F457415

General Info

Members Datasets Scaffolds Average Seq Length
512 222 1024 340

Family's Representative Sequence

Representative Sequence 3300006914|Ga0075436_100175551|Ga0075436_1001755511
Length 385
Sequence LETRICSGFSSRVLRRRGLTLSSSFEYHADALGCSSLMARTNRRTAVVLFQLGGPDSIDSIEPFLYNLFCDPDIIDFPFAKLGRKPLAKLISTTRAKKVQHHYEVIGGGSPIRRHTEQQARALERRLAECGVDARCFVAMRYWHPFTEEAVAGIEAGGYSHVVLLPLYPQYSRTTTGSSLNEWHRRFRLQGRQLTCIREFYQNEQYLDALARKIDEALIRFADPSDVVLVFSAHSVPVAVIAQGDPYQRQIEETVRLVMQRGAWTNRPVLCYQSKVGASKWLQPSLRSTIRELAGSGVRKLCVVPISFVSDHVETLGEIDHEGRELAHAAGIEQFEMTCGLNDAPEFIAALAELVVDSLGKETSQAEKLVSAAALPLLADGAALA

Samples

Sample ID Description Type Environment
1 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
100 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
101 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
102 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
157 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
160 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
161 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
165 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
166 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
184 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
185 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
186 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
209 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.44
Metatranscriptomes 1.56
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.86
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 16.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075436_100175551 3300006914 Bacteria 1513
2 MBSR1b_contig_803434 2162886012 Bacteria 1983
3 MBSR1b_contig_8058958 2162886012 Unclassified 2478
4 MBSR1b_contig_9547313 2162886012 Unclassified 2478
5 LJNas_1000058 3300000546 Bacteria 15006
6 rootL2_10311728 3300003322 Unclassified 1343
7 Ga0065715_10094631 3300005293 Unclassified 4286
8 Ga0070658_10022893 3300005327 Bacteria 5015
9 Ga0070658_10084135 3300005327 Bacteria 2616
10 Ga0070676_10050649 3300005328 Unclassified 2435
11 Ga0070676_10073683 3300005328 Bacteria 2055
12 Ga0070683_100049184 3300005329 Unclassified 3899
13 Ga0070683_100110281 3300005329 Bacteria 2596
14 Ga0070683_100131578 3300005329 Bacteria 2368
15 Ga0070690_100017883 3300005330 Unclassified 4273
16 Ga0070690_100026178 3300005330 Bacteria 3596
17 Ga0070690_100106973 3300005330 Bacteria 1861
18 Ga0070670_100010358 3300005331 Bacteria 7956
19 Ga0070670_100072252 3300005331 Bacteria 2963
20 Ga0070670_100115428 3300005331 Bacteria 2315
21 Ga0068869_100003805 3300005334 Bacteria 9298
22 Ga0068869_100028184 3300005334 Unclassified 3922
23 Ga0068869_100031187 3300005334 Bacteria 3749
24 Ga0068868_100001388 3300005338 Bacteria 16720
25 Ga0068868_100010251 3300005338 Bacteria 6774
26 Ga0068868_100055616 3300005338 Bacteria 3123
27 Ga0068868_100076530 3300005338 Bacteria 2675
28 Ga0068868_100175203 3300005338 Bacteria 1777
29 Ga0068868_100222458 3300005338 Unclassified 1581
30 Ga0070660_100055574 3300005339 Bacteria 3059
31 Ga0070689_100030563 3300005340 Unclassified 4089
32 Ga0070689_100413663 3300005340 Bacteria 1142
33 Ga0070687_100021507 3300005343 Bacteria 3034
34 Ga0070661_100011130 3300005344 Bacteria 6265
35 Ga0070692_10189906 3300005345 Unclassified 1196
36 Ga0070675_100031008 3300005354 Unclassified 4319
37 Ga0070671_100247547 3300005355 Bacteria 1514
38 Ga0070659_100028794 3300005366 Bacteria 4291
39 Ga0070659_100044429 3300005366 Unclassified 3478
40 Ga0070659_100076169 3300005366 Bacteria 2675
41 Ga0070667_100019274 3300005367 Bacteria 5659
42 Ga0070667_100354921 3300005367 Unclassified 1328
43 Ga0070709_10001336 3300005434 Bacteria 13449
44 Ga0070709_10025918 3300005434 Bacteria 3469
45 Ga0070709_10047376 3300005434 Bacteria 2677
46 Ga0070709_10108512 3300005434 Unclassified 1862
47 Ga0070709_10176503 3300005434 Unclassified 1497
48 Ga0070714_100001155 3300005435 Bacteria 19000
49 Ga0070714_100002082 3300005435 Bacteria 14656
50 Ga0070714_100088170 3300005435 Bacteria 2714
51 Ga0070713_100000222 3300005436 Bacteria 37755
52 Ga0070713_100001170 3300005436 Bacteria 16769
53 Ga0070713_100002768 3300005436 Bacteria 11454
54 Ga0070713_100029759 3300005436 Bacteria 4328
55 Ga0070713_100046943 3300005436 Bacteria 3547
56 Ga0070713_100062423 3300005436 Unclassified 3121
57 Ga0070713_100148109 3300005436 Bacteria 2085
58 Ga0070713_100210374 3300005436 Bacteria 1760
59 Ga0070710_10010228 3300005437 Bacteria 4605
60 Ga0070710_10022241 3300005437 Bacteria 3313
61 Ga0070710_10054656 3300005437 Bacteria 2253
62 Ga0070701_10121315 3300005438 Unclassified 1473
63 Ga0070711_100000250 3300005439 Bacteria 27482
64 Ga0070711_100004564 3300005439 Bacteria 8194
65 Ga0070711_100008831 3300005439 Bacteria 6184
66 Ga0070711_100048003 3300005439 Bacteria 2917
67 Ga0070711_100055457 3300005439 Bacteria 2738
68 Ga0070711_100063338 3300005439 Bacteria 2581
69 Ga0070711_100201200 3300005439 Bacteria 1537
70 Ga0070708_100000263 3300005445 Bacteria 39351
