F457373

General Info

Members Datasets Scaffolds Average Seq Length
512 240 508 111

Family's Representative Sequence

Representative Sequence 3300003320|rootH2_10076151|rootH2_100761512
Length 112
Sequence METISWPDFEKVEMRVGTILEANDFPKARNPSYQLIIDFGPETGIRKSSAQITHLYRKEDLIGKQIVAVVNFPPKQIANFISECLVLGAVGDKKEVVLLEPGIKVANGQRIA

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
3 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
4 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300024123 Spruce roots microbial communities from Bohemian Forest, Czech Republic - CRU5 Metagenome Unclassified
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
149 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
152 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
163 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
164 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
165 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
166 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
167 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
168 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
169 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
170 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
171 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
176 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
177 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
178 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
179 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
180 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
183 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
188 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
204 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
207 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
209 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
215 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
216 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
219 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
220 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
221 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
222 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
223 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
224 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
227 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
228 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
229 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
230 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
234 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
235 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
236 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
237 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
238 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
239 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
240 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0
Isolates 0.78

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.59
Nodule 0
Rhizoplane 0.78
Rhizosphere 83.59
Stem 0
Stem Tuber 0
Unclassified 7.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1004610 3300002739 Bacteria 2062
2 rootH1_10138109 3300003316 Bacteria 3103
3 rootH2_10007896 3300003320 Bacteria 7724
4 rootH2_10059820 3300003320 Unclassified 1084
5 rootH2_10076151 3300003320 Bacteria 10907
6 rootH2_10156496 3300003320 Bacteria 1502
7 rootH2_10169336 3300003320 Bacteria 2576
8 rootH2_10242306 3300003320 Bacteria 5779
9 rootL2_10035256 3300003322 Unclassified 2430
10 rootL2_10150714 3300003322 Bacteria 2514
11 rootH1_10017135 3300003323 Bacteria 13955
12 rootH1_10040801 3300003323 Bacteria 2073
13 rootH1_10207709 3300003323 Eukaryota 1117
14 Ga0070658_10476338 3300005327 Unclassified 1077
15 Ga0070676_10036744 3300005328 Bacteria 2823
16 Ga0070676_10408470 3300005328 Bacteria 946
17 Ga0070690_100047442 3300005330 Unclassified 2733
18 Ga0070670_100027301 3300005331 Bacteria 4911
19 Ga0070670_100159495 3300005331 Bacteria 1955
20 Ga0070677_10037772 3300005333 Bacteria 1885
21 Ga0070677_10236452 3300005333 Bacteria 900
22 Ga0070677_10308989 3300005333 Bacteria 806
23 Ga0068869_100034840 3300005334 Bacteria 3564
24 Ga0068869_100187189 3300005334 Unclassified 1626
25 Ga0068869_100488012 3300005334 Bacteria 1027
26 Ga0068869_101700821 3300005334 Bacteria 563
27 Ga0070666_10000127 3300005335 Bacteria 53362
28 Ga0070666_10152804 3300005335 Bacteria 1611
29 Ga0070666_10248370 3300005335 Unclassified 1259
30 Ga0070666_11025413 3300005335 Bacteria 612
31 Ga0068868_100022660 3300005338 Bacteria 4744
32 Ga0068868_100092526 3300005338 Bacteria 2437
33 Ga0068868_100224053 3300005338 Unclassified 1575
34 Ga0068868_100314632 3300005338 Bacteria 1333
35 Ga0070660_100873848 3300005339 Bacteria 757
36 Ga0070660_101148017 3300005339 Bacteria 658
37 Ga0070689_100043406 3300005340 Bacteria 3455
38 Ga0070687_100017175 3300005343 Bacteria 3320
39 Ga0070661_100190712 3300005344 Bacteria 1563
40 Ga0070668_100418672 3300005347 Bacteria 1147
41 Ga0070675_100588603 3300005354 Bacteria 1008
42 Ga0070671_100036271 3300005355 Bacteria 4088
43 Ga0070671_100134148 3300005355 Bacteria 2087
44 Ga0070671_100267664 3300005355 Bacteria 1452
45 Ga0070671_100710976 3300005355 Bacteria 872
46 Ga0070671_101912292 3300005355 Bacteria 528
47 Ga0070674_100076979 3300005356 Bacteria 2373
48 Ga0070674_100648204 3300005356 Bacteria 897
49 Ga0070674_100928246 3300005356 Bacteria 760
50 Ga0070674_101455535 3300005356 Bacteria 615
51 Ga0070673_100035115 3300005364 Bacteria 3799
52 Ga0070673_100139889 3300005364 Bacteria 2040
53 Ga0070673_101282709 3300005364 Bacteria 688
54 Ga0070667_100007591 3300005367 Bacteria 8994
55 Ga0070667_100096612 3300005367 Unclassified 2548
56 Ga0070667_100267654 3300005367 Bacteria 1531
57 Ga0070667_100945155 3300005367 Bacteria 803
58 Ga0070713_101206731 3300005436 Bacteria 732
59 Ga0070710_10330761 3300005437 Bacteria 1003
60 Ga0070663_100673852 3300005455 Bacteria 877
61 Ga0070678_100219483 3300005456 Bacteria 1580
62 Ga0070678_100856756 3300005456 Bacteria 828
63 Ga0070662_100431960 3300005457 Bacteria 1091
64 Ga0070681_10094434 3300005458 Bacteria 2939
65 Ga0068867_100189792 3300005459 Bacteria 1639
66 Ga0068867_100232877 3300005459 Unclassified 1490
67 Ga0068867_100554178 3300005459 Bacteria 996
68 Ga0068867_101572743 3300005459 Bacteria 614
69 Ga0070685_10043717 3300005466 Bacteria 2562
70 Ga0070685_10052171 3300005466 Unclassified 2366
71 Ga0070707_100469213 3300005468 Bacteria 1220
72 Ga0070699_100324426 3300005518 Unclassified 1384
73 Ga0070697_100001009 3300005536 Bacteria 21253
74 Ga0070697_102007590 3300005536 Bacteria 518
75 Ga0068853_100226318 3300005539 Bacteria 1710
76 Ga0068853_100286417 3300005539 Bacteria 1520
77 Ga0068853_100908753 3300005539 Bacteria 846
78 Ga0068853_101052581 3300005539 Bacteria 784
79 Ga0068853_101058174 3300005539 Unclassified 782
80 Ga0070672_100154775 3300005543 Bacteria 1898
81 Ga0070672_100253367 3300005543 Bacteria 1483
82 Ga0070672_100548008 3300005543 Bacteria 1004
83 Ga0070686_100037705 3300005544 Bacteria 2999
84 Ga0070695_100013300 3300005545 Bacteria 4944
85 Ga0070695_100465910 3300005545 Bacteria 971
86 Ga0070696_100243708 3300005546 Unclassified 1357
87 Ga0070693_100697746 3300005547 Bacteria 743
88 Ga0070693_100903177 3300005547 Bacteria 662
89 Ga0070665_100000031 3300005548 Bacteria 333365
90 Ga0070704_100062575 3300005549 Bacteria 2668
