F457482

General Info

Members Datasets Scaffolds Average Seq Length
512 300 387 199

Family's Representative Sequence

Representative Sequence 3300049534|Ga0501318_010939|Ga0501318_010939_242_931
Length 229
Sequence MALRSFEQDHGRYISVKEIEETETNLRGAYKMKIDNSLPLEYSTEENSLKILGFWIFLGAEIMLFATLFASYFTLVDRTGNGPAGAEIFEITPVLIETILLLTSSFTIGLGIHAMRIGNKRAMMAFFAITLLLGLGFLSVEIYEFMHYVHVGAGLQTSAFTSILLTTLGTHGAHVTLGLFWGLFIMLQVKKRGLTPQTTNKAFIFSLYWHFLDVVWIFIFSFIYLKGMI

Samples

Sample ID Description Type Environment
1 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
2 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
3 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
4 2554235283 Bacillus safensis VK Isolate Rhizosphere
5 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
6 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
7 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
8 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
9 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
10 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
11 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
12 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
13 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
14 2643221735 Bacillus sp. Root920 Isolate Unclassified
15 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
16 2671180330 Peribacillus simplex SH-B26 Isolate Unclassified
17 2671180694 Paenibacillus sp. A3 Isolate Unclassified
18 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
19 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
20 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
21 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
22 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
23 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
24 2738541295 Bacillus sp. OK085 Isolate Unclassified
25 2738543017 Bacillus sp. OV186 Isolate Unclassified
26 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
27 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
28 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
29 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
30 2788500588 Lysinibacillus sp. YS11 Isolate Unclassified
31 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
32 2811994870 Bacillus sp. JB4 Isolate Unclassified
33 2816332186 Peribacillus frigoritolerans 3612 Isolate Unclassified
34 2816332295 Bacillus paralicheniformis MDJK30 Isolate Rhizosphere
35 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
36 2818991441 Niallia circulans 3243 Isolate Rhizosphere
37 2818991451 Lysinibacillus fusiformis 3193 Isolate Unclassified
38 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
39 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
40 2842682962 Bacillus sp. R-72492 Isolate Unclassified
41 2849139964 Bacillus sp. R-71875 Isolate Unclassified
42 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
43 2857472729 Cohnella sp. R-74144 Isolate Unclassified
44 2857581216 Bacillus sp. R-71922 Isolate Unclassified
45 2857586860 Bacillus sp. R-71935 Isolate Unclassified
46 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
47 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
48 2860837431 Bacillus sp. WR11 Isolate Unclassified
49 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
50 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
51 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
52 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
53 2885526491 Paenibacillus sp. LK1 Isolate Rhizosphere
54 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
55 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
56 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
57 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
58 2904606771 Lysinibacillus macroides 1284 Isolate Rhizosphere
59 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
60 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
61 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
62 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
63 2919414237 Neobacillus niacini 3240 Isolate Rhizosphere
64 2919726948 Bacillus pumilus 4489 Isolate Unclassified
65 2928510474 Sporosarcina psychrophila 1288 Isolate Rhizosphere
66 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
67 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
68 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
69 2939593269 Lysinibacillus parviboronicapiens 736 Isolate Rhizosphere
70 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
71 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
72 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
73 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
74 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
75 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
76 2969141011 Bacillus velezensis MH25 Isolate Unclassified
77 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
78 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
79 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
80 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
81 2977254563 Bacillus sp. SORGH_AS 510 Isolate Unclassified
82 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
83 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
84 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
85 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
86 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
87 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
88 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
89 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
90 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
91 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
92 2990275345 Bacillus sp. SLBN-46 Isolate Unclassified
93 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
94 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
95 3001272096 Lederbergia citrisecunda FJAT-49732 Isolate Rhizosphere
96 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
97 3006858327 Bacillus paralicheniformis SUBG0010 Isolate Unclassified
98 3006879489 Bacillus atrophaeus UCMB-5137 Isolate Rhizosphere
99 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
100 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
101 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
102 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
103 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
104 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
105 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
106 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
107 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
108 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
109 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
110 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
111 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
112 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
113 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
114 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
115 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
116 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
117 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
118 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
119 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
120 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
121 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
122 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
123 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
124 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
125 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
126 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
127 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
128 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
129 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
130 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
131 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
132 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
133 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
134 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
135 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
136 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
137 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
138 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
139 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
140 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
141 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
142 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
143 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
144 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
145 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
146 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
147 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
148 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
149 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
150 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
151 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
152 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
153 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
154 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
155 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
156 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
159 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
161 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
163 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
183 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
188 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
189 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
201 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
202 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
203 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
204 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
209 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
210 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
213 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
214 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
224 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049544 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
277 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
278 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
279 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
280 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
281 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
285 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
286 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
287 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
288 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
289 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
290 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
291 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
292 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
293 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
294 8022653035 Bacillus sp. Rc4 Isolate Unclassified
295 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
296 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
297 8054280661 Metabacillus kandeliae GX 13764 Isolate Rhizosphere
298 8055531788 Lysinibacillus pakistanensis LY1 Isolate Rhizosphere
299 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
300 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 42.19
Metatranscriptomes 33.4
Isolates 24.41