71 Ga0070708_100000558 3300005445 Bacteria 27878
72 Ga0070708_100002193 3300005445 Bacteria 15093
73 Ga0070708_100009126 3300005445 Bacteria 7998
74 Ga0070708_100017246 3300005445 Bacteria 6016
75 Ga0070708_100096733 3300005445 Bacteria 2697
76 Ga0070708_100188710 3300005445 Unclassified 1928
77 Ga0070708_100546615 3300005445 Bacteria 1093
78 Ga0070663_100014048 3300005455 Bacteria 5129
79 Ga0070663_100114571 3300005455 Bacteria 2030
80 Ga0070662_100004926 3300005457 Bacteria 8483
81 Ga0070662_100092979 3300005457 Bacteria 2268
82 Ga0070681_10050621 3300005458 Bacteria 4144
83 Ga0070681_10101043 3300005458 Bacteria 2829
84 Ga0068867_100087484 3300005459 Bacteria 2359
85 Ga0070685_10012179 3300005466 Unclassified 4512
86 Ga0070706_100000869 3300005467 Bacteria 33228
87 Ga0070706_100001289 3300005467 Bacteria 26742
88 Ga0070706_100004617 3300005467 Bacteria 13217
89 Ga0070706_100033863 3300005467 Bacteria 4715
90 Ga0070706_100326627 3300005467 Unclassified 1431
91 Ga0070707_100000557 3300005468 Bacteria 37459
92 Ga0070707_100001379 3300005468 Bacteria 23881
93 Ga0070707_100007238 3300005468 Bacteria 10298
94 Ga0070707_100098992 3300005468 Bacteria 2825
95 Ga0070707_100323948 3300005468 Unclassified 1497
96 Ga0070707_100416399 3300005468 Bacteria 1304
97 Ga0070698_100000456 3300005471 Bacteria 43335
98 Ga0070698_100001775 3300005471 Bacteria 24031
99 Ga0070698_100058450 3300005471 Bacteria 3899
100 Ga0070699_100010568 3300005518 Bacteria 7991
101 Ga0070699_100011952 3300005518 Bacteria 7493
102 Ga0070699_100093508 3300005518 Bacteria 2631
103 Ga0070684_100001735 3300005535 Bacteria 15855
104 Ga0070684_100082939 3300005535 Unclassified 2840
105 Ga0070684_100135942 3300005535 Bacteria 2220
106 Ga0070697_100000496 3300005536 Bacteria 29902
107 Ga0070697_100000770 3300005536 Bacteria 23986
108 Ga0070697_100001425 3300005536 Bacteria 18173
109 Ga0070697_100011634 3300005536 Bacteria 6877
110 Ga0070697_100040738 3300005536 Unclassified 3759
111 Ga0070697_100073759 3300005536 Bacteria 2803
112 Ga0070697_100105659 3300005536 Bacteria 2342
113 Ga0068853_100038686 3300005539 Bacteria 4064
114 Ga0068853_100218558 3300005539 Bacteria 1739
115 Ga0070696_100027238 3300005546 Bacteria 3892
116 Ga0070696_100078565 3300005546 Bacteria 2333
117 Ga0070693_100091885 3300005547 Bacteria 1831
118 Ga0070665_100247596 3300005548 Bacteria 1783
119 Ga0068855_100181200 3300005563 Bacteria 2381
120 Ga0070664_100009649 3300005564 Bacteria 7831
121 Ga0070664_100033433 3300005564 Bacteria 4307
122 Ga0070664_100166493 3300005564 Bacteria 1953
123 Ga0070664_100194243 3300005564 Bacteria 1809
124 Ga0068857_100003122 3300005577 Bacteria 13706
125 Ga0068854_100025696 3300005578 Bacteria 4041
126 Ga0068854_100179635 3300005578 Bacteria 1652
127 Ga0068856_100005505 3300005614 Bacteria 12467
128 Ga0068856_100084676 3300005614 Unclassified 3150
129 Ga0068856_100215079 3300005614 Bacteria 1937
130 Ga0070702_100008055 3300005615 Bacteria 5086
131 Ga0068852_100002809 3300005616 Bacteria 12066
132 Ga0068852_100058029 3300005616 Bacteria 3350
133 Ga0068852_100270594 3300005616 Unclassified 1635
134 Ga0068859_100034638 3300005617 Bacteria 5067
135 Ga0068859_100344779 3300005617 Unclassified 1584
136 Ga0068864_100031475 3300005618 Bacteria 4501
137 Ga0068864_100060662 3300005618 Unclassified 3274
138 Ga0068864_100085903 3300005618 Bacteria 2767
139 Ga0068866_10177688 3300005718 Unclassified 1255
140 Ga0068861_100026458 3300005719 Unclassified 4217
141 Ga0068851_10008323 3300005834 Unclassified 4794
142 Ga0068851_10068827 3300005834 Unclassified 1828
143 Ga0068863_100020063 3300005841 Bacteria 6394
144 Ga0068863_100071840 3300005841 Unclassified 3274
145 Ga0068858_100014600 3300005842 Bacteria 7398
146 Ga0068858_100192899 3300005842 Bacteria 1925
147 Ga0068858_100203612 3300005842 Bacteria 1872
148 Ga0068860_100212824 3300005843 Bacteria 1875
149 Ga0068862_100030469 3300005844 Bacteria 4547
150 Ga0068862_100031786 3300005844 Unclassified 4458
151 Ga0070717_10002623 3300006028 Bacteria 12685
152 Ga0070717_10008182 3300006028 Bacteria 7807
153 Ga0070717_10009015 3300006028 Bacteria 7487
154 Ga0070717_10009388 3300006028 Bacteria 7348
155 Ga0070717_10117823 3300006028 Bacteria 2272
156 Ga0070717_10171136 3300006028 Unclassified 1889
157 Ga0070715_10126179 3300006163 Unclassified 1226
158 Ga0070716_100000526 3300006173 Bacteria 16009
159 Ga0070716_100018597 3300006173 Unclassified 3622
160 Ga0070716_100034123 3300006173 Bacteria 2787
161 Ga0070716_100070723 3300006173 Unclassified 2050
162 Ga0070716_100076727 3300006173 Unclassified 1981
163 Ga0070716_100095152 3300006173 Bacteria 1813
164 Ga0070716_100188075 3300006173 Unclassified 1362
165 Ga0070712_100000056 3300006175 Bacteria 56756
166 Ga0070712_100000321 3300006175 Bacteria 27066
167 Ga0070712_100000550 3300006175 Bacteria 21698
168 Ga0070712_100001369 3300006175 Bacteria 14787
169 Ga0070712_100008810 3300006175 Bacteria 6354
170 Ga0070712_100030074 3300006175 Bacteria 3646
171 Ga0097621_100002636 3300006237 Bacteria 12280
172 Ga0097621_100054590 3300006237 Bacteria 3259