91 Ga0068855_100038677 3300005563 Bacteria 5668
92 Ga0068855_100056174 3300005563 Bacteria 4620
93 Ga0068855_100061871 3300005563 Unclassified 4372
94 Ga0068855_100546185 3300005563 Unclassified 1255
95 Ga0068855_101675575 3300005563 Unclassified 649
96 Ga0068855_101763927 3300005563 Bacteria 630
97 Ga0068857_100008375 3300005577 Bacteria 8936
98 Ga0068857_100031335 3300005577 Bacteria 4698
99 Ga0068857_100304848 3300005577 Bacteria 1469
100 Ga0068857_100595295 3300005577 Bacteria 1045
101 Ga0068854_100007676 3300005578 Bacteria 6897
102 Ga0068856_100034296 3300005614 Bacteria 4970
103 Ga0068856_100041530 3300005614 Bacteria 4520
104 Ga0068856_101738386 3300005614 Bacteria 636
105 Ga0068852_100045895 3300005616 Bacteria 3720
106 Ga0068852_100062408 3300005616 Bacteria 3242
107 Ga0068852_100078268 3300005616 Unclassified 2925
108 Ga0068852_100405341 3300005616 Bacteria 1342
109 Ga0068852_101081825 3300005616 Bacteria 822
110 Ga0068859_100000098 3300005617 Bacteria 80555
111 Ga0068859_100107032 3300005617 Bacteria 2856
112 Ga0068859_100967190 3300005617 Bacteria 934
113 Ga0068859_101025984 3300005617 Bacteria 906
114 Ga0068859_102742348 3300005617 Bacteria 541
115 Ga0068864_100059685 3300005618 Bacteria 3300
116 Ga0068864_100326261 3300005618 Bacteria 1443
117 Ga0068864_100481977 3300005618 Bacteria 1191
118 Ga0068864_102210167 3300005618 Bacteria 557
119 Ga0068866_10254470 3300005718 Unclassified 1076
120 Ga0068861_100818878 3300005719 Bacteria 875
121 Ga0068861_101286315 3300005719 Bacteria 710
122 Ga0068861_101414905 3300005719 Unclassified 680
123 Ga0068861_101426410 3300005719 Bacteria 677
124 Ga0068851_10178901 3300005834 Bacteria 1174
125 Ga0068870_10438138 3300005840 Bacteria 859
126 Ga0068870_10583988 3300005840 Bacteria 757
127 Ga0068863_100002114 3300005841 Bacteria 19700
128 Ga0068863_100026482 3300005841 Bacteria 5531
129 Ga0068863_100453857 3300005841 Bacteria 1258
130 Ga0068858_100009184 3300005842 Bacteria 9447
131 Ga0068860_100000072 3300005843 Bacteria 174997
132 Ga0068860_100024982 3300005843 Bacteria 5769
133 Ga0068860_100026008 3300005843 Bacteria 5645
134 Ga0068860_100097195 3300005843 Bacteria 2807
135 Ga0068860_100447672 3300005843 Bacteria 1284
136 Ga0068862_100688570 3300005844 Unclassified 989
137 Ga0068862_100870151 3300005844 Bacteria 884
138 Ga0075366_10073678 3300006195 Bacteria 2036
139 Ga0075366_10729378 3300006195 Bacteria 616
140 Ga0097621_100016333 3300006237 Bacteria 5609
141 Ga0097621_100092439 3300006237 Bacteria 2534
142 Ga0097621_100136520 3300006237 Bacteria 2092
143 Ga0097621_100575595 3300006237 Bacteria 1027
144 Ga0068871_100049749 3300006358 Bacteria 3389
145 Ga0068871_100863976 3300006358 Bacteria 837
146 Ga0068871_101078523 3300006358 Unclassified 750
147 Ga0075428_101294525 3300006844 Unclassified 767
148 Ga0075431_101034746 3300006847 Bacteria 787
149 Ga0075433_11294000 3300006852 Unclassified 632
150 Ga0068865_100183169 3300006881 Bacteria 1614
151 Ga0068865_100642365 3300006881 Bacteria 901
152 Ga0097620_100000098 3300006931 Bacteria 80555
153 Ga0097620_100107033 3300006931 Bacteria 2856
154 Ga0097620_100967453 3300006931 Bacteria 934
155 Ga0097620_101026292 3300006931 Bacteria 906
156 Ga0097620_102229654 3300006931 Bacteria 604
157 Ga0097620_102741563 3300006931 Bacteria 541
158 Ga0105240_10004078 3300009093 Bacteria 22471
159 Ga0105240_10012046 3300009093 Bacteria 11985
160 Ga0105240_10015021 3300009093 Bacteria 10543
161 Ga0105240_10088183 3300009093 Bacteria 3797
162 Ga0105240_10120970 3300009093 Bacteria 3152
163 Ga0105240_10452062 3300009093 Bacteria 1437
164 Ga0105240_11694258 3300009093 Bacteria 660
165 Ga0111539_10022060 3300009094 Bacteria 7825
166 Ga0111539_10450077 3300009094 Bacteria 1499
167 Ga0111539_11645813 3300009094 Unclassified 744
168 Ga0105245_10731901 3300009098 Bacteria 1024
169 Ga0105245_13100199 3300009098 Bacteria 515
170 Ga0105247_10013490 3300009101 Bacteria 4900
171 Ga0114129_10003500 3300009147 Bacteria 22079
172 Ga0114129_10253433 3300009147 Bacteria 2362
173 Ga0105241_10000426 3300009174 Bacteria 31864
174 Ga0105241_10003215 3300009174 Bacteria 12158
175 Ga0105241_10022470 3300009174 Bacteria 4672
176 Ga0105241_10959428 3300009174 Bacteria 797
177 Ga0105242_10361676 3300009176 Bacteria 1343
178 Ga0105242_10567069 3300009176 Bacteria 1091
179 Ga0105242_10861381 3300009176 Bacteria 902
180 Ga0105242_11209502 3300009176 Bacteria 775
181 Ga0105242_11936665 3300009176 Bacteria 630
182 Ga0105237_10002095 3300009545 Bacteria 25178
183 Ga0105237_10002351 3300009545 Bacteria 23515
184 Ga0105237_10002466 3300009545 Bacteria 22965
185 Ga0105237_10003853 3300009545 Bacteria 17642
186 Ga0105237_10040762 3300009545 Bacteria 4682
187 Ga0105237_10053536 3300009545 Bacteria 4047
188 Ga0105237_10067582 3300009545 Bacteria 3568
189 Ga0105237_10201670 3300009545 Bacteria 1990
190 Ga0105237_10807896 3300009545 Bacteria 945
191 Ga0105237_11264118 3300009545 Bacteria 745
192 Ga0105237_12692298 3300009545 Unclassified 508
193 Ga0105238_10011323 3300009551 Bacteria 8973
194 Ga0105238_10118022 3300009551 Unclassified 2633
195 Ga0105238_10348900 3300009551 Unclassified 1469
196 Ga0105238_10900602 3300009551 Bacteria 903
197 Ga0105238_11206799 3300009551 Bacteria 781
198 Ga0105249_10010747 3300009553 Bacteria 8043
199 Ga0105249_11450177 3300009553 Bacteria 758
200 Ga0105249_12645958 3300009553 Bacteria 574
201 Ga0105249_13289807 3300009553 Bacteria 520
202 Ga0105239_10000101 3300010375 Bacteria 119610
203 Ga0105239_10001330 3300010375 Bacteria 33265
204 Ga0105239_10011303 3300010375 Bacteria 9960
205 Ga0105239_10020056 3300010375 Bacteria 7377
206 Ga0105239_10072551 3300010375 Bacteria 3785
207 Ga0105239_10085005 3300010375 Bacteria 3486
208 Ga0105239_10131430 3300010375 Unclassified 2785
209 Ga0105239_10461790 3300010375 Unclassified 1441
210 Ga0105246_10109153 3300011119 Bacteria 2029
211 Ga0105246_10810542 3300011119 Bacteria 831
212 Ga0157373_10421026 3300013100 Bacteria 959
213 Ga0157371_11140109 3300013102 Unclassified 599
214 Ga0157370_10014954 3300013104 Bacteria 7914
215 Ga0157370_11323445 3300013104 Bacteria 649
216 Ga0157374_10000002 3300013296 Bacteria 1054226
217 Ga0157374_10192129 3300013296 Bacteria 1997
218 Ga0157374_11766194 3300013296 Bacteria 644
219 Ga0157378_10041199 3300013297 Bacteria 4096
220 Ga0157378_10084419 3300013297 Bacteria 2875
221 Ga0157378_10176997 3300013297 Bacteria 2004
222 Ga0157378_10535752 3300013297 Bacteria 1174
223 Ga0157378_10548701 3300013297 Bacteria 1161
224 Ga0157378_10864076 3300013297 Bacteria 933
225 Ga0163162_10000167 3300013306 Bacteria 60620
226 Ga0163162_10000376 3300013306 Bacteria 40621
227 Ga0163162_10085463 3300013306 Bacteria 3232
228 Ga0157372_10001423 3300013307 Bacteria 25825
229 Ga0157372_10002026 3300013307 Bacteria 22020
230 Ga0157372_11076670 3300013307 Unclassified 930
231 Ga0157372_11107033 3300013307 Bacteria 916
232 Ga0157372_11274785 3300013307 Bacteria 848
233 Ga0157375_10089380 3300013308 Bacteria 3136
234 Ga0157375_10393600 3300013308 Bacteria 1552
235 Ga0163163_10066461 3300014325 Bacteria 3581
236 Ga0163163_10140628 3300014325 Bacteria 2456
237 Ga0163163_10207537 3300014325 Bacteria 2007
238 Ga0163163_10751807 3300014325 Bacteria 1038
239 Ga0163163_12177014 3300014325 Bacteria 614
240 Ga0157380_10066346 3300014326 Unclassified 2902
241 Ga0157380_10081085 3300014326 Bacteria 2653
242 Ga0157380_10283909 3300014326 Bacteria 1516
243 Ga0157377_10580834 3300014745 Bacteria 796
244 Ga0157379_10019184 3300014968 Bacteria 6038
