F457355

General Info

Members Datasets Scaffolds Average Seq Length
511 176 511 292

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0032184|Ga0500616_0032184_1041_1952
Length 303
Sequence MTAGRAIERFLEMMAVERGASRHTLAAYRNDLEDLALFLVGRGAGLETADPEQLRGYMADLGRRAMSARTAARRRSAIRQFFRFLYAEGVRTDDPSATLDGPRLGAPLPKLLSAAEIAELIAAAAVAPAPGGLRLVAILELLYASGMRVSELVGLPLSAVIRDPQALIVRGKGDKERMVPLTDAARAAVKAYLAVRPAFLAEGQVSRHLFPVPRRAEALDRNEVGRQLKKIAAAAGVDPAKVSPHVLRHAYATHLLEGGADLRSVQQLLGHADIATTQIYTHVAVPRLKAMVAAHHPLARRRN

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
148 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
149 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
150 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
156 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
157 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
160 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
161 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
162 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
176 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 4.89
Rhizosphere 94.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10033656 3300001979 Bacteria 1624
2 JGI24737J22298_10006029 3300001990 Bacteria 4159
3 Ga0070658_10036243 3300005327 Bacteria 3975
4 Ga0070658_10137799 3300005327 Bacteria 2037
5 Ga0070683_100018947 3300005329 Bacteria 6106
6 Ga0070690_100000750 3300005330 Bacteria 16607
7 Ga0070670_100002627 3300005331 Bacteria 14846
8 Ga0070670_100007371 3300005331 Bacteria 9341
9 Ga0070670_100030487 3300005331 Bacteria 4644
10 Ga0068869_100101818 3300005334 Bacteria 2173
11 Ga0070666_10000404 3300005335 Bacteria 27169
12 Ga0070666_10002430 3300005335 Bacteria 11259
13 Ga0070666_10041032 3300005335 Bacteria 3091
14 Ga0070666_10241040 3300005335 Bacteria 1279
15 Ga0070680_100025656 3300005336 Bacteria 4712
16 Ga0070680_100050869 3300005336 Bacteria 3380
17 Ga0070680_100138748 3300005336 Bacteria 2038
18 Ga0070682_100075508 3300005337 Bacteria 2167
19 Ga0068868_100001667 3300005338 Bacteria 15171
20 Ga0070660_100003873 3300005339 Bacteria 10334
21 Ga0070660_100006908 3300005339 Bacteria 7873
22 Ga0070660_100058053 3300005339 Bacteria 3000
23 Ga0070660_100066058 3300005339 Bacteria 2815
24 Ga0070660_100154316 3300005339 Bacteria 1848
25 Ga0070660_100257875 3300005339 Bacteria 1423
26 Ga0070691_10055588 3300005341 Bacteria 1896
27 Ga0070687_100080458 3300005343 Bacteria 1776
28 Ga0070661_100018229 3300005344 Bacteria 4989
29 Ga0070661_100044670 3300005344 Bacteria 3237
30 Ga0070661_100053410 3300005344 Bacteria 2957
31 Ga0070661_100064094 3300005344 Bacteria 2700
32 Ga0070661_100108661 3300005344 Bacteria 2070
33 Ga0070661_100111579 3300005344 Bacteria 2042
34 Ga0070692_10002433 3300005345 Bacteria 7224
35 Ga0070675_100010408 3300005354 Bacteria 7265
36 Ga0070675_100076440 3300005354 Bacteria 2785
37 Ga0070671_100003128 3300005355 Bacteria 12891
