686_10014624	Ga0207686_100146243	257
338	3300025934	Ga0207686_10278476	Ga0207686_102784762	257
339	3300025935	Ga0207709_10002527	Ga0207709_100025273	257
340	3300025936	Ga0207670_10035649	Ga0207670_100356492	257
341	3300025937	Ga0207669_10025522	Ga0207669_100255223	257
342	3300025938	Ga0207704_10003483	Ga0207704_100034834	257
343	3300025939	Ga0207665_10004414	Ga0207665_100044145	257
344	3300025939	Ga0207665_10004959	Ga0207665_100049594	257
345	3300025940	Ga0207691_10034540	Ga0207691_100345401	257
346	3300025941	Ga0207711_10016167	Ga0207711_100161675	257
347	3300025941	Ga0207711_10016585	Ga0207711_100165853	257
348	3300025942	Ga0207689_10004958	Ga0207689_100049587	257
349	3300025961	Ga0207712_10005515	Ga0207712_100055154	257
350	3300025961	Ga0207712_10011492	Ga0207712_100114923	257
351	3300025972	Ga0207668_10002920	Ga0207668_100029209	257
352	3300025972	Ga0207668_10083415	Ga0207668_100834152	257
353	3300025972	Ga0207668_10259098	Ga0207668_102590981	257
354	3300025972	Ga0207668_10421552	Ga0207668_104215521	257
355	3300025986	Ga0207658_10025451	Ga0207658_100254513	257
356	3300025986	Ga0207658_10055322	Ga0207658_100553223	257
357	3300025986	Ga0207658_10413184	Ga0207658_104131842	257
358	3300026023	Ga0207677_10007582	Ga0207677_100075824	257
359	3300026041	Ga0207639_10018557	Ga0207639_100185573	257
360	3300026075	Ga0207708_10024937	Ga0207708_100249372	257
361	3300026078	Ga0207702_10172033	Ga0207702_101720332	257
362	3300026088	Ga0207641_10011112	Ga0207641_100111124	257
363	3300026089	Ga0207648_10008145	Ga0207648_100081457	257
364	3300026095	Ga0207676_10244344	Ga0207676_102443442	257
365	3300026118	Ga0207675_100001770	Ga0207675_1000017708	257
366	3300026118	Ga0207675_100034675	Ga0207675_1000346753	257
367	3300026118	Ga0207675_100394257	Ga0207675_1003942572	257
368	3300026121	Ga0207683_10000886	Ga0207683_100008864	257
369	3300026142	Ga0207698_10437692	Ga0207698_104376922	257
370	3300028379	Ga0268266_10009620	Ga0268266_100096202	257
371	3300028379	Ga0268266_10023497	Ga0268266_100234974	257
372	3300028381	Ga0268264_10002290	Ga0268264_100022904	257
373	3300031824	Ga0307413_10010419	Ga0307413_100104193	257
374	3300031903	Ga0307407_10003073	Ga0307407_100030734	257
375	3300031995	Ga0307409_100028265	Ga0307409_1000282652	257
376	3300032002	Ga0307416_100036705	Ga0307416_1000367054	257
377	3300032126	Ga0307415_100044861	Ga0307415_1000448612	257
378	3300035112	Ga0373932_0024261	Ga0373932_0024261_403_1272	257
379	3300035115	Ga0373941_0065001	Ga0373941_0065001_227_1096	257
380	3300037853	Ga0436364_0153728	Ga0436364_0153728_1153_2016	257
381	3300037853	Ga0436364_0849434	Ga0436364_0849434_2792_3658	257
382	3300037853	Ga0436364_1374512	Ga0436364_1374512_776_1675	257
383	3300039437	Ga0436365_0233085	Ga0436365_0233085_11269_12135	257
384	3300039437	Ga0436365_1318036	Ga0436365_1318036_5400_6299	257
385	3300039438	Ga0436360_1324365	Ga0436360_1324365_258_1124	257
386	3300039450	Ga0436363_0218180	Ga0436363_0218180_940_1821	257
387	3300039450	Ga0436363_1132585	Ga0436363_1132585_129_1037	257
388	3300041410	Ga0439461_0011071	Ga0439461_0011071_576_1454	257
389	3300041413	Ga0439465_0002062	Ga0439465_0002062_4810_5679	257
390	3300041413	Ga0439465_0031974	Ga0439465_0031974_616_1476	257
391	3300041452	Ga0451793_0844185	Ga0451793_0844185_519_1388	257
392	3300041460	Ga0451802_1306544	Ga0451802_1306544_461_1330	257
393	3300041997	Ga0439431_0034483	Ga0439431_0034483_29_901	257
394	3300042002	Ga0439442_028033	Ga0439442_028033_111_989	257
395	3300042004	Ga0439445_0016058	Ga0439445_0016058_576_1445	257
396	3300042008	Ga0439450_007366	Ga0439450_007366_476_1345	257
397	3300044658	Ga0466972_0053055	Ga0466972_0053055_800_1669	257
398	3300044684	Ga0466966_0004859	Ga0466966_0004859_3913_4776	257
399	3300044693	Ga0466961_0039058	Ga0466961_0039058_1124_1987	257