245 Ga0157379_11223221 3300014968 Bacteria 723
246 Ga0157376_10005350 3300014969 Bacteria 8966
247 Ga0157376_10008770 3300014969 Bacteria 7313
248 Ga0182006_1288588 3300015261 Bacteria 538
249 Ga0163161_10099147 3300017792 Bacteria 2166
250 Ga0163161_10341699 3300017792 Bacteria 1188
251 Ga0228600_1012163 3300024123 Bacteria 676
252 Ga0209646_1003513 3300025246 Bacteria 3077
253 Ga0207656_10081905 3300025321 Bacteria 1452
254 Ga0207682_10054556 3300025893 Bacteria 1661
255 Ga0207682_10559002 3300025893 Bacteria 541
256 Ga0207680_10000408 3300025903 Bacteria 20509
257 Ga0207680_10262395 3300025903 Unclassified 1196
258 Ga0207680_11020956 3300025903 Bacteria 592
259 Ga0207647_10020916 3300025904 Unclassified 4378
260 Ga0207647_10318027 3300025904 Bacteria 884
261 Ga0207645_10050803 3300025907 Bacteria 2648
262 Ga0207645_10732424 3300025907 Bacteria 672
263 Ga0207643_10152412 3300025908 Bacteria 1386
264 Ga0207643_10376481 3300025908 Bacteria 894
265 Ga0207705_10259035 3300025909 Unclassified 1328
266 Ga0207654_10001077 3300025911 Bacteria 14842
267 Ga0207654_10001446 3300025911 Bacteria 12592
268 Ga0207654_10038181 3300025911 Bacteria 2693
269 Ga0207654_10096969 3300025911 Bacteria 1809
270 Ga0207707_10686578 3300025912 Bacteria 861
271 Ga0207695_10000952 3300025913 Bacteria 51546
272 Ga0207695_10017832 3300025913 Bacteria 8230
273 Ga0207695_10026482 3300025913 Bacteria 6472
274 Ga0207695_10117436 3300025913 Unclassified 2633
275 Ga0207695_10309710 3300025913 Bacteria 1469
276 Ga0207695_11139102 3300025913 Unclassified 660
277 Ga0207671_10001600 3300025914 Bacteria 25735
278 Ga0207671_10001660 3300025914 Bacteria 25315
279 Ga0207671_10002175 3300025914 Bacteria 21298
280 Ga0207671_10025170 3300025914 Bacteria 4471
281 Ga0207671_10089346 3300025914 Unclassified 2318
282 Ga0207671_10178512 3300025914 Bacteria 1652
283 Ga0207671_10333823 3300025914 Bacteria 1201
284 Ga0207671_10536024 3300025914 Bacteria 933
285 Ga0207671_10605289 3300025914 Bacteria 873
286 Ga0207662_10016529 3300025918 Bacteria 4166
287 Ga0207649_11194841 3300025920 Bacteria 601
288 Ga0207646_10760820 3300025922 Bacteria 864
289 Ga0207694_10054476 3300025924 Bacteria 3103
290 Ga0207694_10410171 3300025924 Bacteria 1127
291 Ga0207694_10513402 3300025924 Unclassified 1004
292 Ga0207694_10527888 3300025924 Unclassified 989
293 Ga0207650_10023739 3300025925 Bacteria 4354
294 Ga0207659_10491570 3300025926 Unclassified 1038
295 Ga0207644_10018170 3300025931 Bacteria 4755
296 Ga0207644_10315343 3300025931 Bacteria 1263
297 Ga0207644_10439294 3300025931 Bacteria 1071
298 Ga0207686_10353789 3300025934 Bacteria 1106
299 Ga0207686_11655763 3300025934 Bacteria 529
300 Ga0207670_10036709 3300025936 Bacteria 3189
301 Ga0207669_10046087 3300025937 Bacteria 2574
302 Ga0207669_10389236 3300025937 Bacteria 1089
303 Ga0207669_11294975 3300025937 Bacteria 619
304 Ga0207669_11588181 3300025937 Bacteria 558
305 Ga0207704_10360532 3300025938 Bacteria 1135
306 Ga0207665_10704228 3300025939 Bacteria 794
307 Ga0207691_10022627 3300025940 Bacteria 5927
308 Ga0207691_10126088 3300025940 Bacteria 2265
309 Ga0207691_10291314 3300025940 Bacteria 1404
310 Ga0207711_11089106 3300025941 Bacteria 740
311 Ga0207689_10000357 3300025942 Bacteria 42953
312 Ga0207689_10126778 3300025942 Bacteria 2100
313 Ga0207689_10753505 3300025942 Bacteria 822
314 Ga0207689_11515323 3300025942 Bacteria 560
315 Ga0207667_10020728 3300025949 Bacteria 7304
316 Ga0207667_10021237 3300025949 Bacteria 7197
317 Ga0207667_10038908 3300025949 Bacteria 5072
318 Ga0207667_10387745 3300025949 Unclassified 1423
319 Ga0207651_10293804 3300025960 Bacteria 1348
320 Ga0207651_10398577 3300025960 Bacteria 1170
321 Ga0207712_10025486 3300025961 Bacteria 3929
322 Ga0207668_10082146 3300025972 Bacteria 2340
323 Ga0207640_10017902 3300025981 Bacteria 4153
324 Ga0207640_10157720 3300025981 Bacteria 1675
325 Ga0207640_10856801 3300025981 Bacteria 791
326 Ga0207658_10008823 3300025986 Bacteria 6842
327 Ga0207658_10147034 3300025986 Bacteria 1915
328 Ga0207658_10843177 3300025986 Bacteria 833
329 Ga0207677_10037911 3300026023 Bacteria 3154
330 Ga0207677_10056863 3300026023 Bacteria 2683
331 Ga0207677_10208662 3300026023 Bacteria 1558
332 Ga0207677_10420748 3300026023 Bacteria 1138
333 Ga0207703_10010057 3300026035 Bacteria 7417
334 Ga0207703_10174964 3300026035 Unclassified 1891
335 Ga0207703_10312168 3300026035 Bacteria 1437
336 Ga0207703_10594803 3300026035 Unclassified 1046
337 Ga0207639_10108268 3300026041 Bacteria 2259
338 Ga0207639_10457290 3300026041 Bacteria 1160
339 Ga0207639_10909249 3300026041 Unclassified 823
340 Ga0207639_11005484 3300026041 Bacteria 781
341 Ga0207678_10283878 3300026067 Bacteria 1421
342 Ga0207708_10101578 3300026075 Bacteria 2226
343 Ga0207702_11331566 3300026078 Bacteria 712
344 Ga0207702_11669222 3300026078 Bacteria 630
345 Ga0207641_10000840 3300026088 Bacteria 32683
346 Ga0207641_10006292 3300026088 Bacteria 10040
347 Ga0207641_11857093 3300026088 Unclassified 604
348 Ga0207648_10048652 3300026089 Bacteria 3711
349 Ga0207648_10225288 3300026089 Bacteria 1667
350 Ga0207648_10542711 3300026089 Bacteria 1067
351 Ga0207676_10029219 3300026095 Bacteria 4125
352 Ga0207676_10454740 3300026095 Bacteria 1208
353 Ga0207674_10007429 3300026116 Bacteria 12772
354 Ga0207674_10226034 3300026116 Bacteria 1820
355 Ga0207674_10915968 3300026116 Bacteria 845
356 Ga0207675_100333221 3300026118 Unclassified 1484
357 Ga0207675_100826679 3300026118 Bacteria 940
358 Ga0207675_101157437 3300026118 Bacteria 794
359 Ga0207683_10025259 3300026121 Bacteria 5123
360 Ga0207683_10567208 3300026121 Unclassified 1050
361 Ga0207683_10733482 3300026121 Bacteria 916
362 Ga0207698_10026889 3300026142 Bacteria 4076
363 Ga0207698_10121128 3300026142 Bacteria 2215
364 Ga0207698_10257227 3300026142 Bacteria 1602
365 Ga0207698_10282154 3300026142 Bacteria 1537
366 Ga0207698_11238092 3300026142 Bacteria 761
367 Ga0207698_11996949 3300026142 Bacteria 594
368 Ga0207428_10151152 3300027907 Unclassified 1767
369 Ga0268266_10000088 3300028379 Bacteria 199029
370 Ga0268265_11567118 3300028380 Bacteria 663
371 Ga0268264_10000201 3300028381 Bacteria 122060
372 Ga0268264_10012477 3300028381 Bacteria 6996
373 Ga0268264_10036570 3300028381 Bacteria 4046
374 Ga0268264_10038853 3300028381 Bacteria 3930
375 Ga0268264_10403269 3300028381 Bacteria 1315
376 Ga0268264_10803455 3300028381 Bacteria 940
377 Ga0265323_10001080 3300028653 Bacteria 14105
378 Ga0307517_10111879 3300028786 Bacteria 2072
379 Ga0307517_10269102 3300028786 Bacteria 982
380 Ga0307515_10000341 3300028794 Bacteria 115360
381 Ga0307511_10000224 3300030521 Bacteria 57406
382 Ga0307512_10391982 3300030522 Bacteria 588
383 Ga0265316_10004453 3300031344 Bacteria 13946
384 Ga0307513_10117356 3300031456 Bacteria 2639
385 Ga0307513_10443438 3300031456 Bacteria 1024
386 Ga0307509_10076966 3300031507 Bacteria 3460
387 Ga0307509_10210338 3300031507 Bacteria 1770
388 Ga0307509_10339589 3300031507 Bacteria 1230
389 Ga0307508_10000490 3300031616 Bacteria 47664
390 Ga0307516_10005173 3300031730 Bacteria 15720
391 Ga0307516_10023610 3300031730 Bacteria 6297
392 Ga0307414_10013394 3300032004 Bacteria 4881
393 Ga0307510_10001354 3300033180 Bacteria 26743
394 Ga0307510_10405495 3300033180 Bacteria 806
395 Ga0439436_0004996 3300041404 Bacteria 4065
396 Ga0439439_0021183 3300041406 Unclassified 1619
397 Ga0451795_0253071 3300041456 Unclassified 505
398 Ga0451800_0560944 3300041459 Bacteria 818