173 Ga0097621_100175916 3300006237 Bacteria 1847
174 Ga0097621_100290071 3300006237 Bacteria 1442
175 Ga0068871_100003996 3300006358 Bacteria 10203
176 Ga0068871_100079957 3300006358 Bacteria 2706
177 Ga0075428_100027466 3300006844 Bacteria 6297
178 Ga0075433_10001901 3300006852 Bacteria 15708
179 Ga0075433_10006125 3300006852 Bacteria 9476
180 Ga0075434_100000416 3300006871 Bacteria 31534
181 Ga0075434_100002666 3300006871 Bacteria 15766
182 Ga0075434_100029879 3300006871 Bacteria 5364
183 Ga0075434_100266462 3300006871 Bacteria 1732
184 Ga0068865_100019578 3300006881 Unclassified 4381
185 Ga0075436_100000451 3300006914 Bacteria 26434
186 Ga0075436_100015556 3300006914 Bacteria 5208
187 Ga0097620_100034638 3300006931 Bacteria 5067
188 Ga0097620_100344733 3300006931 Unclassified 1584
189 Ga0075435_100000702 3300007076 Bacteria 20734
190 Ga0075435_100097501 3300007076 Bacteria 2433
191 Ga0105240_10031322 3300009093 Bacteria 6899
192 Ga0105240_10060001 3300009093 Bacteria 4744
193 Ga0105240_10107108 3300009093 Bacteria 3389
194 Ga0105240_10279416 3300009093 Bacteria 1919
195 Ga0111539_10148898 3300009094 Bacteria 2740
196 Ga0105245_10005032 3300009098 Bacteria 11623
197 Ga0105245_10064843 3300009098 Bacteria 3302
198 Ga0105245_10072899 3300009098 Unclassified 3121
199 Ga0105247_10011984 3300009101 Bacteria 5207
200 Ga0105247_10022538 3300009101 Bacteria 3792
201 Ga0105247_10060158 3300009101 Bacteria 2354
202 Ga0105247_10216705 3300009101 Bacteria 1294
203 Ga0114129_10209975 3300009147 Unclassified 2632
204 Ga0105241_10013651 3300009174 Bacteria 5952
205 Ga0105241_10023624 3300009174 Bacteria 4560
206 Ga0105241_10044390 3300009174 Bacteria 3368
207 Ga0105242_10004119 3300009176 Bacteria 11313
208 Ga0105242_10045675 3300009176 Bacteria 3551
209 Ga0105242_10049687 3300009176 Bacteria 3413
210 Ga0105248_10080176 3300009177 Bacteria 3668
211 Ga0105248_10149474 3300009177 Bacteria 2635
212 Ga0105248_10213667 3300009177 Bacteria 2173
213 Ga0105237_10018287 3300009545 Bacteria 7252
214 Ga0105237_10033684 3300009545 Bacteria 5189
215 Ga0105237_10075259 3300009545 Unclassified 3368
216 Ga0105237_10192368 3300009545 Bacteria 2040
217 Ga0105237_10278765 3300009545 Bacteria 1674
218 Ga0105237_10531541 3300009545 Bacteria 1183
219 Ga0105249_10014405 3300009553 Bacteria 6990
220 Ga0105249_10026981 3300009553 Bacteria 5180
221 Ga0105249_10160249 3300009553 Bacteria 2173
222 Ga0105239_10109470 3300010375 Bacteria 3062
223 Ga0105246_10150737 3300011119 Bacteria 1760
224 Ga0105246_10197169 3300011119 Bacteria 1563
225 Ga0105246_10263493 3300011119 Bacteria 1374
226 Ga0157373_10000999 3300013100 Bacteria 21871
227 Ga0157371_10013192 3300013102 Bacteria 6289
228 Ga0157371_10024751 3300013102 Bacteria 4380
229 Ga0157369_10000764 3300013105 Bacteria 41564
230 Ga0157369_10028565 3300013105 Bacteria 6172
231 Ga0157369_10240058 3300013105 Unclassified 1893
232 Ga0157374_10011053 3300013296 Bacteria 7798
233 Ga0157374_10022067 3300013296 Bacteria 5674
234 Ga0157374_10070352 3300013296 Unclassified 3297
235 Ga0157374_10225867 3300013296 Bacteria 1838
236 Ga0157378_10001866 3300013297 Bacteria 18918
237 Ga0157378_10020817 3300013297 Bacteria 5768
238 Ga0163162_10024000 3300013306 Bacteria 6018
239 Ga0163162_10032010 3300013306 Bacteria 5220
240 Ga0163162_10078779 3300013306 Bacteria 3360
241 Ga0163162_10099714 3300013306 Bacteria 2996
242 Ga0163162_10271051 3300013306 Bacteria 1829
243 Ga0163162_10283747 3300013306 Bacteria 1788
244 Ga0157372_10029424 3300013307 Bacteria 5997
245 Ga0157372_10038756 3300013307 Bacteria 5259
246 Ga0157372_10605619 3300013307 Bacteria 1277
247 Ga0157375_10098012 3300013308 Bacteria 3007
248 Ga0157375_10156487 3300013308 Unclassified 2418
249 Ga0163163_10066089 3300014325 Bacteria 3591
250 Ga0163163_10146947 3300014325 Bacteria 2402
251 Ga0163163_10222091 3300014325 Bacteria 1938
252 Ga0163163_10223283 3300014325 Bacteria 1933
253 Ga0182008_10016865 3300014497 Bacteria 3790
254 Ga0182008_10019495 3300014497 Bacteria 3500
255 Ga0157379_10003349 3300014968 Bacteria 13580
256 Ga0157379_10006619 3300014968 Bacteria 9997
257 Ga0157376_10017252 3300014969 Bacteria 5500
258 Ga0157376_10124636 3300014969 Unclassified 2289
259 Ga0157376_10254394 3300014969 Bacteria 1642
260 Ga0157376_10257907 3300014969 Bacteria 1632
261 Ga0182007_10012336 3300015262 Bacteria 3290
262 Ga0182005_1007500 3300015265 Bacteria 3268
263 Ga0163161_10006561 3300017792 Bacteria 8053
264 Ga0224569_101553 3300022732 Bacteria 1920
265 Ga0224569_101875 3300022732 Unclassified 1738
266 Ga0224571_101475 3300022734 Bacteria 1474
267 Ga0224572_1000833 3300024225 Bacteria 4116
268 Ga0224572_1001423 3300024225 Bacteria 3535
269 Ga0224572_1021218 3300024225 Unclassified 1246
270 Ga0228598_1000770 3300024227 Bacteria 6876
271 Ga0228598_1000785 3300024227 Bacteria 6829
272 Ga0228598_1001331 3300024227 Bacteria 5438
273 Ga0207656_10036769 3300025321 Bacteria 2057
274 Ga0207682_10034512 3300025893 Unclassified 2039
275 Ga0207642_10008761 3300025899 Bacteria 3491