Biome Distribution

Category Percentage (%)
Aerial Root 0.39
Bulb 0
Endosphere 13.28
Nodule 0
Rhizoplane 3.52
Rhizosphere 71.88
Stem 0
Stem Tuber 0
Unclassified 10.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1012656 3300001904 Unclassified 1366
2 JGI24737J22298_10000004 3300001990 Bacteria 66533
3 JGI24735J21928_10000992 3300002067 Bacteria 10154
4 JGI25151J46595_10000061 3300003187 Bacteria 146828
5 JGI25151J46595_10001683 3300003187 Bacteria 14479
6 JGI25151J46595_10004122 3300003187 Bacteria 7771
7 JGI25151J46595_10005258 3300003187 Bacteria 6713
8 JGI25151J46595_10019137 3300003187 Bacteria 2917
9 rootH1_10243833 3300003323 Unclassified 2033
10 Ga0006562J51391_1001615 3300003578 Bacteria 34890
11 Ga0055538_1000729 3300003751 Bacteria 9650
12 Ga0055532_1000004 3300003758 Bacteria 471824
13 Ga0055532_1000062 3300003758 Bacteria 148330
14 Ga0055536_1030297 3300003781 Bacteria 1437
15 Ga0055536_1032860 3300003781 Bacteria 1334
16 Ga0055536_1052842 3300003781 Bacteria 882
17 Ga0055541_1000341 3300003841 Bacteria 14646
18 Ga0055541_1000828 3300003841 Bacteria 7608
19 Ga0070658_10001773 3300005327 Bacteria 18166
20 Ga0070683_100043262 3300005329 Bacteria 4151
21 Ga0070666_10000333 3300005335 Bacteria 29797
22 Ga0070680_100240736 3300005336 Bacteria 1529
23 Ga0070680_100386874 3300005336 Bacteria 1191
24 Ga0070660_100000777 3300005339 Bacteria 21179
25 Ga0070691_10006627 3300005341 Bacteria 5299
26 Ga0070668_100114366 3300005347 Bacteria 2150
27 Ga0070675_100108512 3300005354 Bacteria 2344
28 Ga0070674_100011284 3300005356 Bacteria 5435
29 Ga0070659_100001607 3300005366 Bacteria 16260
30 Ga0070667_100007084 3300005367 Bacteria 9321
31 Ga0070667_100492250 3300005367 Bacteria 1123
32 Ga0070700_100211242 3300005441 Bacteria 1369
33 Ga0070681_10000124 3300005458 Bacteria 57934
34 Ga0068867_100425918 3300005459 Bacteria 1125
35 Ga0070679_100015260 3300005530 Bacteria 7381
36 Ga0070679_100090448 3300005530 Bacteria 3049
37 Ga0070679_100306236 3300005530 Bacteria 1539
38 Ga0070684_100127215 3300005535 Bacteria 2296
39 Ga0068855_100000184 3300005563 Bacteria 80265
40 Ga0068855_100003266 3300005563 Bacteria 19846
41 Ga0068855_100401834 3300005563 Unclassified 1501
42 Ga0068857_100000007 3300005577 Bacteria 152197
43 Ga0068857_100505754 3300005577 Bacteria 1134
44 Ga0081539_10022097 3300005985 Bacteria 4221
45 Ga0075365_10002079 3300006038 Bacteria 9561
46 Ga0075368_10000235 3300006042 Bacteria 15544
47 Ga0075368_10173231 3300006042 Unclassified 907
48 Ga0075364_10002154 3300006051 Bacteria 11036
49 Ga0075364_10181796 3300006051 Unclassified 1423
50 Ga0075367_10000864 3300006178 Bacteria 12121
51 Ga0075369_10000572 3300006186 Bacteria 11636
52 Ga0075369_10071600 3300006186 Bacteria 1526
53 Ga0075366_10273803 3300006195 Bacteria 1031
54 Ga0097621_100000082 3300006237 Bacteria 50678
55 Ga0097621_100116948 3300006237 Bacteria 2258
56 Ga0075370_10005296 3300006353 Bacteria 6390
57 Ga0075370_10022171 3300006353 Bacteria 3485
58 Ga0075370_10028744 3300006353 Bacteria 3092
59 Ga0068871_100255217 3300006358 Bacteria 1528
60 Ga0075428_100001206 3300006844 Bacteria 27625
61 Ga0075430_100013108 3300006846 Bacteria 7065
62 Ga0075430_100343734 3300006846 Bacteria 1232
63 Ga0075429_100681973 3300006880 Bacteria 900
64 Ga0068865_100334941 3300006881 Bacteria 1221
65 Ga0105244_10212351 3300009036 Bacteria 910
66 Ga0105241_10243672 3300009174 Bacteria 1521
67 Ga0105238_10006900 3300009551 Bacteria 11340
68 Ga0105238_10256730 3300009551 Bacteria 1727
69 Ga0105249_10279901 3300009553 Bacteria 1665
70 Ga0105239_10060163 3300010375 Bacteria 4168
71 Ga0157371_10008263 3300013102 Bacteria 8314
72 Ga0157371_10015428 3300013102 Bacteria 5730
73 Ga0157369_10005600 3300013105 Bacteria 14584
74 Ga0157372_10287815 3300013307 Bacteria 1911
75 Ga0163163_10000670 3300014325 Bacteria 29312
76 Ga0157380_10325700 3300014326 Bacteria 1426
77 Ga0209784_100054 3300025224 Bacteria 178541
78 Ga0209566_100166 3300025225 Bacteria 71875
79 Ga0209566_100381 3300025225 Bacteria 36138
80 Ga0209147_100010 3300025229 Bacteria 741391
81 Ga0209258_101763 3300025242 Bacteria 6658
82 Ga0209130_1025581 3300025284 Bacteria 1276
83 Ga0209676_1000494 3300025292 Bacteria 63484
84 Ga0209676_1000611 3300025292 Bacteria 52273
85 Ga0209676_1040515 3300025292 Bacteria 1311
86 Ga0209025_1000011 3300025294 Bacteria 976387
87 Ga0209025_1000218 3300025294 Bacteria 137784
88 Ga0209025_1000223 3300025294 Bacteria 133474
89 Ga0209025_1003766 3300025294 Bacteria 13889
90 Ga0209025_1011518 3300025294 Bacteria 5811
91 Ga0209025_1017024 3300025294 Bacteria 4233
92 Ga0209025_1019843 3300025294 Bacteria 3714
93 Ga0209025_1027393 3300025294 Bacteria 2827
94 Ga0209025_1031549 3300025294 Bacteria 2503
95 Ga0209025_1038742 3300025294 Bacteria 2091
96 Ga0209025_1062011 3300025294 Bacteria 1390
97 Ga0207655_1033319 3300025728 Bacteria 2337
98 Ga0207655_1033332 3300025728 Bacteria 2336
99 Ga0207680_10017349 3300025903 Bacteria 3802
100 Ga0207647_10000004 3300025904 Bacteria 307217
101 Ga0207705_10001088 3300025909 Bacteria 22101
102 Ga0207707_10000125 3300025912 Bacteria 79965
103 Ga0207660_10114390 3300025917 Bacteria 2035
104 Ga0207660_10492144 3300025917 Bacteria 994
105 Ga0207657_10049258 3300025919 Bacteria 3673
106 Ga0207652_10048342 3300025921 Bacteria 3636
107 Ga0207694_10006682 3300025924 Bacteria 8764
108 Ga0207694_10187573 3300025924 Bacteria 1679
109 Ga0207690_10014106 3300025932 Bacteria 4818
110 Ga0207686_10034050 3300025934 Bacteria 3046
111 Ga0207669_10011252 3300025937 Bacteria 4347
112 Ga0207667_10000268 3300025949 Bacteria 72064
113 Ga0207667_10311607 3300025949 Unclassified 1608
114 Ga0207668_10232125 3300025972 Bacteria 1488
115 Ga0207703_10029465 3300026035 Bacteria 4331
116 Ga0207708_10582568 3300026075 Bacteria 946
117 Ga0207648_10535400 3300026089 Bacteria 1074
118 Ga0207674_10000001 3300026116 Bacteria 616581
119 Ga0207674_10228723 3300026116 Bacteria 1808
120 Ga0209371_1008402 3300027312 Bacteria 3440
121 Ga0209813_10002516 3300027866 Unclassified 4198
122 Ga0209974_10086119 3300027876 Bacteria 1086
123 Ga0268264_10624957 3300028381 Unclassified 1064
124 Ga0265337_1000906 3300028556 Bacteria 15557
125 Ga0265338_10022121 3300028800 Bacteria 6599
126 Ga0265338_10292706 3300028800 Bacteria 1186
127 Ga0268256_1008750 3300030500 Bacteria 3440
128 Ga0316180_1051467 3300030736 Bacteria 795
129 Ga0316182_1183927 3300030745 Bacteria 8508
130 Ga0316182_1402003 3300030745 Bacteria 5918
131 Ga0265327_10006548 3300031251 Bacteria 9267
132 Ga0307516_10010407 3300031730 Bacteria 10227
133 Ga0307412_11248312 3300031911 Bacteria 667
134 Ga0307416_102165491 3300032002 Bacteria 657
135 Ga0373932_0008420 3300035112 Bacteria 2466
136 Ga0395899_0026125 3300037312 Bacteria 4407
137 Ga0395899_0056580 3300037312 Bacteria 2898
138 Ga0395899_0101706 3300037312 Bacteria 2074
139 Ga0395900_0003978 3300037418 Bacteria 15776
140 Ga0395900_0018903 3300037418 Bacteria 7028
141 Ga0395900_0032929 3300037418 Bacteria 5332
142 Ga0395900_0061367 3300037418 Bacteria 3865
143 Ga0395900_0410384 3300037418 Bacteria 1317
144 Ga0395900_0669928 3300037418 Bacteria 973
145 Ga0395898_0010360 3300037466 Bacteria 9749
146 Ga0395905_0002366 3300037471 Bacteria 21007
147 Ga0395905_0954187 3300037471 Bacteria 761
148 Ga0395901_0014155 3300038443 Bacteria 8121
149 Ga0395901_0157544 3300038443 Bacteria 2385
150 Ga0395901_0412263 3300038443 Bacteria 1387
151 Ga0395901_0505670 3300038443 Bacteria 1230
152 Ga0439461_0000205 3300041410 Bacteria 8299
153 Ga0450920_044124 3300042122 Bacteria 890
154 Ga0450906_002707 3300042145 Bacteria 3854
155 Ga0450908_052277 3300042184 Unclassified 712
156 Ga0450909_000900 3300042185 Bacteria 4059
157 Ga0466959_0964123 3300045049 Bacteria 568
158 Ga0466967_0226148 3300045976 Bacteria 1780
159 Ga0495607_0111007 3300046501 Bacteria 1454
160 Ga0495654_0050517 3300046530 Bacteria 2032
161 Ga0495622_0018934 3300046557 Bacteria 3208
162 Ga0495661_0186936 3300046665 Bacteria 1094
163 Ga0495649_0048717 3300046694 Bacteria 2303
164 Ga0495660_0024377 3300046810 Bacteria 3447
165 Ga0495676_0287014 3300047321 Bacteria 1113
166 Ga0495626_0163456 3300048091 Bacteria 932
167 Ga0496102_0201145 3300048905 Bacteria 1878
168 Ga0496102_0885159 3300048905 Bacteria 815
169 Ga0496103_0023324 3300048906 Bacteria 3731
170 Ga0496103_0047143 3300048906 Bacteria 2662
171 Ga0496103_0200674 3300048906 Bacteria 1283
172 Ga0496104_0320818 3300048907 Bacteria 1462
173 Ga0496107_0600090 3300048910 Bacteria 814
174 Ga0496109_0754768 3300048912 Bacteria 911
175 Ga0496110_0002018 3300048913 Bacteria 15116
176 Ga0496110_0009736 3300048913 Bacteria 7784
177 Ga0496111_0008813 3300048914 Bacteria 6701
178 Ga0496111_0041008 3300048914 Bacteria 3321
179 Ga0496111_0871790 3300048914 Unclassified 649
180 Ga0496112_0437261 3300048915 Bacteria 1246
181 Ga0496116_0011113 3300048919 Bacteria 7487
182 Ga0496116_0066463 3300048919 Bacteria 2307
183 Ga0496116_0081894 3300048919 Bacteria 1999
184 Ga0501306_000208 3300049127 Bacteria 3962
185 Ga0501306_000210 3300049127 Bacteria 3958
186 Ga0501306_002735 3300049127 Bacteria 1838
187 Ga0501306_011324 3300049127 Bacteria 1136
188 Ga0501308_000111 3300049128 Bacteria 3914
189 Ga0501308_001560 3300049128 Bacteria 1861