399 Ga0451807_2616608 3300041486 Bacteria 557
400 Ga0451833_0186840 3300041491 Bacteria 690
401 Ga0451849_0148220 3300041505 Bacteria 677
402 Ga0451843_1341855 3300041509 Bacteria 532
403 Ga0451855_1902866 3300041511 Bacteria 809
404 Ga0451853_2343836 3300041512 Bacteria 907
405 Ga0439449_0017797 3300042007 Bacteria 2668
406 Ga0439449_0036547 3300042007 Bacteria 1827
407 Ga0439457_000514 3300042014 Bacteria 11216
408 Ga0439457_124905 3300042014 Bacteria 610
409 Ga0439462_0018429 3300042015 Bacteria 1813
410 Ga0466969_0008185 3300044656 Bacteria 5548
411 Ga0466972_0000091 3300044658 Bacteria 81829
412 Ga0466972_0013757 3300044658 Bacteria 4062
413 Ga0466972_0038329 3300044658 Unclassified 2341
414 Ga0466965_0276307 3300044683 Bacteria 906
415 Ga0466966_0000170 3300044684 Bacteria 42809
416 Ga0466961_0013099 3300044693 Bacteria 5306
417 Ga0466961_0122814 3300044693 Bacteria 1630
418 Ga0466964_0049036 3300044706 Bacteria 1728
419 Ga0466964_0072261 3300044706 Bacteria 1462
420 Ga0466971_0009293 3300044719 Bacteria 4294
421 Ga0466968_0052844 3300044735 Bacteria 1739
422 Ga0466957_0001173 3300044842 Bacteria 13601
423 Ga0466957_0003784 3300044842 Bacteria 8361
424 Ga0466960_0675119 3300044901 Bacteria 618
425 Ga0466959_0000089 3300045049 Bacteria 57482
426 Ga0466959_0002154 3300045049 Bacteria 12503
427 Ga0451576_0672433 3300045051 Bacteria 1088
428 Ga0466958_0025486 3300045836 Bacteria 3488
429 Ga0495638_0023711 3300046460 Bacteria 4009
430 Ga0495638_0124025 3300046460 Bacteria 1524
431 Ga0495638_0153332 3300046460 Bacteria 1335
432 Ga0495638_0360180 3300046460 Bacteria 765
433 Ga0495606_0008008 3300046507 Bacteria 9287
434 Ga0495618_0376994 3300046514 Bacteria 871
435 Ga0495632_0334263 3300046519 Bacteria 668
436 Ga0495648_0002082 3300046524 Bacteria 18925
437 Ga0495668_0009178 3300046616 Bacteria 6089
438 Ga0495611_0000634 3300046648 Bacteria 20203
439 Ga0495625_0181145 3300046660 Bacteria 1401
440 Ga0495599_0533084 3300046678 Bacteria 689
441 Ga0495672_0102837 3300047320 Bacteria 1546
442 Ga0495687_000079 3300047443 Bacteria 147704
443 Ga0496104_1203883 3300048907 Bacteria 661
444 Ga0501034_1054572 3300049571 Bacteria 695
445 Ga0501034_1188640 3300049571 Unclassified 642
446 Ga0501034_1544071 3300049571 Unclassified 537
447 Ga0501043_0117779 3300049579 Bacteria 2084
448 Ga0501046_0350476 3300049580 Bacteria 1072
449 Ga0501047_0042687 3300049581 Bacteria 4381
450 Ga0501047_0059573 3300049581 Bacteria 3686
451 Ga0501048_0062986 3300049582 Bacteria 2624
452 Ga0501248_033933 3300049678 Bacteria 596
453 Ga0501257_013705 3300049686 Bacteria 1860
454 Ga0501225_0002900 3300049705 Bacteria 5266
455 Ga0501225_0043010 3300049705 Bacteria 1248
456 Ga0501241_005443 3300049758 Bacteria 2374
457 Ga0501035_0593788 3300049822 Bacteria 903
458 Ga0501044_0086356 3300049823 Bacteria 3169
459 Ga0501044_0203593 3300049823 Bacteria 1937
460 Ga0501284_00139 3300050005 Bacteria 8965
461 nmdc:mga0k408_68207_c1 3300050493 Bacteria 2074
462 nmdc:mga0k408_99688_c1 3300050493 Bacteria 1712
463 nmdc:mga05p37_2324_c1 3300050507 Bacteria 22132
464 nmdc:mga05p37_250156_c1 3300050507 Bacteria 2126
465 nmdc:mga09592_445450_c1 3300050508 Unclassified 1117
466 nmdc:mga08y16_1190663_c1 3300050511 Bacteria 733
467 nmdc:mga08y16_38517_c1 3300050511 Bacteria 5020
468 nmdc:mga08y16_579378_c1 3300050511 Bacteria 1133
469 Ga0500644_0335489 3300053088 Bacteria 652
470 Ga0500646_0031209 3300053090 Bacteria 1466
471 Ga0500646_0037211 3300053090 Bacteria 1358
472 Ga0500646_0329800 3300053090 Unclassified 553
473 Ga0500583_0000002 3300053092 Bacteria 232826
474 Ga0500583_0012784 3300053092 Bacteria 3217
475 Ga0500583_0016828 3300053092 Bacteria 2929
476 Ga0500583_0459609 3300053092 Bacteria 603
477 Ga0500651_0345007 3300053093 Bacteria 846
478 Ga0500554_010964 3300053102 Bacteria 2230
479 Ga0500556_0224633 3300053104 Bacteria 741
480 Ga0500572_015074 3300053111 Bacteria 1943
481 Ga0500594_0019577 3300053118 Bacteria 1679
482 Ga0500642_0280189 3300053130 Bacteria 758
483 Ga0500642_0307583 3300053130 Bacteria 714
484 Ga0500652_048022 3300053131 Bacteria 1736
485 Ga0500655_078082 3300053133 Bacteria 679
486 Ga0500559_0277681 3300053136 Bacteria 788
487 Ga0500568_0008536 3300053139 Bacteria 4931
488 Ga0500573_0158466 3300053140 Bacteria 1234
489 Ga0500579_235674 3300053143 Bacteria 615
490 Ga0500588_0040843 3300053146 Bacteria 1397
491 Ga0500588_0227544 3300053146 Bacteria 696
492 Ga0500603_091655 3300053150 Bacteria 893
493 Ga0500616_0003644 3300053153 Bacteria 11575
494 Ga0500616_0157842 3300053153 Bacteria 1043
495 Ga0500616_0325618 3300053153 Unclassified 631
496 Ga0500622_0008448 3300053156 Bacteria 5763
497 Ga0500622_0055373 3300053156 Bacteria 2032
498 Ga0500622_0085077 3300053156 Bacteria 1578
499 Ga0500622_0369398 3300053156 Bacteria 590
500 Ga0500639_183053 3300053163 Bacteria 923
501 Ga0500636_0089632 3300053177 Bacteria 1763
502 Ga0500636_0439948 3300053177 Bacteria 593
503 Ga0500637_0604864 3300053178 Unclassified 518
504 Ga0500584_107272 3300053726 Bacteria 1136
505 Ga0500611_002885 3300053727 Bacteria 2127
506 Ga0500645_093845 3300053730 Bacteria 850
507 Ga0500587_009819 3300053739 Bacteria 1219
508 Ga0590075_162214 3300059424 Bacteria 590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005458 Ga0070681_10094434 Ga0070681_100944342 96
2 3300025912 Ga0207707_10686578 Ga0207707_106865781 96
3 3300028653 Ga0265323_10001080 Ga0265323_1000108012 98
4 3300031344 Ga0265316_10004453 Ga0265316_100044533 98
5 3300032004 Ga0307414_10013394 Ga0307414_100133943 99
6 iso_pu_bacteria 2738541278 2738728307 106
7 3300013307 Ga0157372_11274785 Ga0157372_112747852 108
8 iso_pu_bacteria 2929177148 2929177435 108
9 iso_pu_bacteria 2945977869 2945979802 108
10 iso_pu_bacteria 2946013367 2946014331 108
11 3300005617 Ga0068859_100967190 Ga0068859_1009671901 109
12 3300006931 Ga0097620_100967453 Ga0097620_1009674533 109
13 3300041456 Ga0451795_0253071 Ga0451795_0253071_108_437 109
14 3300049571 Ga0501034_1544071 Ga0501034_1544071_105_434 109
15 3300003320 rootH2_10242306 rootH2_102423064 110
16 3300003322 rootL2_10150714 rootL2_101507144 110
17 3300003323 rootH1_10017135 rootH1_100171359 110
18 3300005328 Ga0070676_10036744 Ga0070676_100367442 110
19 3300005330 Ga0070690_100047442 Ga0070690_1000474423 110
20 3300005333 Ga0070677_10037772 Ga0070677_100377723 110
21 3300005333 Ga0070677_10236452 Ga0070677_102364522 110
22 3300005333 Ga0070677_10308989 Ga0070677_103089892 110
23 3300005334 Ga0068869_100187189 Ga0068869_1001871893 110
24 3300005335 Ga0070666_10152804 Ga0070666_101528042 110
25 3300005338 Ga0068868_100022660 Ga0068868_1000226607 110
26 3300005340 Ga0070689_100043406 Ga0070689_1000434065 110
27 3300005343 Ga0070687_100017175 Ga0070687_1000171752 110
28 3300005354 Ga0070675_100588603 Ga0070675_1005886032 110
29 3300005355 Ga0070671_100036271 Ga0070671_1000362713 110
30 3300005356 Ga0070674_100076979 Ga0070674_1000769793 110
31 3300005356 Ga0070674_100648204 Ga0070674_1006482042 110
32 3300005356 Ga0070674_100928246 Ga0070674_1009282461 110
33 3300005364 Ga0070673_100035115 Ga0070673_1000351153 110
34 3300005436 Ga0070713_101206731 Ga0070713_1012067311 110
35 3300005437 Ga0070710_10330761 Ga0070710_103307612 110
36 3300005455 Ga0070663_100673852 Ga0070663_1006738522 110
37 3300005456 Ga0070678_100219483 Ga0070678_1002194833 110
38 3300005457 Ga0070662_100431960 Ga0070662_1004319601 110
39 3300005459 Ga0068867_100189792 Ga0068867_1001897922 110
40 3300005459 Ga0068867_101572743 Ga0068867_1015727431 110