276 Ga0207642_10085295 3300025899 Unclassified 1545
277 Ga0207642_10138065 3300025899 Bacteria 1281
278 Ga0207710_10056607 3300025900 Unclassified 1770
279 Ga0207647_10007613 3300025904 Bacteria 7804
280 Ga0207685_10033698 3300025905 Bacteria 1853
281 Ga0207699_10001113 3300025906 Bacteria 12723
282 Ga0207699_10028263 3300025906 Unclassified 3115
283 Ga0207699_10042888 3300025906 Bacteria 2625
284 Ga0207699_10074633 3300025906 Bacteria 2084
285 Ga0207645_10002827 3300025907 Bacteria 13478
286 Ga0207645_10004310 3300025907 Bacteria 10557
287 Ga0207643_10000391 3300025908 Bacteria 29201
288 Ga0207684_10000311 3300025910 Bacteria 69074
289 Ga0207684_10001754 3300025910 Bacteria 22933
290 Ga0207684_10002779 3300025910 Bacteria 17408
291 Ga0207684_10276301 3300025910 Unclassified 1449
292 Ga0207707_10052837 3300025912 Bacteria 3536
293 Ga0207707_10068990 3300025912 Unclassified 3081
294 Ga0207695_10120544 3300025913 Bacteria 2592
295 Ga0207695_10397547 3300025913 Bacteria 1263
296 Ga0207693_10000119 3300025915 Bacteria 69804
297 Ga0207693_10000362 3300025915 Bacteria 41574
298 Ga0207693_10000457 3300025915 Bacteria 37236
299 Ga0207693_10002833 3300025915 Bacteria 15021
300 Ga0207693_10009746 3300025915 Bacteria 7822
301 Ga0207693_10011472 3300025915 Bacteria 7168
302 Ga0207693_10036415 3300025915 Bacteria 3879
303 Ga0207663_10009908 3300025916 Bacteria 5046
304 Ga0207663_10021622 3300025916 Bacteria 3665
305 Ga0207663_10056950 3300025916 Bacteria 2461
306 Ga0207663_10157231 3300025916 Bacteria 1600
307 Ga0207663_10190166 3300025916 Unclassified 1473
308 Ga0207662_10035606 3300025918 Bacteria 2908
309 Ga0207657_10000246 3300025919 Bacteria 57698
310 Ga0207657_10001266 3300025919 Bacteria 26953
311 Ga0207657_10018927 3300025919 Bacteria 6554
312 Ga0207649_10000250 3300025920 Bacteria 43495
313 Ga0207652_10082441 3300025921 Unclassified 2814
314 Ga0207646_10000565 3300025922 Bacteria 48737
315 Ga0207646_10002216 3300025922 Bacteria 23136
316 Ga0207646_10015220 3300025922 Bacteria 7277
317 Ga0207650_10000124 3300025925 Bacteria 97031
318 Ga0207650_10087692 3300025925 Bacteria 2372
319 Ga0207687_10044169 3300025927 Bacteria 3074
320 Ga0207687_10048098 3300025927 Bacteria 2959
321 Ga0207700_10000528 3300025928 Bacteria 22511
322 Ga0207700_10040290 3300025928 Bacteria 3408
323 Ga0207700_10041027 3300025928 Bacteria 3383
324 Ga0207700_10049012 3300025928 Bacteria 3139
325 Ga0207664_10014108 3300025929 Bacteria 5762
326 Ga0207664_10027348 3300025929 Bacteria 4323
327 Ga0207664_10122212 3300025929 Bacteria 2181
328 Ga0207664_10172586 3300025929 Bacteria 1851
329 Ga0207664_10324813 3300025929 Bacteria 1358
330 Ga0207644_10102577 3300025931 Bacteria 2152
331 Ga0207690_10027196 3300025932 Bacteria 3613
332 Ga0207690_10123203 3300025932 Unclassified 1886
333 Ga0207706_10000139 3300025933 Bacteria 79096
334 Ga0207706_10006099 3300025933 Bacteria 11189
335 Ga0207706_10215988 3300025933 Unclassified 1680
336 Ga0207686_10019966 3300025934 Unclassified 3821
337 Ga0207686_10024621 3300025934 Bacteria 3490
338 Ga0207704_10109955 3300025938 Bacteria 1860
339 Ga0207665_10000281 3300025939 Bacteria 35365
340 Ga0207665_10002621 3300025939 Bacteria 12104
341 Ga0207665_10008314 3300025939 Bacteria 6851
342 Ga0207665_10024320 3300025939 Bacteria 3994
343 Ga0207665_10035553 3300025939 Bacteria 3308
344 Ga0207665_10100254 3300025939 Unclassified 2021
345 Ga0207665_10122345 3300025939 Bacteria 1839
346 Ga0207691_10005498 3300025940 Bacteria 12243
347 Ga0207711_10027041 3300025941 Bacteria 4816
348 Ga0207689_10001053 3300025942 Bacteria 26527
349 Ga0207689_10008820 3300025942 Bacteria 8764
350 Ga0207689_10018000 3300025942 Bacteria 5966
351 Ga0207689_10046639 3300025942 Bacteria 3581
352 Ga0207661_10004629 3300025944 Bacteria 9638
353 Ga0207679_10000084 3300025945 Bacteria 82946
354 Ga0207679_10111941 3300025945 Bacteria 2156
355 Ga0207679_10225520 3300025945 Bacteria 1579
356 Ga0207667_10077265 3300025949 Unclassified 3453
357 Ga0207667_10447846 3300025949 Unclassified 1312
358 Ga0207668_10137930 3300025972 Bacteria 1871
359 Ga0207640_10134245 3300025981 Bacteria 1794
360 Ga0207658_10074843 3300025986 Bacteria 2574
361 Ga0207677_10015600 3300026023 Bacteria 4475
362 Ga0207677_10019254 3300026023 Bacteria 4119
363 Ga0207677_10032208 3300026023 Bacteria 3367
364 Ga0207703_10007331 3300026035 Bacteria 8768
365 Ga0207703_10064095 3300026035 Unclassified 3015
366 Ga0207703_10178878 3300026035 Bacteria 1871
367 Ga0207703_10269412 3300026035 Unclassified 1542
368 Ga0207639_10015091 3300026041 Bacteria 5442
369 Ga0207639_10076660 3300026041 Unclassified 2633
370 Ga0207678_10002403 3300026067 Bacteria 17014
371 Ga0207678_10004160 3300026067 Bacteria 12993
372 Ga0207678_10074183 3300026067 Bacteria 2915
373 Ga0207702_10174579 3300026078 Unclassified 1973
374 Ga0207641_10000006 3300026088 Bacteria 442569
375 Ga0207641_10030534 3300026088 Bacteria 4465
376 Ga0207641_10191645 3300026088 Bacteria 1879
377 Ga0207648_10003233 3300026089 Bacteria 17155
378 Ga0207648_10053181 3300026089 Bacteria 3540