190 Ga0501309_000592 3300049129 Bacteria 3053
191 Ga0501309_004318 3300049129 Bacteria 1652
192 Ga0501309_004606 3300049129 Bacteria 1612
193 Ga0501309_013520 3300049129 Bacteria 1087
194 Ga0501309_022026 3300049129 Bacteria 899
195 Ga0501310_000634 3300049130 Bacteria 3092
196 Ga0501310_011955 3300049130 Bacteria 989
197 Ga0501310_019780 3300049130 Bacteria 831
198 Ga0501341_00051 3300049131 Bacteria 3160
199 Ga0501341_00428 3300049131 Bacteria 1757
200 Ga0501341_00593 3300049131 Bacteria 1585
201 Ga0501341_02098 3300049131 Bacteria 1055
202 Ga0501343_001339 3300049132 Bacteria 1654
203 Ga0501343_001815 3300049132 Bacteria 1477
204 Ga0501343_001831 3300049132 Bacteria 1474
205 Ga0501343_005858 3300049132 Bacteria 949
206 Ga0501344_00065 3300049133 Bacteria 3067
207 Ga0501344_03585 3300049133 Bacteria 832
208 Ga0501344_05113 3300049133 Bacteria 734
209 Ga0501345_00125 3300049134 Bacteria 2034
210 Ga0501304_006502 3300049160 Bacteria 944
211 Ga0501305_000284 3300049161 Bacteria 3891
212 Ga0501305_000504 3300049161 Bacteria 3237
213 Ga0501305_002674 3300049161 Bacteria 1948
214 Ga0501305_002909 3300049161 Bacteria 1893
215 Ga0501305_003063 3300049161 Bacteria 1865
216 Ga0501305_003621 3300049161 Bacteria 1761
217 Ga0501305_013118 3300049161 Bacteria 1142
218 Ga0501305_014118 3300049161 Bacteria 1114
219 Ga0501305_020678 3300049161 Bacteria 969
220 Ga0501305_027791 3300049161 Bacteria 868
221 Ga0501305_036477 3300049161 Bacteria 786
222 Ga0501307_000243 3300049162 Bacteria 3259
223 Ga0501307_000282 3300049162 Bacteria 3113
224 Ga0501307_017133 3300049162 Bacteria 910
225 Ga0501342_00754 3300049163 Bacteria 925
226 Ga0501311_001106 3300049527 Bacteria 2235
227 Ga0501311_001630 3300049527 Bacteria 2004
228 Ga0501311_001635 3300049527 Bacteria 2002
229 Ga0501312_000372 3300049528 Bacteria 3436
230 Ga0501312_000930 3300049528 Bacteria 2666
231 Ga0501312_002140 3300049528 Bacteria 2092
232 Ga0501312_004958 3300049528 Bacteria 1595
233 Ga0501312_005524 3300049528 Bacteria 1541
234 Ga0501313_000314 3300049529 Bacteria 3074
235 Ga0501313_000363 3300049529 Bacteria 2970
236 Ga0501313_001774 3300049529 Bacteria 1954
237 Ga0501313_004812 3300049529 Bacteria 1402
238 Ga0501314_000257 3300049530 Bacteria 3068
239 Ga0501314_001146 3300049530 Bacteria 1859
240 Ga0501314_004649 3300049530 Bacteria 1146
241 Ga0501314_009768 3300049530 Bacteria 885
242 Ga0501314_011098 3300049530 Bacteria 847
243 Ga0501315_000120 3300049531 Bacteria 4217
244 Ga0501315_000329 3300049531 Bacteria 3114
245 Ga0501315_000743 3300049531 Bacteria 2439
246 Ga0501315_001602 3300049531 Bacteria 1978
247 Ga0501315_002164 3300049531 Bacteria 1809
248 Ga0501315_005614 3300049531 Bacteria 1366
249 Ga0501316_001284 3300049532 Bacteria 2095
250 Ga0501316_003572 3300049532 Bacteria 1519
251 Ga0501316_018984 3300049532 Bacteria 854
252 Ga0501317_000158 3300049533 Bacteria 3866
253 Ga0501317_000314 3300049533 Bacteria 3205
254 Ga0501317_001564 3300049533 Bacteria 1998
255 Ga0501317_005101 3300049533 Bacteria 1395
256 Ga0501317_011039 3300049533 Bacteria 1091
257 Ga0501317_018545 3300049533 Bacteria 921
258 Ga0501317_033215 3300049533 Bacteria 758
259 Ga0501318_000072 3300049534 Bacteria 4271
260 Ga0501318_000096 3300049534 Bacteria 3924
261 Ga0501318_000106 3300049534 Bacteria 3836
262 Ga0501318_002088 3300049534 Bacteria 1683
263 Ga0501318_002478 3300049534 Bacteria 1603
264 Ga0501318_010939 3300049534 Bacteria 1017
265 Ga0501318_011565 3300049534 Bacteria 1000
266 Ga0501318_016936 3300049534 Bacteria 886
267 Ga0501319_000038 3300049535 Bacteria 4139
268 Ga0501319_000309 3300049535 Bacteria 2162
269 Ga0501319_000429 3300049535 Bacteria 1988
270 Ga0501319_001355 3300049535 Bacteria 1398
271 Ga0501320_000204 3300049536 Bacteria 3074
272 Ga0501320_012888 3300049536 Bacteria 886
273 Ga0501321_000122 3300049537 Bacteria 3967
274 Ga0501321_000127 3300049537 Bacteria 3895
275 Ga0501321_000131 3300049537 Bacteria 3851
276 Ga0501321_000686 3300049537 Bacteria 2332
277 Ga0501321_001891 3300049537 Bacteria 1744
278 Ga0501321_002279 3300049537 Bacteria 1645
279 Ga0501321_002387 3300049537 Bacteria 1622
280 Ga0501321_011244 3300049537 Bacteria 995
281 Ga0501321_018868 3300049537 Bacteria 840
282 Ga0501322_000584 3300049538 Bacteria 1773
283 Ga0501322_002542 3300049538 Bacteria 1126
284 Ga0501323_000136 3300049539 Bacteria 4250
285 Ga0501323_000469 3300049539 Bacteria 3012
286 Ga0501323_003280 3300049539 Bacteria 1645
287 Ga0501323_011030 3300049539 Bacteria 1085
288 Ga0501323_017359 3300049539 Bacteria 924
289 Ga0501324_000622 3300049540 Bacteria 2014
290 Ga0501324_000682 3300049540 Bacteria 1972
291 Ga0501324_007070 3300049540 Bacteria 961
292 Ga0501324_012728 3300049540 Bacteria 790
293 Ga0501325_000078 3300049541 Bacteria 3066
294 Ga0501326_00246 3300049542 Bacteria 1995
295 Ga0501326_00435 3300049542 Bacteria 1641
296 Ga0501327_00070 3300049543 Bacteria 3082
297 Ga0501327_00798 3300049543 Bacteria 1382
298 Ga0501328_00171 3300049544 Bacteria 1823
299 Ga0501328_00358 3300049544 Bacteria 1477
300 Ga0501329_02801 3300049545 Bacteria 857
301 Ga0501330_000022 3300049546 Bacteria 3889
302 Ga0501330_000030 3300049546 Bacteria 3550
303 Ga0501330_000634 3300049546 Bacteria 1581
304 Ga0501330_000646 3300049546 Bacteria 1575
305 Ga0501330_002669 3300049546 Bacteria 1021
306 Ga0501330_003440 3300049546 Bacteria 945
307 Ga0501330_005221 3300049546 Bacteria 824
308 Ga0501331_00438 3300049547 Bacteria 1710
309 Ga0501331_00540 3300049547 Bacteria 1585
310 Ga0501332_00295 3300049548 Bacteria 2068
311 Ga0501332_00470 3300049548 Bacteria 1770
312 Ga0501332_00778 3300049548 Bacteria 1509
313 Ga0501332_03585 3300049548 Bacteria 903
314 Ga0501333_000045 3300049549 Bacteria 3568
315 Ga0501333_000287 3300049549 Bacteria 2172
316 Ga0501333_000611 3300049549 Bacteria 1710
317 Ga0501333_002741 3300049549 Bacteria 1046
318 Ga0501333_003965 3300049549 Bacteria 919
319 Ga0501334_00058 3300049550 Bacteria 3446
320 Ga0501334_00387 3300049550 Bacteria 1960
321 Ga0501334_02377 3300049550 Bacteria 1114
322 Ga0501334_03216 3300049550 Bacteria 1005
323 Ga0501334_03559 3300049550 Bacteria 969
324 Ga0501334_04543 3300049550 Bacteria 893
325 Ga0501335_000206 3300049551 Bacteria 3272
326 Ga0501335_000874 3300049551 Bacteria 2147
327 Ga0501335_001055 3300049551 Bacteria 2024
328 Ga0501335_001336 3300049551 Bacteria 1877
329 Ga0501335_001726 3300049551 Bacteria 1707
330 Ga0501335_001752 3300049551 Bacteria 1701
331 Ga0501335_001969 3300049551 Bacteria 1631
332 Ga0501335_002239 3300049551 Bacteria 1557
333 Ga0501336_000051 3300049552 Bacteria 3930
334 Ga0501336_000101 3300049552 Bacteria 3120
335 Ga0501336_000185 3300049552 Bacteria 2644
336 Ga0501336_000654 3300049552 Bacteria 1819
337 Ga0501336_003949 3300049552 Bacteria 1023
338 Ga0501337_000122 3300049553 Bacteria 3040
339 Ga0501337_000292 3300049553 Bacteria 2298
340 Ga0501337_000459 3300049553 Bacteria 1995
341 Ga0501337_000464 3300049553 Bacteria 1988
342 Ga0501337_000717 3300049553 Bacteria 1721
343 Ga0501337_000930 3300049553 Bacteria 1583
344 Ga0501337_010937 3300049553 Bacteria 667
345 Ga0501338_00037 3300049554 Bacteria 3845
346 Ga0501338_00066 3300049554 Bacteria 3111
347 Ga0501338_00413 3300049554 Bacteria 1892
348 Ga0501338_02410 3300049554 Bacteria 1061
349 Ga0501340_000046 3300049556 Bacteria 3367
350 Ga0501340_000266 3300049556 Bacteria 2039
351 Ga0501340_000278 3300049556 Bacteria 2016
352 Ga0501340_000506 3300049556 Bacteria 1754
353 Ga0501340_000633 3300049556 Bacteria 1640
354 Ga0501032_0098593 3300049569 Bacteria 1936
355 Ga0501033_0270977 3300049570 Bacteria 1200
356 Ga0501034_0026490 3300049571 Bacteria 5905
357 Ga0501036_0269276 3300049572 Bacteria 1426
358 Ga0501046_0361512 3300049580 Bacteria 1053
359 Ga0501047_0003583 3300049581 Bacteria 14651
360 Ga0501073_0093978 3300049589 Bacteria 2083
361 Ga0501080_0002005 3300049742 Bacteria 17584
362 Ga0501080_0377893 3300049742 Bacteria 1277
363 Ga0501035_0019370 3300049822 Bacteria 6260
364 Ga0501044_0047295 3300049823 Bacteria 4450
365 nmdc:mga03683_2083_c3 3300050489 Bacteria 1495
366 nmdc:mga00v17_150087_c1 3300050491 Unclassified 1497
367 nmdc:mga00v17_192012_c1 3300050491 Bacteria 1319
368 nmdc:mga00v17_245_c1 3300050491 Bacteria 31982
369 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
370 nmdc:mga0k408_342043_c1 3300050493 Bacteria 892
371 nmdc:mga06z11_304_c1 3300050494 Bacteria 18803
372 nmdc:mga04h51_302_c1 3300050495 Bacteria 12593
373 nmdc:mga07m45_218194_c1 3300050496 Bacteria 1110
374 nmdc:mga07m45_225717_c1 3300050496 Bacteria 1090
375 nmdc:mga07m45_4229_c1 3300050496 Bacteria 7024
376 nmdc:mga0qj67_10242_c1 3300050509 Bacteria 7000
377 nmdc:mga0sz30_68380_c1 3300050516 Bacteria 1526
378 nmdc:mga0sz30_984_c1 3300050516 Bacteria 10242
379 Ga0500643_000011 3300053087 Bacteria 385630
380 Ga0500555_000001 3300053103 Bacteria 1353713
381 Ga0500562_000009 3300053108 Bacteria 187538
382 Ga0500593_018301 3300053117 Bacteria 3053
383 Ga0500561_0000001 3300053137 Bacteria 957685
384 Ga0500577_0165880 3300053142 Bacteria 943
385 Ga0500616_0004882 3300053153 Bacteria 9335
386 Ga0500616_0009525 3300053153 Bacteria 5904
387 Ga0500570_000006 3300053724 Bacteria 129824