41 3300005466 Ga0070685_10043717 Ga0070685_100437173 110
42 3300005539 Ga0068853_100286417 Ga0068853_1002864172 110
43 3300005543 Ga0070672_100253367 Ga0070672_1002533673 110
44 3300005544 Ga0070686_100037705 Ga0070686_1000377052 110
45 3300005547 Ga0070693_100697746 Ga0070693_1006977461 110
46 3300005563 Ga0068855_100056174 Ga0068855_1000561742 110
47 3300005577 Ga0068857_100304848 Ga0068857_1003048483 110
48 3300005577 Ga0068857_100595295 Ga0068857_1005952952 110
49 3300005614 Ga0068856_100034296 Ga0068856_1000342962 110
50 3300005616 Ga0068852_100078268 Ga0068852_1000782683 110
51 3300005617 Ga0068859_101025984 Ga0068859_1010259842 110
52 3300005618 Ga0068864_100481977 Ga0068864_1004819773 110
53 3300005718 Ga0068866_10254470 Ga0068866_102544702 110
54 3300005719 Ga0068861_101286315 Ga0068861_1012863152 110
55 3300005719 Ga0068861_101426410 Ga0068861_1014264101 110
56 3300005840 Ga0068870_10438138 Ga0068870_104381382 110
57 3300005840 Ga0068870_10583988 Ga0068870_105839881 110
58 3300005841 Ga0068863_100453857 Ga0068863_1004538572 110
59 3300005843 Ga0068860_100447672 Ga0068860_1004476721 110
60 3300006195 Ga0075366_10729378 Ga0075366_107293782 110
61 3300006237 Ga0097621_100092439 Ga0097621_1000924394 110
62 3300006358 Ga0068871_100863976 Ga0068871_1008639762 110
63 3300006844 Ga0075428_101294525 Ga0075428_1012945252 110
64 3300006881 Ga0068865_100183169 Ga0068865_1001831692 110
65 3300006881 Ga0068865_100642365 Ga0068865_1006423652 110
66 3300006931 Ga0097620_101026292 Ga0097620_1010262922 110
67 3300009093 Ga0105240_10452062 Ga0105240_104520622 110
68 3300009094 Ga0111539_10022060 Ga0111539_100220606 110
69 3300009094 Ga0111539_10450077 Ga0111539_104500772 110
70 3300009147 Ga0114129_10003500 Ga0114129_100035004 110
71 3300009174 Ga0105241_10022470 Ga0105241_100224703 110
72 3300009176 Ga0105242_10361676 Ga0105242_103616762 110
73 3300009545 Ga0105237_10201670 Ga0105237_102016702 110
74 3300009553 Ga0105249_13289807 Ga0105249_132898071 110
75 3300010375 Ga0105239_10020056 Ga0105239_100200567 110
76 3300010375 Ga0105239_10085005 Ga0105239_100850054 110
77 3300011119 Ga0105246_10810542 Ga0105246_108105422 110
78 3300013297 Ga0157378_10084419 Ga0157378_100844192 110
79 3300013307 Ga0157372_11107033 Ga0157372_111070332 110
80 3300014325 Ga0163163_10207537 Ga0163163_102075373 110
81 3300014325 Ga0163163_12177014 Ga0163163_121770141 110
82 3300014326 Ga0157380_10066346 Ga0157380_100663463 110
83 3300014326 Ga0157380_10081085 Ga0157380_100810853 110
84 3300014326 Ga0157380_10283909 Ga0157380_102839092 110
85 3300017792 Ga0163161_10099147 Ga0163161_100991473 110
86 3300025893 Ga0207682_10054556 Ga0207682_100545561 110
87 3300025893 Ga0207682_10559002 Ga0207682_105590022 110
88 3300025903 Ga0207680_11020956 Ga0207680_110209562 110
89 3300025907 Ga0207645_10050803 Ga0207645_100508033 110
90 3300025908 Ga0207643_10152412 Ga0207643_101524122 110
91 3300025908 Ga0207643_10376481 Ga0207643_103764812 110
92 3300025911 Ga0207654_10038181 Ga0207654_100381813 110
93 3300025913 Ga0207695_10309710 Ga0207695_103097103 110
94 3300025914 Ga0207671_10605289 Ga0207671_106052892 110
95 3300025918 Ga0207662_10016529 Ga0207662_100165293 110
96 3300025926 Ga0207659_10491570 Ga0207659_104915702 110
97 3300025931 Ga0207644_10018170 Ga0207644_100181703 110
98 3300025936 Ga0207670_10036709 Ga0207670_100367093 110
99 3300025937 Ga0207669_10046087 Ga0207669_100460873 110
100 3300025937 Ga0207669_10389236 Ga0207669_103892362 110
101 3300025937 Ga0207669_11588181 Ga0207669_115881812 110
102 3300025938 Ga0207704_10360532 Ga0207704_103605322 110
103 3300025939 Ga0207665_10704228 Ga0207665_107042281 110
104 3300025940 Ga0207691_10022627 Ga0207691_100226274 110
105 3300025940 Ga0207691_10126088 Ga0207691_101260882 110
106 3300025942 Ga0207689_10126778 Ga0207689_101267783 110
107 3300025949 Ga0207667_10021237 Ga0207667_100212376 110
108 3300025960 Ga0207651_10293804 Ga0207651_102938042 110
109 3300025960 Ga0207651_10398577 Ga0207651_103985772 110
110 3300025981 Ga0207640_10856801 Ga0207640_108568012 110
111 3300026023 Ga0207677_10208662 Ga0207677_102086623 110
112 3300026035 Ga0207703_10312168 Ga0207703_103121682 110
113 3300026035 Ga0207703_10594803 Ga0207703_105948031 110
114 3300026041 Ga0207639_10457290 Ga0207639_104572902 110
115 3300026067 Ga0207678_10283878 Ga0207678_102838782 110
116 3300026075 Ga0207708_10101578 Ga0207708_101015783 110
117 3300026088 Ga0207641_11857093 Ga0207641_118570932 110
118 3300026089 Ga0207648_10048652 Ga0207648_100486524 110
119 3300026095 Ga0207676_10454740 Ga0207676_104547402 110
120 3300026116 Ga0207674_10226034 Ga0207674_102260342 110
121 3300026118 Ga0207675_100333221 Ga0207675_1003332212 110
122 3300026118 Ga0207675_101157437 Ga0207675_1011574371 110
123 3300026121 Ga0207683_10025259 Ga0207683_100252593 110
124 3300026121 Ga0207683_10733482 Ga0207683_107334822 110
125 3300026142 Ga0207698_11996949 Ga0207698_119969491 110
126 3300027907 Ga0207428_10151152 Ga0207428_101511522 110
127 3300028381 Ga0268264_10403269 Ga0268264_104032692 110
128 3300031456 Ga0307513_10117356 Ga0307513_101173564 110
129 3300031507 Ga0307509_10076966 Ga0307509_100769662 110
130 3300031616 Ga0307508_10000490 Ga0307508_1000049022 110
131 3300041404 Ga0439436_0004996 Ga0439436_0004996_37_369 110
132 3300041406 Ga0439439_0021183 Ga0439439_0021183_53_385 110
133 3300042007 Ga0439449_0017797 Ga0439449_0017797_1215_1547 110
134 3300042007 Ga0439449_0036547 Ga0439449_0036547_1272_1604 110
135 3300042014 Ga0439457_000514 Ga0439457_000514_2082_2414 110
136 3300042015 Ga0439462_0018429 Ga0439462_0018429_373_705 110
137 3300044656 Ga0466969_0008185 Ga0466969_0008185_3852_4184 110
138 3300044683 Ga0466965_0276307 Ga0466965_0276307_417_749 110
139 3300044684 Ga0466966_0000170 Ga0466966_0000170_19713_20045 110
140 3300044693 Ga0466961_0122814 Ga0466961_0122814_1006_1338 110
141 3300044706 Ga0466964_0049036 Ga0466964_0049036_984_1316 110
142 3300044735 Ga0466968_0052844 Ga0466968_0052844_486_818 110
143 3300044842 Ga0466957_0001173 Ga0466957_0001173_7347_7679 110
144 3300045049 Ga0466959_0000089 Ga0466959_0000089_19712_20044 110
145 3300045051 Ga0451576_0672433 Ga0451576_0672433_527_859 110
146 3300046460 Ga0495638_0124025 Ga0495638_0124025_138_470 110
147 3300046616 Ga0495668_0009178 Ga0495668_0009178_275_607 110
148 3300046678 Ga0495599_0533084 Ga0495599_0533084_227_559 110
149 3300049571 Ga0501034_1188640 Ga0501034_1188640_155_487 110
150 3300049581 Ga0501047_0059573 Ga0501047_0059573_2175_2507 110
151 3300049686 Ga0501257_013705 Ga0501257_013705_470_802 110
152 3300049705 Ga0501225_0002900 Ga0501225_0002900_4709_5041 110
153 3300050493 nmdc:mga0k408_99688_c1 nmdc:mga0k408_99688_c1_1228_1560 110
154 3300050507 nmdc:mga05p37_2324_c1 nmdc:mga05p37_2324_c1_3286_3618 110
155 3300050508 nmdc:mga09592_445450_c1 nmdc:mga09592_445450_c1_89_421 110
156 3300050511 nmdc:mga08y16_1190663_c1 nmdc:mga08y16_1190663_c1_45_377 110
157 3300050511 nmdc:mga08y16_38517_c1 nmdc:mga08y16_38517_c1_4107_4439 110
158 3300050511 nmdc:mga08y16_579378_c1 nmdc:mga08y16_579378_c1_98_430 110
159 3300053090 Ga0500646_0031209 Ga0500646_0031209_1068_1400 110
160 3300053104 Ga0500556_0224633 Ga0500556_0224633_266_598 110
161 3300053146 Ga0500588_0227544 Ga0500588_0227544_139_471 110
162 3300053153 Ga0500616_0003644 Ga0500616_0003644_6158_6490 110
163 3300053156 Ga0500622_0085077 Ga0500622_0085077_92_424 110
164 3300053730 Ga0500645_093845 Ga0500645_093845_386_718 110