379 Ga0207648_10113508 3300026089 Bacteria 2380
380 Ga0207676_10000615 3300026095 Bacteria 29142
381 Ga0207674_10001059 3300026116 Bacteria 35825
382 Ga0207675_100012837 3300026118 Bacteria 7823
383 Ga0207683_10004329 3300026121 Bacteria 12262
384 Ga0207428_10173383 3300027907 Bacteria 1632
385 Ga0265356_1000234 3300028017 Bacteria 10461
386 Ga0265356_1002696 3300028017 Bacteria 2311
387 Ga0268266_10085053 3300028379 Bacteria 2763
388 Ga0268266_10182278 3300028379 Bacteria 1912
389 Ga0268264_10041708 3300028381 Unclassified 3797
390 Ga0268264_10126723 3300028381 Bacteria 2257
391 Ga0268264_10179506 3300028381 Bacteria 1921
392 Ga0268264_10412482 3300028381 Bacteria 1301
393 Ga0265338_10000750 3300028800 Bacteria 55295
394 Ga0265338_10020898 3300028800 Bacteria 6855
395 Ga0265338_10080739 3300028800 Bacteria 2731
396 Ga0265762_1000114 3300030760 Bacteria 11961
397 Ga0265762_1009168 3300030760 Unclassified 1764
398 Ga0265762_1009802 3300030760 Bacteria 1710
399 Ga0265760_10001989 3300031090 Bacteria 6006
400 Ga0265760_10002008 3300031090 Bacteria 5986
401 Ga0265760_10002801 3300031090 Bacteria 5093
402 Ga0265760_10005707 3300031090 Bacteria 3560
403 Ga0265760_10049566 3300031090 Unclassified 1263
404 Ga0265325_10008212 3300031241 Bacteria 6179
405 Ga0265339_10036741 3300031249 Bacteria 2739
406 Ga0265339_10039070 3300031249 Bacteria 2644
407 Ga0265316_10027868 3300031344 Unclassified 4669
408 Ga0265314_10033186 3300031711 Unclassified 3789
409 Ga0265342_10030738 3300031712 Bacteria 3325
410 Ga0307416_100167533 3300032002 Bacteria 2040
411 Ga0373926_0010899 3300035083 Bacteria 3052
412 Ga0373944_0046793 3300035089 Bacteria 1353
413 Ga0373936_0003365 3300035113 Bacteria 5993
414 Ga0373945_0023280 3300035116 Bacteria 2139
415 Ga0373954_0048466 3300035118 Bacteria 1990
416 Ga0373943_0000124 3300035170 Bacteria 29045
417 Ga0373946_0009646 3300035171 Bacteria 3562
418 Ga0373955_0090680 3300035172 Bacteria 1741
419 Ga0373931_0008636 3300035691 Bacteria 4841
420 Ga0373935_0007557 3300035692 Bacteria 6508
421 Ga0373935_0155344 3300035692 Bacteria 1555
422 Ga0373927_0000099 3300035695 Bacteria 65306
423 Ga0373927_0041962 3300035695 Bacteria 2967
424 Ga0373927_0107732 3300035695 Bacteria 1815
425 Ga0373927_0135756 3300035695 Bacteria 1608
426 Ga0373933_0056953 3300035724 Bacteria 2347
427 Ga0373947_0001961 3300035725 Bacteria 12597
428 Ga0373937_0263426 3300036401 Bacteria 1626
429 Ga0373925_0000227 3300037068 Bacteria 60089
430 Ga0373925_0191023 3300037068 Unclassified 1625
431 Ga0395899_0006619 3300037312 Bacteria 8980
432 Ga0395900_0284805 3300037418 Bacteria 1643
433 Ga0395901_0126652 3300038443 Bacteria 2684
434 Ga0436363_0018048 3300039450 Bacteria 5123
435 Ga0436362_0335205 3300039453 Bacteria 3018
436 Ga0451577_0000157 3300042876 Bacteria 151953
437 Ga0451577_0072871 3300042876 Bacteria 3065
438 Ga0453683_0007143 3300044673 Bacteria 7610
439 Ga0453683_0068498 3300044673 Bacteria 2219
440 Ga0453684_0001152 3300044712 Bacteria 82543
441 Ga0453684_0315112 3300044712 Bacteria 1774
442 Ga0451576_0022561 3300045051 Bacteria 6824
443 Ga0451576_0331781 3300045051 Bacteria 1592
444 Ga0495651_0026164 3300046462 Unclassified 4544
445 Ga0495580_0000032 3300046472 Bacteria 75630
446 Ga0495580_0000107 3300046472 Bacteria 55553
447 Ga0495580_0003635 3300046472 Bacteria 13060
448 Ga0495580_0003685 3300046472 Bacteria 12994
449 Ga0495580_0007884 3300046472 Bacteria 8522
450 Ga0495580_0012698 3300046472 Bacteria 6457
451 Ga0495580_0020652 3300046472 Bacteria 4872
452 Ga0495580_0026336 3300046472 Unclassified 4240
453 Ga0495580_0059680 3300046472 Bacteria 2681
454 Ga0495582_0014474 3300046473 Bacteria 4335
455 Ga0495582_0086843 3300046473 Unclassified 1741
456 Ga0495664_0039980 3300046477 Bacteria 2772
457 Ga0495628_0100419 3300046516 Bacteria 2234
458 Ga0495630_0016481 3300046517 Bacteria 5402
459 Ga0495665_0008807 3300046531 Bacteria 5477
460 Ga0495587_0238151 3300046536 Unclassified 1024
461 Ga0495667_0016744 3300046559 Bacteria 4952
462 Ga0495667_0083253 3300046559 Unclassified 2078
463 Ga0495635_0208048 3300046663 Unclassified 1326
464 Ga0495623_0093825 3300046679 Unclassified 1837
465 Ga0495624_0099773 3300046690 Bacteria 1788
466 Ga0495674_0003493 3300047319 Bacteria 15291
467 Ga0495674_0012272 3300047319 Bacteria 8076
468 Ga0495674_0203254 3300047319 Bacteria 1643
469 Ga0495684_0002797 3300047471 Bacteria 13760
470 Ga0495684_0244725 3300047471 Bacteria 1307
471 Ga0496102_0000537 3300048905 Bacteria 40994
472 Ga0496102_0033371 3300048905 Bacteria 4625
473 Ga0496102_0090668 3300048905 Bacteria 2829
474 Ga0496103_0057171 3300048906 Bacteria 2422
475 Ga0496103_0058329 3300048906 Unclassified 2398
476 Ga0496103_0123589 3300048906 Unclassified 1649
477 Ga0496104_0022249 3300048907 Bacteria 5822
478 Ga0496104_0113070 3300048907 Bacteria 2604
479 Ga0496104_0130966 3300048907 Bacteria 2409
480 Ga0496105_0045868 3300048908 Bacteria 3606
481 Ga0496105_0366493 3300048908 Bacteria 1148
482 Ga0496106_0129709 3300048909 Bacteria 1976