400	3300044693	Ga0466961_0104208	Ga0466961_0104208_796_1665	257
401	3300044694	Ga0466963_0071391	Ga0466963_0071391_557_1474	257
402	3300044694	Ga0466963_0342704	Ga0466963_0342704_28_891	257
403	3300044719	Ga0466971_0020876	Ga0466971_0020876_1089_1958	257
404	3300044719	Ga0466971_0025522	Ga0466971_0025522_825_1712	257
405	3300044719	Ga0466971_0110562	Ga0466971_0110562_253_1179	257
406	3300044735	Ga0466968_0004897	Ga0466968_0004897_3836_4699	257
407	3300044765	Ga0466970_0006422	Ga0466970_0006422_4499_5368	257
408	3300044765	Ga0466970_0019897	Ga0466970_0019897_2528_3391	257
409	3300044842	Ga0466957_0004117	Ga0466957_0004117_429_1298	257
410	3300044842	Ga0466957_0090628	Ga0466957_0090628_743_1606	257
411	3300044842	Ga0466957_0101313	Ga0466957_0101313_23_799	257
412	3300044901	Ga0466960_0000160	Ga0466960_0000160_16437_17363	257
413	3300045049	Ga0466959_0000940	Ga0466959_0000940_13640_14503	257
414	3300045836	Ga0466958_0020975	Ga0466958_0020975_2725_3594	257
415	3300045836	Ga0466958_0059965	Ga0466958_0059965_720_1607	257
416	3300045976	Ga0466967_0018135	Ga0466967_0018135_2239_3165	257
417	3300045976	Ga0466967_0027971	Ga0466967_0027971_598_1524	257
418	3300045976	Ga0466967_0060875	Ga0466967_0060875_539_1420	257
419	3300045976	Ga0466967_0087792	Ga0466967_0087792_1884_2801	257
420	3300046459	Ga0495629_0015212	Ga0495629_0015212_2504_3373	257
421	3300046460	Ga0495638_0018325	Ga0495638_0018325_2597_3466	257
422	3300046476	Ga0495662_0102430	Ga0495662_0102430_379_1248	257
423	3300046506	Ga0495583_0028356	Ga0495583_0028356_687_1556	257
424	3300046507	Ga0495606_0039006	Ga0495606_0039006_1768_2643	257
425	3300046524	Ga0495648_0003152	Ga0495648_0003152_4388_5257	257
426	3300046533	Ga0495640_0020023	Ga0495640_0020023_480_1349	257
427	3300046616	Ga0495668_0006910	Ga0495668_0006910_188_1057	257
428	3300046690	Ga0495624_0034170	Ga0495624_0034170_1491_2360	257
429	3300047320	Ga0495672_0000716	Ga0495672_0000716_203_1072	257
430	3300047321	Ga0495676_0199897	Ga0495676_0199897_462_1331	257
431	3300047469	Ga0495673_0000337	Ga0495673_0000337_35349_36218	257
432	3300048903	Ga0496100_0000571	Ga0496100_0000571_6967_7836	257
433	3300048903	Ga0496100_0000643	Ga0496100_0000643_12886_13755	257
434	3300048904	Ga0496101_0000046	Ga0496101_0000046_120724_121584	257
435	3300048904	Ga0496101_0001312	Ga0496101_0001312_12032_12901	257
436	3300048904	Ga0496101_0003049	Ga0496101_0003049_3949_4818	257
437	3300048904	Ga0496101_0176908	Ga0496101_0176908_80_949	257
438	3300048905	Ga0496102_0000025	Ga0496102_0000025_166300_167160	257
439	3300048905	Ga0496102_0007868	Ga0496102_0007868_889_1758	257
440	3300048905	Ga0496102_0493721	Ga0496102_0493721_58_927	257
441	3300048906	Ga0496103_0000022	Ga0496103_0000022_166300_167160	257
442	3300048906	Ga0496103_0004044	Ga0496103_0004044_7525_8394	257
443	3300048906	Ga0496103_0033652	Ga0496103_0033652_1584_2453	257
444	3300048907	Ga0496104_0003506	Ga0496104_0003506_9255_10124	257
445	3300048907	Ga0496104_0011118	Ga0496104_0011118_533_1402	257
446	3300048908	Ga0496105_0001389	Ga0496105_0001389_6829_7698	257
447	3300048908	Ga0496105_0029839	Ga0496105_0029839_3048_3917	257
448	3300048909	Ga0496106_0002275	Ga0496106_0002275_12159_13028	257
449	3300048909	Ga0496106_0003171	Ga0496106_0003171_2593_3453	257
450	3300048909	Ga0496106_0003263	Ga0496106_0003263_9112_9981	257
451	3300048909	Ga0496106_0427763	Ga0496106_0427763_180_1049	257
452	3300048910	Ga0496107_0000786	Ga0496107_0000786_8235_9104	257
453	3300048910	Ga0496107_0000917	Ga0496107_0000917_6199_7068	257
454	3300048910	Ga0496107_0040244	Ga0496107_0040244_596_1477	257
455	3300048910	Ga0496107_0051819	Ga0496107_0051819_1513_2373	257
456	3300048911	Ga0496108_0006082	Ga0496108_0006082_1879_2769	257