165 3300059424 Ga0590075_162214 Ga0590075_162214_163_495 110
166 3300003316 rootH1_10138109 rootH1_101381093 111
167 3300003320 rootH2_10007896 rootH2_100078965 111
168 3300003320 rootH2_10059820 rootH2_100598202 111
169 3300003320 rootH2_10156496 rootH2_101564962 111
170 3300003320 rootH2_10169336 rootH2_101693362 111
171 3300003322 rootL2_10035256 rootL2_100352562 111
172 3300003323 rootH1_10207709 rootH1_102077091 111
173 3300005327 Ga0070658_10476338 Ga0070658_104763382 111
174 3300005328 Ga0070676_10408470 Ga0070676_104084702 111
175 3300005331 Ga0070670_100027301 Ga0070670_1000273016 111
176 3300005331 Ga0070670_100159495 Ga0070670_1001594953 111
177 3300005334 Ga0068869_100034840 Ga0068869_1000348403 111
178 3300005334 Ga0068869_100488012 Ga0068869_1004880122 111
179 3300005334 Ga0068869_101700821 Ga0068869_1017008212 111
180 3300005335 Ga0070666_10000127 Ga0070666_100001279 111
181 3300005335 Ga0070666_10248370 Ga0070666_102483702 111
182 3300005335 Ga0070666_11025413 Ga0070666_110254132 111
183 3300005338 Ga0068868_100092526 Ga0068868_1000925263 111
184 3300005338 Ga0068868_100224053 Ga0068868_1002240532 111
185 3300005338 Ga0068868_100314632 Ga0068868_1003146322 111
186 3300005339 Ga0070660_100873848 Ga0070660_1008738481 111
187 3300005339 Ga0070660_101148017 Ga0070660_1011480171 111
188 3300005344 Ga0070661_100190712 Ga0070661_1001907122 111
189 3300005347 Ga0070668_100418672 Ga0070668_1004186722 111
190 3300005355 Ga0070671_100134148 Ga0070671_1001341483 111
191 3300005355 Ga0070671_100267664 Ga0070671_1002676642 111
192 3300005355 Ga0070671_100710976 Ga0070671_1007109762 111
193 3300005355 Ga0070671_101912292 Ga0070671_1019122921 111
194 3300005356 Ga0070674_101455535 Ga0070674_1014555351 111
195 3300005364 Ga0070673_100139889 Ga0070673_1001398893 111
196 3300005364 Ga0070673_101282709 Ga0070673_1012827092 111
197 3300005367 Ga0070667_100007591 Ga0070667_1000075912 111
198 3300005367 Ga0070667_100096612 Ga0070667_1000966123 111
199 3300005367 Ga0070667_100267654 Ga0070667_1002676542 111
200 3300005367 Ga0070667_100945155 Ga0070667_1009451552 111
201 3300005456 Ga0070678_100856756 Ga0070678_1008567561 111
202 3300005459 Ga0068867_100232877 Ga0068867_1002328772 111
203 3300005459 Ga0068867_100554178 Ga0068867_1005541782 111
204 3300005466 Ga0070685_10052171 Ga0070685_100521714 111
205 3300005468 Ga0070707_100469213 Ga0070707_1004692132 111
206 3300005518 Ga0070699_100324426 Ga0070699_1003244262 111
207 3300005536 Ga0070697_100001009 Ga0070697_10000100915 111
208 3300005536 Ga0070697_102007590 Ga0070697_1020075901 111
209 3300005539 Ga0068853_100226318 Ga0068853_1002263181 111
210 3300005539 Ga0068853_100908753 Ga0068853_1009087532 111
211 3300005539 Ga0068853_101052581 Ga0068853_1010525811 111
212 3300005539 Ga0068853_101058174 Ga0068853_1010581742 111
213 3300005543 Ga0070672_100154775 Ga0070672_1001547751 111
214 3300005543 Ga0070672_100548008 Ga0070672_1005480082 111
215 3300005545 Ga0070695_100013300 Ga0070695_1000133003 111
216 3300005545 Ga0070695_100465910 Ga0070695_1004659102 111
217 3300005546 Ga0070696_100243708 Ga0070696_1002437082 111
218 3300005547 Ga0070693_100903177 Ga0070693_1009031771 111
219 3300005548 Ga0070665_100000031 Ga0070665_100000031267 111
220 3300005549 Ga0070704_100062575 Ga0070704_1000625752 111
221 3300005563 Ga0068855_100038677 Ga0068855_1000386772 111
222 3300005563 Ga0068855_100061871 Ga0068855_1000618713 111
223 3300005563 Ga0068855_100546185 Ga0068855_1005461852 111
224 3300005563 Ga0068855_101675575 Ga0068855_1016755752 111
225 3300005563 Ga0068855_101763927 Ga0068855_1017639271 111
226 3300005577 Ga0068857_100008375 Ga0068857_1000083757 111
227 3300005578 Ga0068854_100007676 Ga0068854_1000076764 111
228 3300005614 Ga0068856_100041530 Ga0068856_1000415303 111
229 3300005614 Ga0068856_101738386 Ga0068856_1017383861 111
230 3300005616 Ga0068852_100045895 Ga0068852_1000458955 111
231 3300005616 Ga0068852_100062408 Ga0068852_1000624082 111
232 3300005616 Ga0068852_100405341 Ga0068852_1004053412 111
233 3300005616 Ga0068852_101081825 Ga0068852_1010818252 111
234 3300005617 Ga0068859_100000098 Ga0068859_10000009822 111
235 3300005617 Ga0068859_100107032 Ga0068859_1001070324 111
236 3300005617 Ga0068859_102742348 Ga0068859_1027423481 111
237 3300005618 Ga0068864_100059685 Ga0068864_1000596853 111
238 3300005618 Ga0068864_100326261 Ga0068864_1003262613 111
239 3300005618 Ga0068864_102210167 Ga0068864_1022101672 111
240 3300005719 Ga0068861_100818878 Ga0068861_1008188781 111
241 3300005719 Ga0068861_101414905 Ga0068861_1014149051 111
242 3300005834 Ga0068851_10178901 Ga0068851_101789013 111
243 3300005841 Ga0068863_100002114 Ga0068863_1000021143 111
244 3300005841 Ga0068863_100026482 Ga0068863_1000264825 111
245 3300005842 Ga0068858_100009184 Ga0068858_1000091848 111
246 3300005843 Ga0068860_100000072 Ga0068860_10000007220 111
247 3300005843 Ga0068860_100024982 Ga0068860_1000249823 111
248 3300005843 Ga0068860_100026008 Ga0068860_1000260083 111
249 3300005843 Ga0068860_100097195 Ga0068860_1000971952 111
250 3300005844 Ga0068862_100688570 Ga0068862_1006885701 111
251 3300005844 Ga0068862_100870151 Ga0068862_1008701512 111
252 3300006195 Ga0075366_10073678 Ga0075366_100736783 111
253 3300006237 Ga0097621_100016333 Ga0097621_1000163332 111
254 3300006237 Ga0097621_100136520 Ga0097621_1001365202 111
255 3300006237 Ga0097621_100575595 Ga0097621_1005755951 111
256 3300006358 Ga0068871_100049749 Ga0068871_1000497494 111
257 3300006358 Ga0068871_101078523 Ga0068871_1010785232 111
258 3300006847 Ga0075431_101034746 Ga0075431_1010347462 111
259 3300006852 Ga0075433_11294000 Ga0075433_112940001 111
260 3300006931 Ga0097620_100000098 Ga0097620_10000009822 111
261 3300006931 Ga0097620_100107033 Ga0097620_1001070334 111
262 3300006931 Ga0097620_102229654 Ga0097620_1022296541 111
263 3300006931 Ga0097620_102741563 Ga0097620_1027415631 111
264 3300009093 Ga0105240_10004078 Ga0105240_100040785 111
265 3300009093 Ga0105240_10012046 Ga0105240_100120466 111
266 3300009093 Ga0105240_10015021 Ga0105240_100150217 111
267 3300009093 Ga0105240_10088183 Ga0105240_100881833 111
268 3300009093 Ga0105240_10120970 Ga0105240_101209704 111
269 3300009093 Ga0105240_11694258 Ga0105240_116942582 111
270 3300009094 Ga0111539_11645813 Ga0111539_116458132 111
271 3300009098 Ga0105245_10731901 Ga0105245_107319012 111
272 3300009098 Ga0105245_13100199 Ga0105245_131001991 111
273 3300009101 Ga0105247_10013490 Ga0105247_100134905 111
274 3300009147 Ga0114129_10253433 Ga0114129_102534332 111
275 3300009174 Ga0105241_10000426 Ga0105241_1000042622 111
276 3300009174 Ga0105241_10003215 Ga0105241_100032154 111
277 3300009174 Ga0105241_10959428 Ga0105241_109594282 111
278 3300009176 Ga0105242_10567069 Ga0105242_105670691 111
279 3300009176 Ga0105242_10861381 Ga0105242_108613812 111
280 3300009176 Ga0105242_11209502 Ga0105242_112095022 111
281 3300009176 Ga0105242_11936665 Ga0105242_119366652 111
282 3300009545 Ga0105237_10002095 Ga0105237_1000209510 111
283 3300009545 Ga0105237_10002351 Ga0105237_1000235114 111
284 3300009545 Ga0105237_10002466 Ga0105237_100024662 111
285 3300009545 Ga0105237_10003853 Ga0105237_100038538 111
286 3300009545 Ga0105237_10040762 Ga0105237_100407622 111
287 3300009545 Ga0105237_10053536 Ga0105237_100535362 111
288 3300009545 Ga0105237_10067582 Ga0105237_100675823 111
289 3300009545 Ga0105237_10807896 Ga0105237_108078962 111
290 3300009545 Ga0105237_11264118 Ga0105237_112641181 111
291 3300009545 Ga0105237_12692298 Ga0105237_126922981 111