483 Ga0496107_0019356 3300048910 Bacteria 4803
484 Ga0496107_0336470 3300048910 Bacteria 1123
485 Ga0496108_0000200 3300048911 Bacteria 55323
486 Ga0496108_0365789 3300048911 Unclassified 1259
487 Ga0496109_0000149 3300048912 Bacteria 68979
488 Ga0496109_0118728 3300048912 Bacteria 2462
489 Ga0496110_0001586 3300048913 Bacteria 16619
490 Ga0496110_0011987 3300048913 Bacteria 7121
491 Ga0496111_0007059 3300048914 Bacteria 7338
492 Ga0496112_0000070 3300048915 Bacteria 67934
493 Ga0496112_0001099 3300048915 Bacteria 20026
494 Ga0496112_0042095 3300048915 Bacteria 4469
495 Ga0496112_0101917 3300048915 Unclassified 2841
496 Ga0496112_0338521 3300048915 Bacteria 1448
497 Ga0496113_0001103 3300048916 Bacteria 14626
498 Ga0496113_0171417 3300048916 Bacteria 1719
499 Ga0496115_0025819 3300048918 Bacteria 4578
500 Ga0496115_0277908 3300048918 Bacteria 1375
501 Ga0501077_0076760 3300049593 Bacteria 2116
502 nmdc:mga05p37_198654_c1 3300050507 Bacteria 2430
503 nmdc:mga08y16_89566_c1 3300050511 Bacteria 3206
504 nmdc:mga0n895_1682_c1 3300050512 Bacteria 16697
505 nmdc:mga0n895_45735_c1 3300050512 Bacteria 4273
506 nmdc:mga0n895_74282_c1 3300050512 Bacteria 3377
507 nmdc:mga0rr50_4459_c1 3300050513 Bacteria 8240
508 nmdc:mga08x19_1753_c1 3300050514 Bacteria 13370
509 nmdc:mga08x19_337954_c1 3300050514 Bacteria 1050
510 nmdc:mga08x19_54904_c1 3300050514 Bacteria 2566
511 nmdc:mga0a205_1714_c1 3300050515 Bacteria 18910
512 nmdc:mga0a205_2297_c1 3300050515 Bacteria 16866
513 Ga0075436_100175551
514 MBSR1b_contig_803434
515 MBSR1b_contig_8058958
516 MBSR1b_contig_9547313
517 LJNas_1000058
518 rootL2_10311728
519 Ga0065715_10094631
520 Ga0070658_10022893
521 Ga0070658_10084135
522 Ga0070676_10050649
523 Ga0070676_10073683
524 Ga0070683_100049184
525 Ga0070683_100110281
526 Ga0070683_100131578
527 Ga0070690_100017883
528 Ga0070690_100026178
529 Ga0070690_100106973
530 Ga0070670_100010358
531 Ga0070670_100072252
532 Ga0070670_100115428
533 Ga0068869_100003805
534 Ga0068869_100028184
535 Ga0068869_100031187
536 Ga0068868_100001388
537 Ga0068868_100010251
538 Ga0068868_100055616
539 Ga0068868_100076530
540 Ga0068868_100175203
541 Ga0068868_100222458
542 Ga0070660_100055574
543 Ga0070689_100030563
544 Ga0070689_100413663
545 Ga0070687_100021507
546 Ga0070661_100011130
547 Ga0070692_10189906
548 Ga0070675_100031008
549 Ga0070671_100247547
550 Ga0070659_100028794
551 Ga0070659_100044429
552 Ga0070659_100076169
553 Ga0070667_100019274
554 Ga0070667_100354921
555 Ga0070709_10001336
556 Ga0070709_10025918
557 Ga0070709_10047376
558 Ga0070709_10108512
559 Ga0070709_10176503
560 Ga0070714_100001155
561 Ga0070714_100002082
562 Ga0070714_100088170
563 Ga0070713_100000222
564 Ga0070713_100001170
565 Ga0070713_100002768
566 Ga0070713_100029759
567 Ga0070713_100046943
568 Ga0070713_100062423
569 Ga0070713_100148109
570 Ga0070713_100210374
571 Ga0070710_10010228
572 Ga0070710_10022241
573 Ga0070710_10054656
574 Ga0070701_10121315
575 Ga0070711_100000250
576 Ga0070711_100004564
577 Ga0070711_100008831
578 Ga0070711_100048003
579 Ga0070711_100055457
580 Ga0070711_100063338
581 Ga0070711_100201200
582 Ga0070708_100000263
583 Ga0070708_100000558
584 Ga0070708_100002193
585 Ga0070708_100009126
586 Ga0070708_100017246
587 Ga0070708_100096733
588 Ga0070708_100188710
589 Ga0070708_100546615
590 Ga0070663_100014048
591 Ga0070663_100114571
592 Ga0070662_100004926
593 Ga0070662_100092979
594 Ga0070681_10050621
595 Ga0070681_10101043
596 Ga0068867_100087484
597 Ga0070685_10012179
598 Ga0070706_100000869
599 Ga0070706_100001289
600 Ga0070706_100004617
601 Ga0070706_100033863
602 Ga0070706_100326627
603 Ga0070707_100000557
604 Ga0070707_100001379
605 Ga0070707_100007238
606 Ga0070707_100098992
607 Ga0070707_100323948
608 Ga0070707_100416399
609 Ga0070698_100000456
610 Ga0070698_100001775
611 Ga0070698_100058450
612 Ga0070699_100010568
613 Ga0070699_100011952
614 Ga0070699_100093508
615 Ga0070684_100001735
616 Ga0070684_100082939
617 Ga0070684_100135942
618 Ga0070697_100000496
619 Ga0070697_100000770
620 Ga0070697_100001425
621 Ga0070697_100011634
622 Ga0070697_100040738
623 Ga0070697_100073759
624 Ga0070697_100105659
625 Ga0068853_100038686
626 Ga0068853_100218558
627 Ga0070696_100027238
628 Ga0070696_100078565
629 Ga0070693_100091885
630 Ga0070665_100247596
631 Ga0068855_100181200
632 Ga0070664_100009649
633 Ga0070664_100033433
634 Ga0070664_100166493
635 Ga0070664_100194243
636 Ga0068857_100003122
637 Ga0068854_100025696
638 Ga0068854_100179635
639 Ga0068856_100005505
640 Ga0068856_100084676
641 Ga0068856_100215079
642 Ga0070702_100008055
643 Ga0068852_100002809
644 Ga0068852_100058029
645 Ga0068852_100270594
646 Ga0068859_100034638
647 Ga0068859_100344779
648 Ga0068864_100031475
649 Ga0068864_100060662
650 Ga0068864_100085903
651 Ga0068866_10177688
652 Ga0068861_100026458
653 Ga0068851_10008323
654 Ga0068851_10068827
655 Ga0068863_100020063
656 Ga0068863_100071840
657 Ga0068858_100014600
658 Ga0068858_100192899
659 Ga0068858_100203612
660 Ga0068860_100212824
661 Ga0068862_100030469