38 Ga0070671_100006801 3300005355 Bacteria 9152
39 Ga0070671_100009228 3300005355 Bacteria 7923
40 Ga0070671_100012280 3300005355 Bacteria 6893
41 Ga0070671_100021092 3300005355 Bacteria 5319
42 Ga0070671_100024725 3300005355 Bacteria 4920
43 Ga0070671_100100762 3300005355 Bacteria 2423
44 Ga0070671_100231351 3300005355 Bacteria 1568
45 Ga0070674_100017149 3300005356 Bacteria 4549
46 Ga0070674_100048960 3300005356 Bacteria 2903
47 Ga0070674_100050912 3300005356 Bacteria 2852
48 Ga0070674_100086397 3300005356 Bacteria 2253
49 Ga0070673_100002544 3300005364 Bacteria 11131
50 Ga0070673_100016707 3300005364 Bacteria 5199
51 Ga0070673_100071881 3300005364 Bacteria 2781
52 Ga0070673_100138715 3300005364 Bacteria 2049
53 Ga0070659_100008214 3300005366 Bacteria 7622
54 Ga0070659_100011294 3300005366 Bacteria 6600
55 Ga0070659_100022580 3300005366 Bacteria 4803
56 Ga0070659_100067163 3300005366 Bacteria 2843
57 Ga0070659_100114900 3300005366 Bacteria 2175
58 Ga0070667_100003837 3300005367 Bacteria 12768
59 Ga0070714_100028110 3300005435 Bacteria 4662
60 Ga0070714_100122691 3300005435 Bacteria 2313
61 Ga0070713_100179448 3300005436 Bacteria 1902
62 Ga0070663_100019491 3300005455 Bacteria 4472
63 Ga0070663_100029543 3300005455 Bacteria 3747
64 Ga0070663_100052481 3300005455 Bacteria 2908
65 Ga0070663_100179880 3300005455 Bacteria 1640
66 Ga0070663_100234744 3300005455 Bacteria 1445
67 Ga0070678_100001957 3300005456 Bacteria 11119
68 Ga0070678_100026119 3300005456 Bacteria 3942
69 Ga0070678_100142395 3300005456 Bacteria 1920
70 Ga0070662_100000866 3300005457 Bacteria 18520
71 Ga0070662_100003728 3300005457 Bacteria 9536
72 Ga0070662_100012251 3300005457 Bacteria 5679
73 Ga0070662_100055311 3300005457 Bacteria 2878
74 Ga0070662_100272633 3300005457 Bacteria 1367
75 Ga0070681_10267610 3300005458 Bacteria 1620
76 Ga0068867_100512329 3300005459 Bacteria 1033
77 Ga0070679_100045525 3300005530 Bacteria 4372
78 Ga0070679_100140676 3300005530 Bacteria 2393
79 Ga0070684_100160633 3300005535 Bacteria 2038
80 Ga0068853_100024744 3300005539 Bacteria 5036
81 Ga0068853_100033137 3300005539 Bacteria 4381
82 Ga0068853_100058899 3300005539 Bacteria 3317
83 Ga0068853_100140918 3300005539 Bacteria 2164
84 Ga0068853_100157252 3300005539 Bacteria 2048
85 Ga0068853_100183112 3300005539 Bacteria 1900
86 Ga0070672_100004370 3300005543 Bacteria 9260
87 Ga0070672_100039061 3300005543 Bacteria 3633
88 Ga0070693_100025170 3300005547 Bacteria 3200
89 Ga0070665_100153034 3300005548 Bacteria 2309
90 Ga0068855_100133640 3300005563 Bacteria 2831
91 Ga0068855_100407032 3300005563 Bacteria 1490
92 Ga0070664_100003352 3300005564 Bacteria 12952
93 Ga0070664_100003436 3300005564 Bacteria 12801
94 Ga0070664_100009960 3300005564 Bacteria 7705
95 Ga0070664_100023073 3300005564 Bacteria 5136
96 Ga0070664_100024518 3300005564 Bacteria 4989
97 Ga0070664_100070065 3300005564 Bacteria 3002
98 Ga0070664_100075366 3300005564 Bacteria 2897