457	3300048911	Ga0496108_0016072	Ga0496108_0016072_1869_2738	257
458	3300048911	Ga0496108_0137634	Ga0496108_0137634_859_1728	257
459	3300048912	Ga0496109_0005081	Ga0496109_0005081_9990_10868	257
460	3300048913	Ga0496110_0003811	Ga0496110_0003811_4932_5801	257
461	3300048913	Ga0496110_0071874	Ga0496110_0071874_782_1651	257
462	3300048915	Ga0496112_0007475	Ga0496112_0007475_4543_5511	257
463	3300048915	Ga0496112_0010248	Ga0496112_0010248_3782_4651	257
464	3300048915	Ga0496112_0345862	Ga0496112_0345862_548_1420	257
465	3300048916	Ga0496113_0214627	Ga0496113_0214627_197_1066	257
466	3300048917	Ga0496114_0000215	Ga0496114_0000215_31671_32540	257
467	3300048917	Ga0496114_0002963	Ga0496114_0002963_8260_9129	257
468	3300048917	Ga0496114_0092849	Ga0496114_0092849_1310_2200	257
469	3300048918	Ga0496115_0003338	Ga0496115_0003338_2456_3325	257
470	3300048918	Ga0496115_0009385	Ga0496115_0009385_3604_4473	257
471	3300048918	Ga0496115_0291487	Ga0496115_0291487_75_944	257
472	3300048919	Ga0496116_0000059	Ga0496116_0000059_107332_108192	257
473	3300048920	Ga0496117_0000055	Ga0496117_0000055_166300_167160	257
474	3300048920	Ga0496117_0050660	Ga0496117_0050660_1126_2007	257
475	3300048921	Ga0496118_0000058	Ga0496118_0000058_166300_167160	257
476	3300048921	Ga0496118_0001433	Ga0496118_0001433_6867_7748	257
477	3300048922	Ga0496119_0004905	Ga0496119_0004905_6419_7279	257
478	3300048924	Ga0496121_0000113	Ga0496121_0000113_60041_60901	257
479	3300048929	Ga0496126_0003135	Ga0496126_0003135_17273_18172	257
480	3300048929	Ga0496126_0010978	Ga0496126_0010978_4923_5783	257
481	3300049571	Ga0501034_0041046	Ga0501034_0041046_2121_3044	257
482	3300049571	Ga0501034_0326396	Ga0501034_0326396_446_1315	257
483	3300049580	Ga0501046_0013438	Ga0501046_0013438_4099_5022	257
484	3300049582	Ga0501048_0001407	Ga0501048_0001407_926_1849	257
485	3300049585	Ga0501069_0031838	Ga0501069_0031838_913_1791	257
486	3300049586	Ga0501070_0016402	Ga0501070_0016402_3636_4559	257
487	3300049589	Ga0501073_0131093	Ga0501073_0131093_73_996	257
488	3300049822	Ga0501035_0008277	Ga0501035_0008277_2340_3263	257
489	3300049823	Ga0501044_0007594	Ga0501044_0007594_9595_10518	257
490	3300049823	Ga0501044_0084157	Ga0501044_0084157_1754_2623	257
491	3300050490	nmdc:mga03n38_106388_c1	nmdc:mga03n38_106388_c1_283_1152	257
492	3300050491	nmdc:mga00v17_1056_c1	nmdc:mga00v17_1056_c1_303_1184	257
493	3300050491	nmdc:mga00v17_61135_c1	nmdc:mga00v17_61135_c1_1358_2239	257
494	3300050492	nmdc:mga0yw44_86208_c1	nmdc:mga0yw44_86208_c1_605_1516	257
495	3300050495	nmdc:mga04h51_96381_c1	nmdc:mga04h51_96381_c1_148_1017	257
496	3300050496	nmdc:mga07m45_13669_c1	nmdc:mga07m45_13669_c1_2403_3272	257
497	3300050496	nmdc:mga07m45_163379_c1	nmdc:mga07m45_163379_c1_276_1145	257
498	3300050496	nmdc:mga07m45_9478_c1	nmdc:mga07m45_9478_c1_2665_3537	257
499	3300050507	nmdc:mga05p37_29305_c2	nmdc:mga05p37_29305_c2_1867_2736	257
500	3300050509	nmdc:mga0qj67_10438_c1	nmdc:mga0qj67_10438_c1_4673_5551	257
501	3300050509	nmdc:mga0qj67_3816_c1	nmdc:mga0qj67_3816_c1_5821_6690	257
502	3300050511	nmdc:mga08y16_392106_c1	nmdc:mga08y16_392106_c1_94_996	257
503	3300050516	nmdc:mga0sz30_18946_c1	nmdc:mga0sz30_18946_c1_42_914	257
504	3300050516	nmdc:mga0sz30_3408_c2	nmdc:mga0sz30_3408_c2_1653_2522	257
505	3300050516	nmdc:mga0sz30_6691_c2	nmdc:mga0sz30_6691_c2_533_1435	257
506	3300053085	Ga0495619_0326993	Ga0495619_0326993_21_890	257
507	3300053087	Ga0500643_003541	Ga0500643_003541_3225_4094	257
508	3300053151	Ga0500604_0062636	Ga0500604_0062636_119_988	257
509	3300061719	Ga0466962_0048160	Ga0466962_0048160_522_1391	257
510	iso_pu_bacteria	2643221687	2644485901	257
511	iso_pu_bacteria	2643221715	2644635216	257
512	iso_pu_bacteria	2902792274	2902795865	257
513	iso_pu_bacteria	2902837492	2902843693	257