662 Ga0068862_100031786
663 Ga0070717_10002623
664 Ga0070717_10008182
665 Ga0070717_10009015
666 Ga0070717_10009388
667 Ga0070717_10117823
668 Ga0070717_10171136
669 Ga0070715_10126179
670 Ga0070716_100000526
671 Ga0070716_100018597
672 Ga0070716_100034123
673 Ga0070716_100070723
674 Ga0070716_100076727
675 Ga0070716_100095152
676 Ga0070716_100188075
677 Ga0070712_100000056
678 Ga0070712_100000321
679 Ga0070712_100000550
680 Ga0070712_100001369
681 Ga0070712_100008810
682 Ga0070712_100030074
683 Ga0097621_100002636
684 Ga0097621_100054590
685 Ga0097621_100175916
686 Ga0097621_100290071
687 Ga0068871_100003996
688 Ga0068871_100079957
689 Ga0075428_100027466
690 Ga0075433_10001901
691 Ga0075433_10006125
692 Ga0075434_100000416
693 Ga0075434_100002666
694 Ga0075434_100029879
695 Ga0075434_100266462
696 Ga0068865_100019578
697 Ga0075436_100000451
698 Ga0075436_100015556
699 Ga0097620_100034638
700 Ga0097620_100344733
701 Ga0075435_100000702
702 Ga0075435_100097501
703 Ga0105240_10031322
704 Ga0105240_10060001
705 Ga0105240_10107108
706 Ga0105240_10279416
707 Ga0111539_10148898
708 Ga0105245_10005032
709 Ga0105245_10064843
710 Ga0105245_10072899
711 Ga0105247_10011984
712 Ga0105247_10022538
713 Ga0105247_10060158
714 Ga0105247_10216705
715 Ga0114129_10209975
716 Ga0105241_10013651
717 Ga0105241_10023624
718 Ga0105241_10044390
719 Ga0105242_10004119
720 Ga0105242_10045675
721 Ga0105242_10049687
722 Ga0105248_10080176
723 Ga0105248_10149474
724 Ga0105248_10213667
725 Ga0105237_10018287
726 Ga0105237_10033684
727 Ga0105237_10075259
728 Ga0105237_10192368
729 Ga0105237_10278765
730 Ga0105237_10531541
731 Ga0105249_10014405
732 Ga0105249_10026981
733 Ga0105249_10160249
734 Ga0105239_10109470
735 Ga0105246_10150737
736 Ga0105246_10197169
737 Ga0105246_10263493
738 Ga0157373_10000999
739 Ga0157371_10013192
740 Ga0157371_10024751
741 Ga0157369_10000764
742 Ga0157369_10028565
743 Ga0157369_10240058
744 Ga0157374_10011053
745 Ga0157374_10022067
746 Ga0157374_10070352
747 Ga0157374_10225867
748 Ga0157378_10001866
749 Ga0157378_10020817
750 Ga0163162_10024000
751 Ga0163162_10032010
752 Ga0163162_10078779
753 Ga0163162_10099714
754 Ga0163162_10271051
755 Ga0163162_10283747
756 Ga0157372_10029424
757 Ga0157372_10038756
758 Ga0157372_10605619
759 Ga0157375_10098012
760 Ga0157375_10156487
761 Ga0163163_10066089
762 Ga0163163_10146947
763 Ga0163163_10222091
764 Ga0163163_10223283
765 Ga0182008_10016865
766 Ga0182008_10019495
767 Ga0157379_10003349
768 Ga0157379_10006619
769 Ga0157376_10017252
770 Ga0157376_10124636
771 Ga0157376_10254394
772 Ga0157376_10257907
773 Ga0182007_10012336
774 Ga0182005_1007500
775 Ga0163161_10006561
776 Ga0224569_101553
777 Ga0224569_101875
778 Ga0224571_101475
779 Ga0224572_1000833
780 Ga0224572_1001423
781 Ga0224572_1021218
782 Ga0228598_1000770
783 Ga0228598_1000785
784 Ga0228598_1001331
785 Ga0207656_10036769
786 Ga0207682_10034512
787 Ga0207642_10008761
788 Ga0207642_10085295
789 Ga0207642_10138065
790 Ga0207710_10056607
791 Ga0207647_10007613
792 Ga0207685_10033698
793 Ga0207699_10001113
794 Ga0207699_10028263
795 Ga0207699_10042888
796 Ga0207699_10074633
797 Ga0207645_10002827
798 Ga0207645_10004310
799 Ga0207643_10000391
800 Ga0207684_10000311
801 Ga0207684_10001754
802 Ga0207684_10002779
803 Ga0207684_10276301
804 Ga0207707_10052837
805 Ga0207707_10068990
806 Ga0207695_10120544
807 Ga0207695_10397547
808 Ga0207693_10000119
809 Ga0207693_10000362
810 Ga0207693_10000457
811 Ga0207693_10002833
812 Ga0207693_10009746
813 Ga0207693_10011472
814 Ga0207693_10036415
815 Ga0207663_10009908
816 Ga0207663_10021622
817 Ga0207663_10056950
818 Ga0207663_10157231
819 Ga0207663_10190166
820 Ga0207662_10035606
821 Ga0207657_10000246
822 Ga0207657_10001266
823 Ga0207657_10018927
824 Ga0207649_10000250
825 Ga0207652_10082441
826 Ga0207646_10000565
827 Ga0207646_10002216
828 Ga0207646_10015220
829 Ga0207650_10000124
830 Ga0207650_10087692
831 Ga0207687_10044169
832 Ga0207687_10048098
833 Ga0207700_10000528
834 Ga0207700_10040290
835 Ga0207700_10041027
836 Ga0207700_10049012
837 Ga0207664_10014108
838 Ga0207664_10027348
839 Ga0207664_10122212
840 Ga0207664_10172586
841 Ga0207664_10324813
842 Ga0207644_10102577
843 Ga0207690_10027196
844 Ga0207690_10123203
845 Ga0207706_10000139
846 Ga0207706_10006099
847 Ga0207706_10215988
848 Ga0207686_10019966
849 Ga0207686_10024621
850 Ga0207704_10109955
851 Ga0207665_10000281
852 Ga0207665_10002621
853 Ga0207665_10008314
854 Ga0207665_10024320
855 Ga0207665_10035553
856 Ga0207665_10100254
857 Ga0207665_10122345
858 Ga0207691_10005498
859 Ga0207711_10027041
860 Ga0207689_10001053
861 Ga0207689_10008820
862 Ga0207689_10018000
863 Ga0207689_10046639
864 Ga0207661_10004629
865 Ga0207679_10000084
866 Ga0207679_10111941
867 Ga0207679_10225520
868 Ga0207667_10077265
869 Ga0207667_10447846
870 Ga0207668_10137930
871 Ga0207640_10134245
872 Ga0207658_10074843
873 Ga0207677_10015600
874 Ga0207677_10019254
875 Ga0207677_10032208
876 Ga0207703_10007331
877 Ga0207703_10064095
878 Ga0207703_10178878
879 Ga0207703_10269412