99 Ga0070664_100250150 3300005564 Bacteria 1593
100 Ga0068857_100000325 3300005577 Bacteria 32762
101 Ga0068857_100021705 3300005577 Bacteria 5649
102 Ga0068857_100139716 3300005577 Bacteria 2189
103 Ga0068857_100283799 3300005577 Bacteria 1523
104 Ga0068854_100065607 3300005578 Bacteria 2640
105 Ga0068854_100067347 3300005578 Bacteria 2608
106 Ga0068856_100014714 3300005614 Bacteria 7551
107 Ga0068856_100144210 3300005614 Bacteria 2389
108 Ga0068856_100204618 3300005614 Bacteria 1988
109 Ga0068852_100010286 3300005616 Bacteria 6981
110 Ga0068852_100019330 3300005616 Bacteria 5389
111 Ga0068852_100035772 3300005616 Bacteria 4146
112 Ga0068852_100054519 3300005616 Bacteria 3446
113 Ga0068852_100357629 3300005616 Bacteria 1427
114 Ga0068852_100412997 3300005616 Bacteria 1330
115 Ga0068859_100029119 3300005617 Bacteria 5542
116 Ga0068859_100104345 3300005617 Bacteria 2894
117 Ga0068864_100000768 3300005618 Bacteria 26958
118 Ga0068864_100004140 3300005618 Bacteria 11901
119 Ga0068864_100090694 3300005618 Bacteria 2695
120 Ga0068866_10005064 3300005718 Bacteria 5428
121 Ga0068861_100115426 3300005719 Bacteria 2157
122 Ga0068851_10013164 3300005834 Bacteria 3913
123 Ga0068851_10145310 3300005834 Bacteria 1293
124 Ga0068863_100074911 3300005841 Bacteria 3202
125 Ga0068863_100267016 3300005841 Bacteria 1655
126 Ga0068858_100005036 3300005842 Bacteria 12951
127 Ga0068858_100069212 3300005842 Bacteria 3271
128 Ga0068860_100058657 3300005843 Bacteria 3659
129 Ga0081539_10033654 3300005985 Bacteria 3116
130 Ga0081539_10071159 3300005985 Bacteria 1864
131 Ga0070717_10005365 3300006028 Bacteria 9349
132 Ga0070716_100167447 3300006173 Bacteria 1431
133 Ga0097621_100003188 3300006237 Bacteria 11278
134 Ga0097621_100101891 3300006237 Bacteria 2416
135 Ga0068871_100048209 3300006358 Bacteria 3438
136 Ga0068871_100242634 3300006358 Bacteria 1567
137 Ga0068871_100312328 3300006358 Bacteria 1382
138 Ga0068865_100015662 3300006881 Bacteria 4838
139 Ga0097620_100029120 3300006931 Bacteria 5542
140 Ga0097620_100104345 3300006931 Bacteria 2894
141 Ga0105240_10024421 3300009093 Bacteria 7965
142 Ga0105240_10211504 3300009093 Bacteria 2266
143 Ga0105245_10156144 3300009098 Bacteria 2161
144 Ga0105245_10416992 3300009098 Bacteria 1345
145 Ga0105241_10233601 3300009174 Bacteria 1551
146 Ga0105242_10265279 3300009176 Bacteria 1553
147 Ga0105248_10001683 3300009177 Bacteria 24621
148 Ga0105248_10001721 3300009177 Bacteria 24322
149 Ga0105248_10003888 3300009177 Bacteria 16511
150 Ga0105248_10008936 3300009177 Bacteria 11019
151 Ga0105248_10046894 3300009177 Bacteria 4845
152 Ga0105248_10052917 3300009177 Bacteria 4556
153 Ga0105237_10047670 3300009545 Bacteria 4307
154 Ga0105238_10033305 3300009551 Bacteria 5244
155 Ga0105238_10381587 3300009551 Bacteria 1401
156 Ga0157373_10014370 3300013100 Bacteria 5803
157 Ga0157373_10045276 3300013100 Bacteria 3141
158 Ga0157373_10143522 3300013100 Bacteria 1679