292 3300009551 Ga0105238_10011323 Ga0105238_100113237 111
293 3300009551 Ga0105238_10118022 Ga0105238_101180223 111
294 3300009551 Ga0105238_10348900 Ga0105238_103489003 111
295 3300009551 Ga0105238_10900602 Ga0105238_109006022 111
296 3300009551 Ga0105238_11206799 Ga0105238_112067992 111
297 3300009553 Ga0105249_10010747 Ga0105249_100107473 111
298 3300009553 Ga0105249_11450177 Ga0105249_114501772 111
299 3300009553 Ga0105249_12645958 Ga0105249_126459582 111
300 3300010375 Ga0105239_10000101 Ga0105239_1000010114 111
301 3300010375 Ga0105239_10001330 Ga0105239_1000133019 111
302 3300010375 Ga0105239_10011303 Ga0105239_100113034 111
303 3300010375 Ga0105239_10072551 Ga0105239_100725514 111
304 3300010375 Ga0105239_10131430 Ga0105239_101314303 111
305 3300010375 Ga0105239_10461790 Ga0105239_104617902 111
306 3300011119 Ga0105246_10109153 Ga0105246_101091533 111
307 3300013100 Ga0157373_10421026 Ga0157373_104210262 111
308 3300013102 Ga0157371_11140109 Ga0157371_111401091 111
309 3300013104 Ga0157370_10014954 Ga0157370_100149546 111
310 3300013104 Ga0157370_11323445 Ga0157370_113234451 111
311 3300013296 Ga0157374_10000002 Ga0157374_10000002770 111
312 3300013296 Ga0157374_10192129 Ga0157374_101921293 111
313 3300013296 Ga0157374_11766194 Ga0157374_117661942 111
314 3300013297 Ga0157378_10041199 Ga0157378_100411994 111
315 3300013297 Ga0157378_10176997 Ga0157378_101769973 111
316 3300013297 Ga0157378_10535752 Ga0157378_105357522 111
317 3300013297 Ga0157378_10548701 Ga0157378_105487012 111
318 3300013297 Ga0157378_10864076 Ga0157378_108640762 111
319 3300013306 Ga0163162_10000167 Ga0163162_1000016711 111
320 3300013306 Ga0163162_10000376 Ga0163162_1000037622 111
321 3300013306 Ga0163162_10085463 Ga0163162_100854634 111
322 3300013307 Ga0157372_10001423 Ga0157372_100014235 111
323 3300013307 Ga0157372_10002026 Ga0157372_100020269 111
324 3300013307 Ga0157372_11076670 Ga0157372_110766702 111
325 3300013308 Ga0157375_10089380 Ga0157375_100893805 111
326 3300013308 Ga0157375_10393600 Ga0157375_103936002 111
327 3300014325 Ga0163163_10066461 Ga0163163_100664612 111
328 3300014325 Ga0163163_10140628 Ga0163163_101406283 111
329 3300014325 Ga0163163_10751807 Ga0163163_107518072 111
330 3300014745 Ga0157377_10580834 Ga0157377_105808342 111
331 3300014968 Ga0157379_10019184 Ga0157379_100191844 111
332 3300014968 Ga0157379_11223221 Ga0157379_112232212 111
333 3300014969 Ga0157376_10005350 Ga0157376_100053506 111
334 3300014969 Ga0157376_10008770 Ga0157376_100087704 111
335 3300015261 Ga0182006_1288588 Ga0182006_12885881 111
336 3300017792 Ga0163161_10341699 Ga0163161_103416992 111
337 3300024123 Ga0228600_1012163 Ga0228600_10121632 111
338 3300025246 Ga0209646_1003513 Ga0209646_10035135 111
339 3300025321 Ga0207656_10081905 Ga0207656_100819052 111
340 3300025903 Ga0207680_10000408 Ga0207680_100004088 111
341 3300025903 Ga0207680_10262395 Ga0207680_102623952 111
342 3300025904 Ga0207647_10020916 Ga0207647_100209164 111
343 3300025904 Ga0207647_10318027 Ga0207647_103180272 111
344 3300025907 Ga0207645_10732424 Ga0207645_107324242 111
345 3300025909 Ga0207705_10259035 Ga0207705_102590352 111
346 3300025911 Ga0207654_10001077 Ga0207654_100010773 111
347 3300025911 Ga0207654_10001446 Ga0207654_100014464 111
348 3300025911 Ga0207654_10096969 Ga0207654_100969692 111
349 3300025913 Ga0207695_10000952 Ga0207695_100009527 111
350 3300025913 Ga0207695_10017832 Ga0207695_100178324 111
351 3300025913 Ga0207695_10026482 Ga0207695_100264823 111
352 3300025913 Ga0207695_10117436 Ga0207695_101174362 111
353 3300025913 Ga0207695_11139102 Ga0207695_111391022 111
354 3300025914 Ga0207671_10001600 Ga0207671_100016004 111
355 3300025914 Ga0207671_10001660 Ga0207671_1000166011 111
356 3300025914 Ga0207671_10002175 Ga0207671_1000217511 111
357 3300025914 Ga0207671_10025170 Ga0207671_100251702 111
358 3300025914 Ga0207671_10089346 Ga0207671_100893462 111
359 3300025914 Ga0207671_10178512 Ga0207671_101785123 111
360 3300025914 Ga0207671_10333823 Ga0207671_103338232 111
361 3300025914 Ga0207671_10536024 Ga0207671_105360241 111
362 3300025920 Ga0207649_11194841 Ga0207649_111948412 111
363 3300025922 Ga0207646_10760820 Ga0207646_107608202 111
364 3300025924 Ga0207694_10054476 Ga0207694_100544763 111
365 3300025924 Ga0207694_10410171 Ga0207694_104101712 111
366 3300025924 Ga0207694_10513402 Ga0207694_105134022 111
367 3300025924 Ga0207694_10527888 Ga0207694_105278882 111
368 3300025925 Ga0207650_10023739 Ga0207650_100237392 111
369 3300025931 Ga0207644_10315343 Ga0207644_103153432 111
370 3300025931 Ga0207644_10439294 Ga0207644_104392941 111
371 3300025934 Ga0207686_10353789 Ga0207686_103537892 111
372 3300025934 Ga0207686_11655763 Ga0207686_116557632 111
373 3300025937 Ga0207669_11294975 Ga0207669_112949752 111
374 3300025940 Ga0207691_10291314 Ga0207691_102913142 111
375 3300025941 Ga0207711_11089106 Ga0207711_110891061 111
376 3300025942 Ga0207689_10000357 Ga0207689_1000035730 111
377 3300025942 Ga0207689_10753505 Ga0207689_107535052 111
378 3300025942 Ga0207689_11515323 Ga0207689_115153232 111
379 3300025949 Ga0207667_10020728 Ga0207667_100207284 111
380 3300025949 Ga0207667_10038908 Ga0207667_100389082 111
381 3300025949 Ga0207667_10387745 Ga0207667_103877452 111
382 3300025961 Ga0207712_10025486 Ga0207712_100254864 111
383 3300025972 Ga0207668_10082146 Ga0207668_100821463 111
384 3300025981 Ga0207640_10017902 Ga0207640_100179022 111
385 3300025986 Ga0207658_10008823 Ga0207658_100088237 111
386 3300025986 Ga0207658_10147034 Ga0207658_101470343 111
387 3300025986 Ga0207658_10843177 Ga0207658_108431772 111
388 3300026023 Ga0207677_10037911 Ga0207677_100379113 111
389 3300026023 Ga0207677_10056863 Ga0207677_100568632 111
390 3300026023 Ga0207677_10420748 Ga0207677_104207482 111
391 3300026035 Ga0207703_10010057 Ga0207703_100100575 111
392 3300026035 Ga0207703_10174964 Ga0207703_101749642 111
393 3300026041 Ga0207639_10108268 Ga0207639_101082682 111
394 3300026041 Ga0207639_10909249 Ga0207639_109092492 111
395 3300026041 Ga0207639_11005484 Ga0207639_110054841 111
396 3300026078 Ga0207702_11331566 Ga0207702_113315662 111
397 3300026078 Ga0207702_11669222 Ga0207702_116692222 111
398 3300026088 Ga0207641_10000840 Ga0207641_1000084017 111
399 3300026088 Ga0207641_10006292 Ga0207641_100062923 111
400 3300026089 Ga0207648_10225288 Ga0207648_102252883 111
401 3300026089 Ga0207648_10542711 Ga0207648_105427112 111
402 3300026095 Ga0207676_10029219 Ga0207676_100292193 111
403 3300026116 Ga0207674_10007429 Ga0207674_100074295 111
404 3300026116 Ga0207674_10915968 Ga0207674_109159682 111
405 3300026118 Ga0207675_100826679 Ga0207675_1008266792 111
406 3300026121 Ga0207683_10567208 Ga0207683_105672082 111
407 3300026142 Ga0207698_10026889 Ga0207698_100268892 111
408 3300026142 Ga0207698_10121128 Ga0207698_101211282 111
409 3300026142 Ga0207698_10257227 Ga0207698_102572272 111
410 3300026142 Ga0207698_10282154 Ga0207698_102821541 111
411 3300026142 Ga0207698_11238092 Ga0207698_112380921 111
412 3300028379 Ga0268266_10000088 Ga0268266_10000088159 111
413 3300028380 Ga0268265_11567118 Ga0268265_115671181 111
414 3300028381 Ga0268264_10000201 Ga0268264_1000020120 111
415 3300028381 Ga0268264_10012477 Ga0268264_100124776 111
416 3300028381 Ga0268264_10036570 Ga0268264_100365704 111
417 3300028381 Ga0268264_10038853 Ga0268264_100388534 111
418 3300028381 Ga0268264_10803455 Ga0268264_108034552 111
419 3300028786 Ga0307517_10111879 Ga0307517_101118792 111