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0061367 Ga0395900_0061367_2398_2916 171
2 3300037471 Ga0395905_0954187 Ga0395905_0954187_216_737 171
3 3300038443 Ga0395901_0412263 Ga0395901_0412263_539_1057 171
4 3300042184 Ga0450908_052277 Ga0450908_052277_22_537 171
5 3300045049 Ga0466959_0964123 Ga0466959_0964123_36_551 171
6 3300049529 Ga0501313_001774 Ga0501313_001774_176_769 184
7 3300049539 Ga0501323_011030 Ga0501323_011030_82_675 184
8 3300003187 JGI25151J46595_10000061 JGI25151J46595_10000061122 186
9 3300003578 Ga0006562J51391_1001615 Ga0006562J51391_100161515 186
10 3300025294 Ga0209025_1000011 Ga0209025_1000011287 186
11 3300031730 Ga0307516_10010407 Ga0307516_100104075 187
12 3300053142 Ga0500577_0165880 Ga0500577_0165880_75_674 187
13 3300049742 Ga0501080_0377893 Ga0501080_0377893_528_1097 188
14 3300003323 rootH1_10243833 rootH1_102438332 189
15 3300005985 Ga0081539_10022097 Ga0081539_100220974 189
16 3300028800 Ga0265338_10292706 Ga0265338_102927062 189
17 3300035112 Ga0373932_0008420 Ga0373932_0008420_1879_2454 190
18 iso_pu_bacteria 2593339131 2595088924 190
19 iso_pu_bacteria 2738543017 2739268837 190
20 iso_pu_bacteria 2757320391 2757564665 190
21 iso_pu_bacteria 2775507177 2777763116 190
22 iso_pu_bacteria 2775507192 2777836490 190
23 iso_pu_bacteria 2857586860 2857587788 190
24 iso_pu_bacteria 2936340661 2936344142 190
25 3300013102 Ga0157371_10008263 Ga0157371_100082637 191
26 3300013307 Ga0157372_10287815 Ga0157372_102878152 191
27 3300003841 Ga0055541_1000828 Ga0055541_10008284 192
28 3300005367 Ga0070667_100492250 Ga0070667_1004922502 192
29 3300005577 Ga0068857_100505754 Ga0068857_1005057542 192
30 3300009174 Ga0105241_10243672 Ga0105241_102436722 192
31 3300009551 Ga0105238_10006900 Ga0105238_100069007 192
32 3300025225 Ga0209566_100166 Ga0209566_10016611 192
33 3300025924 Ga0207694_10006682 Ga0207694_100066829 192
34 3300026116 Ga0207674_10228723 Ga0207674_102287232 192
35 3300037312 Ga0395899_0026125 Ga0395899_0026125_1248_1886 192
36 iso_pu_bacteria 2599185353 2600199101 192
37 iso_pu_bacteria 2600254943 2600400745 192
38 iso_pu_bacteria 2857357740 2857367659 192
39 3300003187 JGI25151J46595_10001683 JGI25151J46595_100016831 193
40 3300003187 JGI25151J46595_10004122 JGI25151J46595_100041227 193
41 3300003187 JGI25151J46595_10005258 JGI25151J46595_100052587 193
42 3300003758 Ga0055532_1000004 Ga0055532_100000495 193
43 3300003758 Ga0055532_1000062 Ga0055532_100006215 193
44 3300003781 Ga0055536_1052842 Ga0055536_10528422 193
45 3300005336 Ga0070680_100240736 Ga0070680_1002407363 193
46 3300005458 Ga0070681_10000124 Ga0070681_1000012448 193
47 3300005530 Ga0070679_100090448 Ga0070679_1000904481 193
48 3300025229 Ga0209147_100010 Ga0209147_100010403 193
49 3300025284 Ga0209130_1025581 Ga0209130_10255812 193
50 3300025292 Ga0209676_1000611 Ga0209676_100061120 193
51 3300025294 Ga0209025_1000218 Ga0209025_100021834 193
52 3300025294 Ga0209025_1000223 Ga0209025_100022388 193
53 3300025294 Ga0209025_1003766 Ga0209025_100376613 193
54 3300025294 Ga0209025_1031549 Ga0209025_10315492 193
55 3300025912 Ga0207707_10000125 Ga0207707_1000012579 193
56 3300025917 Ga0207660_10114390 Ga0207660_101143903 193
57 3300048906 Ga0496103_0047143 Ga0496103_0047143_1610_2200 193
58 3300048910 Ga0496107_0600090 Ga0496107_0600090_16_606 193
59 3300048919 Ga0496116_0011113 Ga0496116_0011113_5142_5771 193
60 3300049127 Ga0501306_002735 Ga0501306_002735_327_944 193
61 3300049161 Ga0501305_013118 Ga0501305_013118_292_909 193
62 iso_pu_bacteria 2563366752 2563928484 193
63 iso_pu_bacteria 2576861424 2578335462 193
64 iso_pu_bacteria 2593339131 2595088164 193
65 iso_pu_bacteria 2671180330 2672333951 193
66 iso_pu_bacteria 2671180330 2672336498 193
67 iso_pu_bacteria 2738541295 2738814677 193
68 iso_pu_bacteria 2744054657 2745168048 193
69 iso_pu_bacteria 2744054657 2745168577 193
70 iso_pu_bacteria 2757320391 2757566148 193
71 iso_pu_bacteria 2788500588 2791213592 193
72 iso_pu_bacteria 2788500588 2791214576 193
73 iso_pu_bacteria 2816332186 2816863038 193
74 iso_pu_bacteria 2816332186 2816866025 193
75 iso_pu_bacteria 2816332336 2817620951 193
76 iso_pu_bacteria 2818991451 2819628353 193
77 iso_pu_bacteria 2842682962 2842683086 193
78 iso_pu_bacteria 2842682962 2842686108 193
79 iso_pu_bacteria 2849139964 2849141882 193
80 iso_pu_bacteria 2849139964 2849143930 193
81 iso_pu_bacteria 2857581216 2857585275 193
82 iso_pu_bacteria 2857604169 2857604578 193
83 iso_pu_bacteria 2857609550 2857611208 193
84 iso_pu_bacteria 2881644220 2881649044 193
85 iso_pu_bacteria 2904606771 2904607671 193
86 iso_pu_bacteria 2904606771 2904609917 193
87 iso_pu_bacteria 2907202186 2907207660 193
88 iso_pu_bacteria 2919414237 2919418154 193
89 iso_pu_bacteria 2928510474 2928515028 193
90 iso_pu_bacteria 2936340661 2936342652 193
91 iso_pu_bacteria 2938649242 2938655057 193
92 iso_pu_bacteria 2939593269 2939596263 193
93 iso_pu_bacteria 2968558590 2968564961 193
94 iso_pu_bacteria 2971511577 2971513259 193
95 iso_pu_bacteria 2980125574 2980128503 193
96 iso_pu_bacteria 2980176882 2980178427 193
97 iso_pu_bacteria 2988225383 2988227016 193
98 iso_pu_bacteria 2996632988 2996633117 193
99 iso_pu_bacteria 3001267043 3001271520 193
100 iso_pu_bacteria 3001272096 3001272460 193
101 iso_pu_bacteria 3001892409 3001893406 193
102 iso_pu_bacteria 3006969106 3006972603 193
103 iso_pu_bacteria 3006978542 3006978900 193
104 iso_pu_bacteria 3006978542 3006980834 193
105 iso_pu_bacteria 3006984091 3006984763 193
106 iso_pu_bacteria 3006988479 3006992911 193
107 iso_pu_bacteria 8055531788 8055534542 193
108 iso_pu_bacteria 8055531788 8055535707 193
109 iso_pu_bacteria 8057632132 8057634746 193
110 iso_pu_bacteria 8057733483 8057735626 193
111 3300005459 Ga0068867_100425918 Ga0068867_1004259181 194
112 3300014326 Ga0157380_10325700 Ga0157380_103257002 194
113 3300026089 Ga0207648_10535400 Ga0207648_105354001 194
114 3300053117 Ga0500593_018301 Ga0500593_018301_2188_2817 194
115 3300053153 Ga0500616_0009525 Ga0500616_0009525_1473_2102 194
116 iso_pu_bacteria 2671180694 2673817663 194
117 iso_pu_bacteria 2818991441 2819569742 194
118 3300005327 Ga0070658_10001773 Ga0070658_100017733 195
119 3300005339 Ga0070660_100000777 Ga0070660_1000007779 195
120 3300005341 Ga0070691_10006627 Ga0070691_100066276 195
121 3300005366 Ga0070659_100001607 Ga0070659_1000016079 195
122 3300005530 Ga0070679_100015260 Ga0070679_1000152602 195
123 3300005563 Ga0068855_100000184 Ga0068855_1000001844 195
124 3300005563 Ga0068855_100003266 Ga0068855_10000326619 195
125 3300005577 Ga0068857_100000007 Ga0068857_10000000762 195
126 3300006042 Ga0075368_10173231 Ga0075368_101732312 195
127 3300006353 Ga0075370_10005296 Ga0075370_100052962 195
128 3300006353 Ga0075370_10022171 Ga0075370_100221713 195
129 3300009551 Ga0105238_10256730 Ga0105238_102567302 195
130 3300010375 Ga0105239_10060163 Ga0105239_100601632 195
131 3300025909 Ga0207705_10001088 Ga0207705_1000108822 195
132 3300025919 Ga0207657_10049258 Ga0207657_100492583 195
133 3300025921 Ga0207652_10048342 Ga0207652_100483424 195
134 3300025924 Ga0207694_10187573 Ga0207694_101875732 195
135 3300025932 Ga0207690_10014106 Ga0207690_100141065 195
136 3300025949 Ga0207667_10000268 Ga0207667_1000026864 195
137 3300026116 Ga0207674_10000001 Ga0207674_10000001249 195
138 3300037312 Ga0395899_0056580 Ga0395899_0056580_2041_2679 195