880 Ga0207639_10015091
881 Ga0207639_10076660
882 Ga0207678_10002403
883 Ga0207678_10004160
884 Ga0207678_10074183
885 Ga0207702_10174579
886 Ga0207641_10000006
887 Ga0207641_10030534
888 Ga0207641_10191645
889 Ga0207648_10003233
890 Ga0207648_10053181
891 Ga0207648_10113508
892 Ga0207676_10000615
893 Ga0207674_10001059
894 Ga0207675_100012837
895 Ga0207683_10004329
896 Ga0207428_10173383
897 Ga0265356_1000234
898 Ga0265356_1002696
899 Ga0268266_10085053
900 Ga0268266_10182278
901 Ga0268264_10041708
902 Ga0268264_10126723
903 Ga0268264_10179506
904 Ga0268264_10412482
905 Ga0265338_10000750
906 Ga0265338_10020898
907 Ga0265338_10080739
908 Ga0265762_1000114
909 Ga0265762_1009168
910 Ga0265762_1009802
911 Ga0265760_10001989
912 Ga0265760_10002008
913 Ga0265760_10002801
914 Ga0265760_10005707
915 Ga0265760_10049566
916 Ga0265325_10008212
917 Ga0265339_10036741
918 Ga0265339_10039070
919 Ga0265316_10027868
920 Ga0265314_10033186
921 Ga0265342_10030738
922 Ga0307416_100167533
923 Ga0373926_0010899
924 Ga0373944_0046793
925 Ga0373936_0003365
926 Ga0373945_0023280
927 Ga0373954_0048466
928 Ga0373943_0000124
929 Ga0373946_0009646
930 Ga0373955_0090680
931 Ga0373931_0008636
932 Ga0373935_0007557
933 Ga0373935_0155344
934 Ga0373927_0000099
935 Ga0373927_0041962
936 Ga0373927_0107732
937 Ga0373927_0135756
938 Ga0373933_0056953
939 Ga0373947_0001961
940 Ga0373937_0263426
941 Ga0373925_0000227
942 Ga0373925_0191023
943 Ga0395899_0006619
944 Ga0395900_0284805
945 Ga0395901_0126652
946 Ga0436363_0018048
947 Ga0436362_0335205
948 Ga0451577_0000157
949 Ga0451577_0072871
950 Ga0453683_0007143
951 Ga0453683_0068498
952 Ga0453684_0001152
953 Ga0453684_0315112
954 Ga0451576_0022561
955 Ga0451576_0331781
956 Ga0495651_0026164
957 Ga0495580_0000032
958 Ga0495580_0000107
959 Ga0495580_0003635
960 Ga0495580_0003685
961 Ga0495580_0007884
962 Ga0495580_0012698
963 Ga0495580_0020652
964 Ga0495580_0026336
965 Ga0495580_0059680
966 Ga0495582_0014474
967 Ga0495582_0086843
968 Ga0495664_0039980
969 Ga0495628_0100419
970 Ga0495630_0016481
971 Ga0495665_0008807
972 Ga0495587_0238151
973 Ga0495667_0016744
974 Ga0495667_0083253
975 Ga0495635_0208048
976 Ga0495623_0093825
977 Ga0495624_0099773
978 Ga0495674_0003493
979 Ga0495674_0012272
980 Ga0495674_0203254
981 Ga0495684_0002797
982 Ga0495684_0244725
983 Ga0496102_0000537
984 Ga0496102_0033371
985 Ga0496102_0090668
986 Ga0496103_0057171
987 Ga0496103_0058329
988 Ga0496103_0123589
989 Ga0496104_0022249
990 Ga0496104_0113070
991 Ga0496104_0130966
992 Ga0496105_0045868
993 Ga0496105_0366493
994 Ga0496106_0129709
995 Ga0496107_0019356
996 Ga0496107_0336470
997 Ga0496108_0000200
998 Ga0496108_0365789
999 Ga0496109_0000149
1000 Ga0496109_0118728
1001 Ga0496110_0001586
1002 Ga0496110_0011987
1003 Ga0496111_0007059
1004 Ga0496112_0000070
1005 Ga0496112_0001099
1006 Ga0496112_0042095
1007 Ga0496112_0101917
1008 Ga0496112_0338521
1009 Ga0496113_0001103
1010 Ga0496113_0171417
1011 Ga0496115_0025819
1012 Ga0496115_0277908
1013 Ga0501077_0076760
1014 nmdc:mga05p37_198654_c1
1015 nmdc:mga08y16_89566_c1
1016 nmdc:mga0n895_1682_c1
1017 nmdc:mga0n895_45735_c1
1018 nmdc:mga0n895_74282_c1
1019 nmdc:mga0rr50_4459_c1
1020 nmdc:mga08x19_1753_c1
1021 nmdc:mga08x19_337954_c1
1022 nmdc:mga08x19_54904_c1
1023 nmdc:mga0a205_1714_c1
1024 nmdc:mga0a205_2297_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

44

359

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hre-assembly1.cif.gz_A structure of human ferrochelatase variant e343k with protoporphyrin ix bound 0.9511 5 324
4klc-assembly1.cif.gz_B e343d/f110a double mutant of human ferrochelatase 0.9488 6 324
7ct7-assembly1.cif.gz_B fech - inhibitor complex 2 0.9482 5 324
2pnj-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with phe 337 replaced by ala 0.9457 5 324
2po5-assembly1.cif.gz_B crystal structure of human ferrochelatase mutant with his 263 replaced by cys 0.9456 5 324
ID Description Score Start End Superfamily
af_I1K8C0_106_244_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9742 8 143 3.40.50.1400
af_O59786_242_370_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9641 174 300 3.40.50.1400
af_Q69TB1_279_409_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.961 176 300 3.40.50.1400
af_Q69TB1_107_267_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9586 9 162 3.40.50.1400
af_P23871_188_298_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9583 191 297 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A1Q7KQE1-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9916 11 320 GO:0004325
GO:0005737
GO:0006783
AF-A0A2V9IRB6-F1-model_v4 coproporphyrin ferrochelatase (EC 4.99.1.9) 0.9878 193 311 GO:0004325
GO:0006783
AF-A0A1Q7KQE1-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9853 11 320 GO:0004325
GO:0005737
GO:0006783
AF-A0A6A2WVM4-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9737 3 323 GO:0004325
GO:0005739
GO:0006783
GO:0009507
AF-A0A0G4H5D7-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9729 6 322 GO:0004325
GO:0005743
GO:0006783

Map