159 Ga0157371_10063548 3300013102 Bacteria 2616
160 Ga0157371_10132501 3300013102 Bacteria 1774
161 Ga0157371_10205260 3300013102 Bacteria 1413
162 Ga0157370_10036150 3300013104 Bacteria 4795
163 Ga0157370_10036320 3300013104 Bacteria 4783
164 Ga0157370_10241993 3300013104 Bacteria 1669
165 Ga0157370_10253852 3300013104 Bacteria 1626
166 Ga0157370_10279907 3300013104 Bacteria 1541
167 Ga0157370_10568058 3300013104 Bacteria 1039
168 Ga0157369_10068388 3300013105 Bacteria 3816
169 Ga0157369_10197468 3300013105 Bacteria 2112
170 Ga0157369_10235963 3300013105 Bacteria 1911
171 Ga0157369_10294988 3300013105 Bacteria 1687
172 Ga0157369_10308984 3300013105 Bacteria 1644
173 Ga0157374_10021539 3300013296 Bacteria 5738
174 Ga0157374_10139913 3300013296 Bacteria 2349
175 Ga0157378_10024540 3300013297 Bacteria 5308
176 Ga0157378_10162208 3300013297 Bacteria 2091
177 Ga0157378_10254504 3300013297 Bacteria 1682
178 Ga0163162_10001373 3300013306 Bacteria 22633
179 Ga0157372_10088294 3300013307 Bacteria 3520
180 Ga0157372_10229267 3300013307 Bacteria 2153
181 Ga0157375_10088117 3300013308 Bacteria 3158
182 Ga0157375_10989989 3300013308 Bacteria 981
183 Ga0163163_10003320 3300014325 Bacteria 13646
184 Ga0163163_10039404 3300014325 Bacteria 4611
185 Ga0157377_10008638 3300014745 Bacteria 4974
186 Ga0207697_10004254 3300025315 Bacteria 6873
187 Ga0207656_10031205 3300025321 Bacteria 2206
188 Ga0207656_10064923 3300025321 Bacteria 1610
189 Ga0207656_10104510 3300025321 Bacteria 1302
190 Ga0207682_10005716 3300025893 Bacteria 5044
191 Ga0207642_10011871 3300025899 Bacteria 3125
192 Ga0207688_10012378 3300025901 Bacteria 4641
193 Ga0207688_10044400 3300025901 Bacteria 2477
194 Ga0207680_10000398 3300025903 Bacteria 20709
195 Ga0207647_10002018 3300025904 Bacteria 15524
196 Ga0207647_10003169 3300025904 Bacteria 12341
197 Ga0207647_10003785 3300025904 Bacteria 11307
198 Ga0207647_10015489 3300025904 Bacteria 5224
199 Ga0207647_10026714 3300025904 Bacteria 3773
200 Ga0207645_10004551 3300025907 Bacteria 10239
201 Ga0207645_10034374 3300025907 Bacteria 3257
202 Ga0207643_10028903 3300025908 Bacteria 3082
203 Ga0207705_10004521 3300025909 Bacteria 10510
204 Ga0207705_10014010 3300025909 Bacteria 5779
205 Ga0207705_10034746 3300025909 Bacteria 3605
206 Ga0207705_10048893 3300025909 Bacteria 3043
207 Ga0207705_10079667 3300025909 Bacteria 2385
208 Ga0207705_10090133 3300025909 Bacteria 2244
209 Ga0207695_10016569 3300025913 Bacteria 8618
210 Ga0207695_10120144 3300025913 Bacteria 2597
211 Ga0207671_10015904 3300025914 Bacteria 5869
212 Ga0207671_10062899 3300025914 Bacteria 2757
213 Ga0207657_10000631 3300025919 Bacteria 37345
214 Ga0207657_10001922 3300025919 Bacteria 22436
215 Ga0207657_10004647 3300025919 Bacteria 14504
216 Ga0207657_10009173 3300025919 Bacteria 9976
217 Ga0207657_10030555 3300025919 Bacteria 4889
218 Ga0207657_10042536 3300025919 Bacteria 4007
219 Ga0207657_10058885 3300025919 Bacteria 3303