139 3300049553 Ga0501337_000464 Ga0501337_000464_1156_1749 195
140 3300050496 nmdc:mga07m45_225717_c1 nmdc:mga07m45_225717_c1_131_769 195
141 3300050496 nmdc:mga07m45_4229_c1 nmdc:mga07m45_4229_c1_5225_5824 195
142 3300053103 Ga0500555_000001 Ga0500555_000001_617377_617970 195
143 iso_pu_bacteria 2864997549 2864999521 195
144 iso_pu_bacteria 2885526491 2885528164 195
145 iso_pu_bacteria 2889295896 2889298196 195
146 iso_pu_bacteria 2917832318 2917836110 195
147 iso_pu_bacteria 2919414237 2919418623 195
148 iso_pu_bacteria 2936361878 2936365752 195
149 iso_pu_bacteria 2964375228 2964376388 195
150 iso_pu_bacteria 2977254563 2977257990 195
151 iso_pu_bacteria 2981284811 2981286680 195
152 iso_pu_bacteria 2981289755 2981291631 195
153 iso_pu_bacteria 2981980479 2981982321 195
154 iso_pu_bacteria 2981985349 2981987224 195
155 iso_pu_bacteria 2984527788 2984531056 195
156 iso_pu_bacteria 2984532647 2984537165 195
157 iso_pu_bacteria 2990275345 2990279014 195
158 iso_pu_bacteria 3006973921 3006977427 195
159 iso_pu_bacteria 8002317523 8002317835 195
160 3300003187 JGI25151J46595_10019137 JGI25151J46595_100191374 196
161 3300003751 Ga0055538_1000729 Ga0055538_10007292 196
162 3300003781 Ga0055536_1030297 Ga0055536_10302972 196
163 3300003781 Ga0055536_1032860 Ga0055536_10328601 196
164 3300003841 Ga0055541_1000341 Ga0055541_10003413 196
165 3300006844 Ga0075428_100001206 Ga0075428_1000012066 196
166 3300006846 Ga0075430_100013108 Ga0075430_1000131083 196
167 3300006846 Ga0075430_100343734 Ga0075430_1003437341 196
168 3300006880 Ga0075429_100681973 Ga0075429_1006819732 196
169 3300009036 Ga0105244_10212351 Ga0105244_102123512 196
170 3300013102 Ga0157371_10015428 Ga0157371_100154284 196
171 3300014325 Ga0163163_10000670 Ga0163163_1000067019 196
172 3300025224 Ga0209784_100054 Ga0209784_10005416 196
173 3300025225 Ga0209566_100381 Ga0209566_10038125 196
174 3300025242 Ga0209258_101763 Ga0209258_1017635 196
175 3300025292 Ga0209676_1000494 Ga0209676_100049435 196
176 3300025292 Ga0209676_1040515 Ga0209676_10405153 196
177 3300025294 Ga0209025_1011518 Ga0209025_10115185 196
178 3300025294 Ga0209025_1017024 Ga0209025_10170242 196
179 3300025294 Ga0209025_1019843 Ga0209025_10198432 196
180 3300025294 Ga0209025_1027393 Ga0209025_10273932 196
181 3300025294 Ga0209025_1038742 Ga0209025_10387422 196
182 3300025294 Ga0209025_1062011 Ga0209025_10620112 196
183 3300028381 Ga0268264_10624957 Ga0268264_106249571 196
184 3300031251 Ga0265327_10006548 Ga0265327_100065484 196
185 3300031911 Ga0307412_11248312 Ga0307412_112483121 196
186 3300032002 Ga0307416_102165491 Ga0307416_1021654911 196
187 3300048905 Ga0496102_0201145 Ga0496102_0201145_692_1288 196
188 3300048905 Ga0496102_0885159 Ga0496102_0885159_89_685 196
189 3300048906 Ga0496103_0023324 Ga0496103_0023324_1460_2056 196
190 3300048907 Ga0496104_0320818 Ga0496104_0320818_515_1111 196
191 3300048912 Ga0496109_0754768 Ga0496109_0754768_303_899 196
192 3300048913 Ga0496110_0002018 Ga0496110_0002018_9277_9873 196
193 3300048913 Ga0496110_0009736 Ga0496110_0009736_3496_4092 196
194 3300048914 Ga0496111_0008813 Ga0496111_0008813_2942_3538 196
195 3300048914 Ga0496111_0041008 Ga0496111_0041008_475_1071 196
196 3300048914 Ga0496111_0871790 Ga0496111_0871790_36_632 196
197 3300048919 Ga0496116_0066463 Ga0496116_0066463_742_1338 196
198 3300049127 Ga0501306_000208 Ga0501306_000208_354_950 196
199 3300049127 Ga0501306_000210 Ga0501306_000210_2981_3577 196
200 3300049127 Ga0501306_011324 Ga0501306_011324_245_841 196
201 3300049128 Ga0501308_000111 Ga0501308_000111_3022_3618 196
202 3300049128 Ga0501308_001560 Ga0501308_001560_173_769 196
203 3300049129 Ga0501309_000592 Ga0501309_000592_2163_2759 196
204 3300049129 Ga0501309_004318 Ga0501309_004318_761_1357 196
205 3300049129 Ga0501309_004606 Ga0501309_004606_740_1336 196
206 3300049129 Ga0501309_013520 Ga0501309_013520_455_1051 196
207 3300049129 Ga0501309_022026 Ga0501309_022026_277_873 196
208 3300049130 Ga0501310_000634 Ga0501310_000634_2219_2815 196
209 3300049130 Ga0501310_011955 Ga0501310_011955_242_838 196
210 3300049130 Ga0501310_019780 Ga0501310_019780_222_818 196
211 3300049131 Ga0501341_00051 Ga0501341_00051_314_910 196
212 3300049131 Ga0501341_00428 Ga0501341_00428_859_1455 196
213 3300049131 Ga0501341_00593 Ga0501341_00593_251_847 196
214 3300049132 Ga0501343_001339 Ga0501343_001339_726_1322 196
215 3300049132 Ga0501343_001815 Ga0501343_001815_327_923 196
216 3300049132 Ga0501343_001831 Ga0501343_001831_731_1327 196
217 3300049132 Ga0501343_005858 Ga0501343_005858_257_853 196
218 3300049133 Ga0501344_00065 Ga0501344_00065_2164_2760 196
219 3300049133 Ga0501344_03585 Ga0501344_03585_77_673 196
220 3300049133 Ga0501344_05113 Ga0501344_05113_123_719 196
221 3300049134 Ga0501345_00125 Ga0501345_00125_1106_1702 196
222 3300049160 Ga0501304_006502 Ga0501304_006502_256_852 196
223 3300049161 Ga0501305_000284 Ga0501305_000284_3020_3616 196
224 3300049161 Ga0501305_000504 Ga0501305_000504_2194_2790 196
225 3300049161 Ga0501305_002674 Ga0501305_002674_239_835 196
226 3300049161 Ga0501305_002909 Ga0501305_002909_681_1277 196
227 3300049161 Ga0501305_003063 Ga0501305_003063_993_1589 196
228 3300049161 Ga0501305_003621 Ga0501305_003621_618_1214 196
229 3300049161 Ga0501305_014118 Ga0501305_014118_117_713 196
230 3300049161 Ga0501305_020678 Ga0501305_020678_98_694 196
231 3300049161 Ga0501305_027791 Ga0501305_027791_98_694 196
232 3300049162 Ga0501307_000243 Ga0501307_000243_2412_3008 196
233 3300049162 Ga0501307_000282 Ga0501307_000282_2241_2837 196
234 3300049162 Ga0501307_017133 Ga0501307_017133_268_864 196
235 3300049163 Ga0501342_00754 Ga0501342_00754_281_877 196
236 3300049527 Ga0501311_001106 Ga0501311_001106_278_874 196
237 3300049527 Ga0501311_001630 Ga0501311_001630_1133_1729 196
238 3300049527 Ga0501311_001635 Ga0501311_001635_274_870 196
239 3300049528 Ga0501312_000372 Ga0501312_000372_2238_2834 196
240 3300049528 Ga0501312_000930 Ga0501312_000930_1671_2267 196
241 3300049528 Ga0501312_002140 Ga0501312_002140_618_1214 196
242 3300049528 Ga0501312_004958 Ga0501312_004958_673_1269 196
243 3300049528 Ga0501312_005524 Ga0501312_005524_253_849 196
244 3300049529 Ga0501313_000314 Ga0501313_000314_278_874 196
245 3300049529 Ga0501313_000363 Ga0501313_000363_2350_2946 196
246 3300049529 Ga0501313_004812 Ga0501313_004812_473_1069 196
247 3300049530 Ga0501314_000257 Ga0501314_000257_2195_2791 196
248 3300049530 Ga0501314_001146 Ga0501314_001146_1010_1606 196
249 3300049530 Ga0501314_004649 Ga0501314_004649_293_889 196
250 3300049530 Ga0501314_009768 Ga0501314_009768_276_872 196
251 3300049530 Ga0501314_011098 Ga0501314_011098_14_610 196
252 3300049531 Ga0501315_000120 Ga0501315_000120_3023_3619 196
253 3300049531 Ga0501315_000329 Ga0501315_000329_2241_2837 196
254 3300049531 Ga0501315_000743 Ga0501315_000743_252_848 196
255 3300049531 Ga0501315_001602 Ga0501315_001602_1086_1682 196
256 3300049531 Ga0501315_002164 Ga0501315_002164_270_866 196
257 3300049532 Ga0501316_001284 Ga0501316_001284_354_950 196
258 3300049532 Ga0501316_003572 Ga0501316_003572_356_952 196
259 3300049532 Ga0501316_018984 Ga0501316_018984_169_765 196
260 3300049533 Ga0501317_000158 Ga0501317_000158_275_871 196
261 3300049533 Ga0501317_000314 Ga0501317_000314_404_1000 196
262 3300049533 Ga0501317_001564 Ga0501317_001564_1108_1704 196
263 3300049533 Ga0501317_011039 Ga0501317_011039_482_1078 196