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02551

Acyl_CoA_thio

Acyl-CoA thioesterase

167

299

0.98 PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

45

129

0.88 PF20789

4HBT_3C

Acyl-CoA thioesterase C-terminal domain

141

300

0.85 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1tbu-assembly1.cif.gz_C	crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1	0.9453	1	78
1tbu-assembly1.cif.gz_D	crystal structure of n-terminal domain of yeast peroxisomal thioesterase-1	0.9381	4	78
4r9z-assembly1.cif.gz_A	mycobacterium avium subs paratuberculosis tesb protein map1729c	0.9052	5	250
4r9z-assembly1.cif.gz_B	mycobacterium avium subs paratuberculosis tesb protein map1729c	0.8814	5	250
3rd7-assembly1.cif.gz_A	crystal structure of acyl-coa thioesterase from mycobacterium avium	0.8701	4	250

ID	Description	Score	Start	End	Superfamily
1tbuC00	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.9453	1	78	3.10.129.10
4r9zA00	Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain	0.9052	5	250	2.40.160.210
af_O06135_6_288_2.40.160.210	Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain	0.8963	2	251	2.40.160.210
1c8uB02	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.8846	1	85	3.10.129.10
af_K7KLB0_34_136_3.10.129.10	Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase	0.8793	2	80	3.10.129.10

ID	Description	Score	Start	End	GO Terms
AF-A0A2S9GJN4-F1-model_v4	Acyl-CoA thioesterase II	0.9338	1	83	GO:0006637 GO:0009062 GO:0047617
AF-A0A1J3J6Q8-F1-model_v4	Acyl-CoA thioesterase 2	0.9049	2	106	GO:0006637 GO:0009062 GO:0047617
AF-A0A2S9GJN4-F1-model_v4	Acyl-CoA thioesterase II	0.902	1	83	GO:0006637 GO:0009062 GO:0047617
AF-K5BGC1-F1-model_v4	Thioesterase superfamily protein	0.888	1	253	GO:0006637 GO:0009062 GO:0047617
AF-A0A5C6WTS6-F1-model_v4	deleted	0.8828	1	100

Feature Viewer

pLDDT	pTM	Quality
82.43	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F457533

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02551

Acyl_CoA_thio

Acyl-CoA thioesterase

167

299

0.98

PF13622

4HBT_3

Acyl-CoA thioesterase N-terminal domain

45

129

0.88

PF20789

4HBT_3C

Acyl-CoA thioesterase C-terminal domain

141

300

0.85

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map