420 3300028786 Ga0307517_10269102 Ga0307517_102691022 111
421 3300028794 Ga0307515_10000341 Ga0307515_100003417 111
422 3300030521 Ga0307511_10000224 Ga0307511_1000022413 111
423 3300030522 Ga0307512_10391982 Ga0307512_103919822 111
424 3300031456 Ga0307513_10443438 Ga0307513_104434382 111
425 3300031507 Ga0307509_10210338 Ga0307509_102103382 111
426 3300031507 Ga0307509_10339589 Ga0307509_103395892 111
427 3300031730 Ga0307516_10005173 Ga0307516_100051736 111
428 3300031730 Ga0307516_10023610 Ga0307516_100236104 111
429 3300033180 Ga0307510_10001354 Ga0307510_100013544 111
430 3300033180 Ga0307510_10405495 Ga0307510_104054952 111
431 3300041459 Ga0451800_0560944 Ga0451800_0560944_307_642 111
432 3300041486 Ga0451807_2616608 Ga0451807_2616608_35_370 111
433 3300041491 Ga0451833_0186840 Ga0451833_0186840_334_669 111
434 3300041505 Ga0451849_0148220 Ga0451849_0148220_268_603 111
435 3300041509 Ga0451843_1341855 Ga0451843_1341855_41_376 111
436 3300041511 Ga0451855_1902866 Ga0451855_1902866_184_519 111
437 3300041512 Ga0451853_2343836 Ga0451853_2343836_12_347 111
438 3300042014 Ga0439457_124905 Ga0439457_124905_74_409 111
439 3300044658 Ga0466972_0000091 Ga0466972_0000091_70144_70479 111
440 3300044658 Ga0466972_0013757 Ga0466972_0013757_1234_1569 111
441 3300044658 Ga0466972_0038329 Ga0466972_0038329_1012_1347 111
442 3300044693 Ga0466961_0013099 Ga0466961_0013099_1245_1580 111
443 3300044706 Ga0466964_0072261 Ga0466964_0072261_940_1275 111
444 3300044719 Ga0466971_0009293 Ga0466971_0009293_2189_2524 111
445 3300044842 Ga0466957_0003784 Ga0466957_0003784_1559_1894 111
446 3300044901 Ga0466960_0675119 Ga0466960_0675119_119_454 111
447 3300045049 Ga0466959_0002154 Ga0466959_0002154_4226_4561 111
448 3300045836 Ga0466958_0025486 Ga0466958_0025486_1927_2262 111
449 3300046460 Ga0495638_0023711 Ga0495638_0023711_2192_2527 111
450 3300046460 Ga0495638_0153332 Ga0495638_0153332_477_812 111
451 3300046460 Ga0495638_0360180 Ga0495638_0360180_10_345 111
452 3300046507 Ga0495606_0008008 Ga0495606_0008008_5392_5727 111
453 3300046514 Ga0495618_0376994 Ga0495618_0376994_280_615 111
454 3300046519 Ga0495632_0334263 Ga0495632_0334263_174_509 111
455 3300046524 Ga0495648_0002082 Ga0495648_0002082_13789_14124 111
456 3300046648 Ga0495611_0000634 Ga0495611_0000634_17262_17597 111
457 3300046660 Ga0495625_0181145 Ga0495625_0181145_877_1212 111
458 3300047320 Ga0495672_0102837 Ga0495672_0102837_16_366 111
459 3300047443 Ga0495687_000079 Ga0495687_000079_123914_124249 111
460 3300048907 Ga0496104_1203883 Ga0496104_1203883_278_622 111
461 3300049571 Ga0501034_1054572 Ga0501034_1054572_198_533 111
462 3300049579 Ga0501043_0117779 Ga0501043_0117779_1236_1571 111
463 3300049580 Ga0501046_0350476 Ga0501046_0350476_478_813 111
464 3300049581 Ga0501047_0042687 Ga0501047_0042687_3597_3932 111
465 3300049582 Ga0501048_0062986 Ga0501048_0062986_1317_1652 111
466 3300049678 Ga0501248_033933 Ga0501248_033933_49_384 111
467 3300049705 Ga0501225_0043010 Ga0501225_0043010_493_852 111
468 3300049758 Ga0501241_005443 Ga0501241_005443_402_761 111
469 3300049822 Ga0501035_0593788 Ga0501035_0593788_468_803 111
470 3300049823 Ga0501044_0086356 Ga0501044_0086356_2557_2892 111
471 3300049823 Ga0501044_0203593 Ga0501044_0203593_34_369 111
472 3300050005 Ga0501284_00139 Ga0501284_00139_6837_7196 111
473 3300050493 nmdc:mga0k408_68207_c1 nmdc:mga0k408_68207_c1_1381_1716 111
474 3300050507 nmdc:mga05p37_250156_c1 nmdc:mga05p37_250156_c1_339_674 111
475 3300053088 Ga0500644_0335489 Ga0500644_0335489_11_346 111
476 3300053090 Ga0500646_0037211 Ga0500646_0037211_816_1151 111
477 3300053090 Ga0500646_0329800 Ga0500646_0329800_196_531 111
478 3300053092 Ga0500583_0000002 Ga0500583_0000002_156455_156790 111
479 3300053092 Ga0500583_0012784 Ga0500583_0012784_966_1301 111
480 3300053092 Ga0500583_0016828 Ga0500583_0016828_2366_2701 111
481 3300053092 Ga0500583_0459609 Ga0500583_0459609_124_459 111
482 3300053093 Ga0500651_0345007 Ga0500651_0345007_328_663 111
483 3300053102 Ga0500554_010964 Ga0500554_010964_602_937 111
484 3300053111 Ga0500572_015074 Ga0500572_015074_1563_1898 111
485 3300053118 Ga0500594_0019577 Ga0500594_0019577_1163_1498 111
486 3300053130 Ga0500642_0280189 Ga0500642_0280189_243_578 111
487 3300053130 Ga0500642_0307583 Ga0500642_0307583_324_659 111
488 3300053131 Ga0500652_048022 Ga0500652_048022_1224_1559 111
489 3300053133 Ga0500655_078082 Ga0500655_078082_62_397 111
490 3300053136 Ga0500559_0277681 Ga0500559_0277681_74_409 111
491 3300053139 Ga0500568_0008536 Ga0500568_0008536_2641_2976 111
492 3300053140 Ga0500573_0158466 Ga0500573_0158466_525_860 111
493 3300053143 Ga0500579_235674 Ga0500579_235674_64_399 111
494 3300053146 Ga0500588_0040843 Ga0500588_0040843_592_927 111
495 3300053150 Ga0500603_091655 Ga0500603_091655_212_547 111
496 3300053153 Ga0500616_0157842 Ga0500616_0157842_271_606 111
497 3300053153 Ga0500616_0325618 Ga0500616_0325618_146_481 111
498 3300053156 Ga0500622_0008448 Ga0500622_0008448_1287_1622 111
499 3300053156 Ga0500622_0055373 Ga0500622_0055373_1490_1825 111
500 3300053156 Ga0500622_0369398 Ga0500622_0369398_32_367 111
501 3300053163 Ga0500639_183053 Ga0500639_183053_315_650 111
502 3300053177 Ga0500636_0089632 Ga0500636_0089632_906_1241 111
503 3300053177 Ga0500636_0439948 Ga0500636_0439948_167_502 111
504 3300053178 Ga0500637_0604864 Ga0500637_0604864_37_372 111
505 3300053726 Ga0500584_107272 Ga0500584_107272_232_567 111
506 3300053727 Ga0500611_002885 Ga0500611_002885_439_774 111
507 3300053739 Ga0500587_009819 Ga0500587_009819_598_933 111
508 3300002739 JGI25158J39367_1004610 JGI25158J39367_10046102 112
509 3300003320 rootH2_10076151 rootH2_100761512 112
510 3300003323 rootH1_10040801 rootH1_100408012 112
511 3300005577 Ga0068857_100031335 Ga0068857_1000313354 112
512 3300025981 Ga0207640_10157720 Ga0207640_101577202 112

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01588

tRNA_bind

Putative tRNA binding domain

14

110

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2q2i-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9764 1 112
2nzo-assembly2.cif.gz_D crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1 0.9731 2 112
2q2i-assembly1.cif.gz_A crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens. 0.9714 1 112
2q2h-assembly1.cif.gz_B crystal structure of the protein secretion chaperone csaa from agrobacterium tumefaciens with a genetically fused phage-display derived peptide substrate at the n-terminus. 0.9714 2 112
2nzo-assembly2.cif.gz_C crystal structure of a secretion chaperone csaa from bacillus subtilis in the space group p 32 2 1 0.9697 3 112
ID Description Score Start End Superfamily
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9886 2 112 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9764 1 112 2.40.50.140
af_Q54B13_2_117_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9712 2 112 2.40.50.140
2q2iB00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9677 1 112 2.40.50.140
1gd7A00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9672 3 112 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A4R1BNJ5-F1-model_v4 tRNA-binding protein 0.9956 1 112 GO:0000049
AF-A0A3E1Y9R8-F1-model_v4 tRNA-binding protein 0.9954 1 112 GO:0000049
AF-A0A356R983-F1-model_v4 tRNA-binding protein 0.9929 12 112 GO:0000049
AF-A0A359DSK8-F1-model_v4 deleted 0.9928 1 112
AF-A0A561IKL8-F1-model_v4 deleted 0.9928 1 112

Feature Viewer

pLDDT pTM Quality
95.81 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map