264 3300049533 Ga0501317_018545 Ga0501317_018545_312_908 196
265 3300049533 Ga0501317_033215 Ga0501317_033215_146_742 196
266 3300049534 Ga0501318_000072 Ga0501318_000072_3386_3982 196
267 3300049534 Ga0501318_000096 Ga0501318_000096_2996_3592 196
268 3300049534 Ga0501318_000106 Ga0501318_000106_278_874 196
269 3300049534 Ga0501318_002088 Ga0501318_002088_856_1452 196
270 3300049534 Ga0501318_002478 Ga0501318_002478_730_1326 196
271 3300049534 Ga0501318_016936 Ga0501318_016936_14_610 196
272 3300049535 Ga0501319_000038 Ga0501319_000038_3268_3864 196
273 3300049535 Ga0501319_000309 Ga0501319_000309_426_1022 196
274 3300049535 Ga0501319_000429 Ga0501319_000429_1115_1711 196
275 3300049535 Ga0501319_001355 Ga0501319_001355_270_866 196
276 3300049536 Ga0501320_000204 Ga0501320_000204_278_874 196
277 3300049536 Ga0501320_012888 Ga0501320_012888_168_764 196
278 3300049537 Ga0501321_000122 Ga0501321_000122_2982_3578 196
279 3300049537 Ga0501321_000127 Ga0501321_000127_3024_3620 196
280 3300049537 Ga0501321_000131 Ga0501321_000131_2996_3592 196
281 3300049537 Ga0501321_000686 Ga0501321_000686_1179_1775 196
282 3300049537 Ga0501321_001891 Ga0501321_001891_278_874 196
283 3300049537 Ga0501321_002279 Ga0501321_002279_352_948 196
284 3300049537 Ga0501321_002387 Ga0501321_002387_278_874 196
285 3300049537 Ga0501321_011244 Ga0501321_011244_123_719 196
286 3300049537 Ga0501321_018868 Ga0501321_018868_148_744 196
287 3300049538 Ga0501322_000584 Ga0501322_000584_353_949 196
288 3300049538 Ga0501322_002542 Ga0501322_002542_308_904 196
289 3300049539 Ga0501323_000136 Ga0501323_000136_261_857 196
290 3300049539 Ga0501323_000469 Ga0501323_000469_276_872 196
291 3300049539 Ga0501323_003280 Ga0501323_003280_336_932 196
292 3300049539 Ga0501323_017359 Ga0501323_017359_156_752 196
293 3300049540 Ga0501324_000622 Ga0501324_000622_1151_1747 196
294 3300049540 Ga0501324_000682 Ga0501324_000682_1101_1697 196
295 3300049540 Ga0501324_007070 Ga0501324_007070_98_694 196
296 3300049540 Ga0501324_012728 Ga0501324_012728_97_693 196
297 3300049541 Ga0501325_000078 Ga0501325_000078_2195_2791 196
298 3300049542 Ga0501326_00246 Ga0501326_00246_266_862 196
299 3300049542 Ga0501326_00435 Ga0501326_00435_777_1373 196
300 3300049543 Ga0501327_00070 Ga0501327_00070_2206_2802 196
301 3300049543 Ga0501327_00798 Ga0501327_00798_762_1358 196
302 3300049544 Ga0501328_00171 Ga0501328_00171_161_757 196
303 3300049544 Ga0501328_00358 Ga0501328_00358_328_924 196
304 3300049545 Ga0501329_02801 Ga0501329_02801_118_714 196
305 3300049546 Ga0501330_000022 Ga0501330_000022_3020_3616 196
306 3300049546 Ga0501330_000030 Ga0501330_000030_307_903 196
307 3300049546 Ga0501330_000634 Ga0501330_000634_930_1526 196
308 3300049546 Ga0501330_002669 Ga0501330_002669_274_870 196
309 3300049546 Ga0501330_003440 Ga0501330_003440_252_848 196
310 3300049546 Ga0501330_005221 Ga0501330_005221_131_727 196
311 3300049547 Ga0501331_00438 Ga0501331_00438_1090_1686 196
312 3300049547 Ga0501331_00540 Ga0501331_00540_356_952 196
313 3300049548 Ga0501332_00295 Ga0501332_00295_347_943 196
314 3300049548 Ga0501332_00470 Ga0501332_00470_868_1464 196
315 3300049548 Ga0501332_00778 Ga0501332_00778_581_1177 196
316 3300049548 Ga0501332_03585 Ga0501332_03585_14_610 196
317 3300049549 Ga0501333_000045 Ga0501333_000045_638_1234 196
318 3300049549 Ga0501333_000287 Ga0501333_000287_1155_1751 196
319 3300049549 Ga0501333_000611 Ga0501333_000611_863_1459 196
320 3300049549 Ga0501333_002741 Ga0501333_002741_66_662 196
321 3300049549 Ga0501333_003965 Ga0501333_003965_18_614 196
322 3300049550 Ga0501334_00058 Ga0501334_00058_2199_2795 196
323 3300049550 Ga0501334_00387 Ga0501334_00387_235_831 196
324 3300049550 Ga0501334_02377 Ga0501334_02377_500_1096 196
325 3300049550 Ga0501334_03559 Ga0501334_03559_123_719 196
326 3300049550 Ga0501334_04543 Ga0501334_04543_54_650 196
327 3300049551 Ga0501335_000206 Ga0501335_000206_2349_2945 196
328 3300049551 Ga0501335_000874 Ga0501335_000874_1245_1841 196
329 3300049551 Ga0501335_001055 Ga0501335_001055_359_955 196
330 3300049551 Ga0501335_001336 Ga0501335_001336_736_1332 196
331 3300049551 Ga0501335_001726 Ga0501335_001726_841_1437 196
332 3300049551 Ga0501335_001752 Ga0501335_001752_852_1448 196
333 3300049551 Ga0501335_001969 Ga0501335_001969_356_952 196
334 3300049551 Ga0501335_002239 Ga0501335_002239_686_1282 196
335 3300049552 Ga0501336_000051 Ga0501336_000051_3002_3598 196
336 3300049552 Ga0501336_000101 Ga0501336_000101_2249_2845 196
337 3300049552 Ga0501336_000185 Ga0501336_000185_628_1224 196
338 3300049552 Ga0501336_000654 Ga0501336_000654_156_752 196
339 3300049552 Ga0501336_003949 Ga0501336_003949_152_748 196
340 3300049553 Ga0501337_000122 Ga0501337_000122_2169_2765 196
341 3300049553 Ga0501337_000292 Ga0501337_000292_1141_1737 196
342 3300049553 Ga0501337_000459 Ga0501337_000459_1124_1720 196
343 3300049553 Ga0501337_000717 Ga0501337_000717_848_1444 196
344 3300049553 Ga0501337_000930 Ga0501337_000930_326_922 196
345 3300049553 Ga0501337_010937 Ga0501337_010937_43_639 196
346 3300049554 Ga0501338_00037 Ga0501338_00037_3020_3616 196
347 3300049554 Ga0501338_00066 Ga0501338_00066_345_941 196
348 3300049554 Ga0501338_00413 Ga0501338_00413_207_803 196
349 3300049554 Ga0501338_02410 Ga0501338_02410_157_753 196
350 3300049556 Ga0501340_000046 Ga0501340_000046_2159_2755 196
351 3300049556 Ga0501340_000266 Ga0501340_000266_276_872 196
352 3300049556 Ga0501340_000278 Ga0501340_000278_1157_1753 196
353 3300049556 Ga0501340_000506 Ga0501340_000506_859_1455 196
354 3300049556 Ga0501340_000633 Ga0501340_000633_144_740 196
355 3300049589 Ga0501073_0093978 Ga0501073_0093978_1197_1787 196
356 3300049742 Ga0501080_0002005 Ga0501080_0002005_8210_8800 196
357 3300050509 nmdc:mga0qj67_10242_c1 nmdc:mga0qj67_10242_c1_4064_4663 196
358 3300053087 Ga0500643_000011 Ga0500643_000011_165161_165751 196
359 3300053724 Ga0500570_000006 Ga0500570_000006_89705_90295 196
360 iso_pu_bacteria 2511231119 2511701539 196
361 iso_pu_bacteria 2540341094 2540608739 196
362 iso_pu_bacteria 2545555800 2545557738 196
363 iso_pu_bacteria 2554235283 2555468698 196
364 iso_pu_bacteria 2576861599 2578932129 196
365 iso_pu_bacteria 2630968484 2631983286 196
366 iso_pu_bacteria 2643221735 2644738513 196
367 iso_pu_bacteria 2648501850 2651531140 196
368 iso_pu_bacteria 2671180844 2674421523 196
369 iso_pu_bacteria 2684623153 2686998833 196
370 iso_pu_bacteria 2687453109 2687500129 196
371 iso_pu_bacteria 2695420354 2695629496 196
372 iso_pu_bacteria 2716884898 2717914808 196
373 iso_pu_bacteria 2808606399 2809053880 196
374 iso_pu_bacteria 2811994870 2812314022 196
375 iso_pu_bacteria 2816332295 2817482117 196
376 iso_pu_bacteria 2818991468 2819723038 196
377 iso_pu_bacteria 2823526263 2823530070 196
378 iso_pu_bacteria 2860837431 2860841558 196
379 iso_pu_bacteria 2877768649 2877772423 196
380 iso_pu_bacteria 2880169592 2880173272 196
381 iso_pu_bacteria 2897109615 2897113541 196
382 iso_pu_bacteria 2904560550 2904563135 196
383 iso_pu_bacteria 2908665501 2908667300 196
384 iso_pu_bacteria 2919093281 2919094685 196
385 iso_pu_bacteria 2919726948 2919727244 196
386 iso_pu_bacteria 2954773129 2954776522 196
387 iso_pu_bacteria 2956897341 2956898367 196
388 iso_pu_bacteria 2962290636 2962294798 196
389 iso_pu_bacteria 2969136845 2969140716 196
390 iso_pu_bacteria 2969141011 2969144995 196
391 iso_pu_bacteria 2969765954 2969770042 196
392 iso_pu_bacteria 2969770375 2969770804 196
393 iso_pu_bacteria 2971893375 2971897118 196
394 iso_pu_bacteria 2980492589 2980496564 196
395 iso_pu_bacteria 3006858327 3006862547 196
396 iso_pu_bacteria 3006879489 3006883260 196
397 iso_pu_bacteria 8022630665 8022632643 196
398 iso_pu_bacteria 8022653035 8022655517 196
399 iso_pu_bacteria 8051952484 8051953967 196
400 iso_pu_bacteria 8052174270 8052175974 196
401 iso_pu_bacteria 8054280661 8054283846 196
402 3300006051 Ga0075364_10181796 Ga0075364_101817962 197
403 3300009553 Ga0105249_10279901 Ga0105249_102799012 197
404 3300027312 Ga0209371_1008402 Ga0209371_10084024 197
405 3300030500 Ga0268256_1008750 Ga0268256_10087504 197
406 3300037312 Ga0395899_0101706 Ga0395899_0101706_970_1575 197
407 3300037418 Ga0395900_0003978 Ga0395900_0003978_19_624 197
408 3300037418 Ga0395900_0032929 Ga0395900_0032929_4529_5134 197
409 3300037466 Ga0395898_0010360 Ga0395898_0010360_1924_2529 197
410 3300038443 Ga0395901_0014155 Ga0395901_0014155_2000_2605 197
411 3300050491 nmdc:mga00v17_150087_c1 nmdc:mga00v17_150087_c1_573_1169 197
412 iso_pu_bacteria 2857472729 2857478714 197
413 3300005347 Ga0070668_100114366 Ga0070668_1001143662 198
414 3300006237 Ga0097621_100000082 Ga0097621_1000000827 198
415 3300025972 Ga0207668_10232125 Ga0207668_102321252 198
416 3300028556 Ga0265337_1000906 Ga0265337_10009064 198
417 3300028800 Ga0265338_10022121 Ga0265338_100221213 198
418 3300030745 Ga0316182_1402003 Ga0316182_14020033 198
419 3300042122 Ga0450920_044124 Ga0450920_044124_42_644 198
420 3300042145 Ga0450906_002707 Ga0450906_002707_896_1498 198
421 3300042185 Ga0450909_000900 Ga0450909_000900_836_1438 198
422 3300045976 Ga0466967_0226148 Ga0466967_0226148_399_1004 198
423 3300046501 Ga0495607_0111007 Ga0495607_0111007_729_1334 198
424 3300046530 Ga0495654_0050517 Ga0495654_0050517_258_863 198
425 3300046557 Ga0495622_0018934 Ga0495622_0018934_2088_2693 198
426 3300046665 Ga0495661_0186936 Ga0495661_0186936_172_777 198
427 3300046694 Ga0495649_0048717 Ga0495649_0048717_1170_1775 198
428 3300046810 Ga0495660_0024377 Ga0495660_0024377_2032_2637 198
429 3300047321 Ga0495676_0287014 Ga0495676_0287014_70_672 198
430 3300048091 Ga0495626_0163456 Ga0495626_0163456_79_684 198
431 3300048906 Ga0496103_0200674 Ga0496103_0200674_91_696 198
432 3300048915 Ga0496112_0437261 Ga0496112_0437261_400_1005 198
433 3300048919 Ga0496116_0081894 Ga0496116_0081894_390_995 198
434 3300049131 Ga0501341_02098 Ga0501341_02098_308_913 198
435 3300049161 Ga0501305_036477 Ga0501305_036477_105_710 198
436 3300049531 Ga0501315_005614 Ga0501315_005614_528_1133 198
437 3300049533 Ga0501317_005101 Ga0501317_005101_563_1168 198
438 3300049534 Ga0501318_011565 Ga0501318_011565_290_895 198
439 3300049546 Ga0501330_000646 Ga0501330_000646_332_937 198
440 3300049550 Ga0501334_03216 Ga0501334_03216_155_760 198
441 3300049569 Ga0501032_0098593 Ga0501032_0098593_37_639 198
442 3300049570 Ga0501033_0270977 Ga0501033_0270977_452_1054 198
443 3300049571 Ga0501034_0026490 Ga0501034_0026490_1432_2034 198
444 3300049572 Ga0501036_0269276 Ga0501036_0269276_97_699 198
445 3300049580 Ga0501046_0361512 Ga0501046_0361512_24_650 198
446 3300049581 Ga0501047_0003583 Ga0501047_0003583_388_990 198
447 3300049822 Ga0501035_0019370 Ga0501035_0019370_2683_3285 198
448 3300049823 Ga0501044_0047295 Ga0501044_0047295_198_800 198
449 3300006038 Ga0075365_10002079 Ga0075365_100020793 199
450 3300006042 Ga0075368_10000235 Ga0075368_100002354 199
451 3300006051 Ga0075364_10002154 Ga0075364_100021543 199
452 3300006178 Ga0075367_10000864 Ga0075367_100008649 199
453 3300006186 Ga0075369_10000572 Ga0075369_100005726 199
454 3300006186 Ga0075369_10071600 Ga0075369_100716002 199
455 3300006195 Ga0075366_10273803 Ga0075366_102738032 199
456 3300006353 Ga0075370_10028744 Ga0075370_100287442 199
457 3300025728 Ga0207655_1033332 Ga0207655_10333322 199
458 3300025934 Ga0207686_10034050 Ga0207686_100340503 199
459 3300027866 Ga0209813_10002516 Ga0209813_100025162 199
460 3300027876 Ga0209974_10086119 Ga0209974_100861192 199
461 3300030745 Ga0316182_1183927 Ga0316182_11839277 199
462 3300037418 Ga0395900_0410384 Ga0395900_0410384_688_1299 199
463 3300037418 Ga0395900_0669928 Ga0395900_0669928_79_705 199
464 3300038443 Ga0395901_0157544 Ga0395901_0157544_774_1400 199
465 3300038443 Ga0395901_0505670 Ga0395901_0505670_566_1177 199
466 3300050489 nmdc:mga03683_2083_c3 nmdc:mga03683_2083_c3_327_926 199
467 3300050491 nmdc:mga00v17_192012_c1 nmdc:mga00v17_192012_c1_233_844 199
468 3300050491 nmdc:mga00v17_245_c1 nmdc:mga00v17_245_c1_159_758 199
469 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_347532_348131 199
470 3300050493 nmdc:mga0k408_342043_c1 nmdc:mga0k408_342043_c1_158_757 199
471 3300050494 nmdc:mga06z11_304_c1 nmdc:mga06z11_304_c1_6675_7274 199
472 3300050495 nmdc:mga04h51_302_c1 nmdc:mga04h51_302_c1_9878_10477 199
473 3300050496 nmdc:mga07m45_218194_c1 nmdc:mga07m45_218194_c1_177_776 199
474 3300050516 nmdc:mga0sz30_68380_c1 nmdc:mga0sz30_68380_c1_794_1405 199
475 3300050516 nmdc:mga0sz30_984_c1 nmdc:mga0sz30_984_c1_4054_4653 199
476 3300053137 Ga0500561_0000001 Ga0500561_0000001_376211_376810 199
477 3300053153 Ga0500616_0004882 Ga0500616_0004882_5307_5906 199
478 iso_pu_bacteria 2593339198 2595318375 199
479 3300005329 Ga0070683_100043262 Ga0070683_1000432625 200
480 3300005535 Ga0070684_100127215 Ga0070684_1001272152 200
481 3300013105 Ga0157369_10005600 Ga0157369_1000560016 200
482 3300025728 Ga0207655_1033319 Ga0207655_10333192 200
483 3300037471 Ga0395905_0002366 Ga0395905_0002366_6828_7439 200
484 3300049534 Ga0501318_010939 Ga0501318_010939_242_931 200
485 iso_pu_bacteria 2554235469 2556064379 200
486 iso_pu_bacteria 2711768088 2712197446 200
487 3300005530 Ga0070679_100306236 Ga0070679_1003062362 201
488 3300005563 Ga0068855_100401834 Ga0068855_1004018342 201
489 3300025949 Ga0207667_10311607 Ga0207667_103116072 201
490 3300026035 Ga0207703_10029465 Ga0207703_100294653 201
491 iso_pu_bacteria 2904113452 2904116733 201
492 3300002067 JGI24735J21928_10000992 JGI24735J21928_100009922 202
493 3300005336 Ga0070680_100386874 Ga0070680_1003868742 202
494 3300005354 Ga0070675_100108512 Ga0070675_1001085122 202
495 3300025917 Ga0207660_10492144 Ga0207660_104921442 202
496 3300005441 Ga0070700_100211242 Ga0070700_1002112422 203
497 3300026075 Ga0207708_10582568 Ga0207708_105825681 203
498 3300005367 Ga0070667_100007084 Ga0070667_1000070845 204
499 3300006237 Ga0097621_100116948 Ga0097621_1001169482 204
500 3300006358 Ga0068871_100255217 Ga0068871_1002552172 204
501 3300030736 Ga0316180_1051467 Ga0316180_10514671 206
502 3300041410 Ga0439461_0000205 Ga0439461_0000205_3071_3700 206
503 3300037418 Ga0395900_0018903 Ga0395900_0018903_2016_2648 207
504 3300001990 JGI24737J22298_10000004 JGI24737J22298_1000000454 209
505 3300053108 Ga0500562_000009 Ga0500562_000009_90852_91490 209
506 3300001904 JGI24736J21556_1012656 JGI24736J21556_10126562 211
507 3300005335 Ga0070666_10000333 Ga0070666_100003335 211
508 3300005356 Ga0070674_100011284 Ga0070674_1000112842 211
509 3300006881 Ga0068865_100334941 Ga0068865_1003349412 211
510 3300025903 Ga0207680_10017349 Ga0207680_100173495 211
511 3300025904 Ga0207647_10000004 Ga0207647_10000004347 211
512 3300025937 Ga0207669_10011252 Ga0207669_100112526 211

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

40

228

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.972 29 209
7cub-assembly1.cif.gz_C 2.55-angstrom cryo-em structure of cytochrome bo3 from escherichia coli in native membrane 0.9514 29 209
7rh5-assembly1.cif.gz_S mycobacterial ciii2civ2 supercomplex, inhibitor free 0.9377 32 208
7qhm-assembly1.cif.gz_S cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.9302 32 208
7e1v-assembly1.cif.gz_G cryo-em structure of apo hybrid respiratory supercomplex consisting of mycobacterium tuberculosis complexiii and mycobacterium smegmatis complexiv 0.9258 32 203
ID Description Score Start End Superfamily
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9706 28 211 1.20.120.80
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9553 28 211 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9415 32 206 1.20.120.80
1fftH00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8963 33 208 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.8919 32 206 1.20.120.80
ID Description Score Start End GO Terms
AF-A0A1F8J280-F1-model_v4 Heme-copper oxidase subunit III family profile domain-containing protein 0.9848 23 209 GO:0004129
GO:0005886
GO:0019646
AF-A0A271KWN0-F1-model_v4 deleted 0.9834 29 209
AF-A0A368A7B9-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9829 28 209 GO:0004129
GO:0005886
GO:0009486
GO:0019646
AF-A0A2U0Y2M7-F1-model_v4 deleted 0.9826 33 211
AF-A0A5U6TQ07-F1-model_v4 Cytochrome bo(3) ubiquinol oxidase subunit 3 (Cytochrome o ubiquinol oxidase subunit 3) (Oxidase bo(3) subunit 3) (Ubiquinol oxidase polypeptide III) (Ubiquinol oxidase subunit 3) 0.9826 67 209 GO:0004129
GO:0005886
GO:0009486
GO:0019646

Feature Viewer

pLDDT pTM Quality
77.98 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map