220 Ga0207657_10155159 3300025919 Bacteria 1862
221 Ga0207649_10004815 3300025920 Bacteria 7299
222 Ga0207649_10025930 3300025920 Bacteria 3424
223 Ga0207649_10064666 3300025920 Bacteria 2313
224 Ga0207649_10102083 3300025920 Bacteria 1900
225 Ga0207649_10168906 3300025920 Bacteria 1522
226 Ga0207652_10127208 3300025921 Bacteria 2270
227 Ga0207694_10043157 3300025924 Bacteria 3480
228 Ga0207650_10017346 3300025925 Bacteria 5040
229 Ga0207650_10051469 3300025925 Bacteria 3048
230 Ga0207650_10116667 3300025925 Bacteria 2073
231 Ga0207659_10039563 3300025926 Bacteria 3290
232 Ga0207687_10253459 3300025927 Bacteria 1400
233 Ga0207700_10016449 3300025928 Bacteria 4914
234 Ga0207664_10031771 3300025929 Bacteria 4042
235 Ga0207644_10000664 3300025931 Bacteria 21695
236 Ga0207644_10008194 3300025931 Bacteria 6844
237 Ga0207644_10008537 3300025931 Bacteria 6702
238 Ga0207644_10017336 3300025931 Bacteria 4862
239 Ga0207644_10120368 3300025931 Bacteria 1998
240 Ga0207644_10132653 3300025931 Bacteria 1909
241 Ga0207690_10014745 3300025932 Bacteria 4726
242 Ga0207690_10039976 3300025932 Bacteria 3063
243 Ga0207690_10139353 3300025932 Bacteria 1785
244 Ga0207690_10245220 3300025932 Bacteria 1381
245 Ga0207690_10281955 3300025932 Bacteria 1294
246 Ga0207706_10014196 3300025933 Bacteria 7221
247 Ga0207706_10025624 3300025933 Bacteria 5283
248 Ga0207706_10037644 3300025933 Bacteria 4294
249 Ga0207706_10079794 3300025933 Bacteria 2878
250 Ga0207706_10178304 3300025933 Bacteria 1866
251 Ga0207706_10188585 3300025933 Bacteria 1810
252 Ga0207706_10357730 3300025933 Bacteria 1269
253 Ga0207686_10165818 3300025934 Bacteria 1553
254 Ga0207669_10258919 3300025937 Bacteria 1300
255 Ga0207669_10323423 3300025937 Bacteria 1181
256 Ga0207704_10104727 3300025938 Bacteria 1896
257 Ga0207665_10072954 3300025939 Bacteria 2346
258 Ga0207691_10006999 3300025940 Bacteria 10882
259 Ga0207691_10054895 3300025940 Bacteria 3633
260 Ga0207691_10078186 3300025940 Bacteria 2978
261 Ga0207711_10001247 3300025941 Bacteria 24153
262 Ga0207711_10001618 3300025941 Bacteria 20781
263 Ga0207711_10002775 3300025941 Bacteria 15413
264 Ga0207711_10015104 3300025941 Bacteria 6413
265 Ga0207689_10084575 3300025942 Bacteria 2608
266 Ga0207661_10203994 3300025944 Bacteria 1740
267 Ga0207661_10307806 3300025944 Bacteria 1422
268 Ga0207679_10002922 3300025945 Bacteria 10586
269 Ga0207679_10012018 3300025945 Bacteria 5629
270 Ga0207679_10013805 3300025945 Bacteria 5297
271 Ga0207679_10189109 3300025945 Bacteria 1710
272 Ga0207679_10276541 3300025945 Bacteria 1438
273 Ga0207679_10321280 3300025945 Bacteria 1340
274 Ga0207667_10009340 3300025949 Bacteria 11566
275 Ga0207667_10101234 3300025949 Bacteria 2972
276 Ga0207651_10029924 3300025960 Bacteria 3459
277 Ga0207668_10074838 3300025972 Bacteria 2433
278 Ga0207668_10236004 3300025972 Bacteria 1477
279 Ga0207640_10002139 3300025981 Bacteria 10614
280 Ga0207640_10038722 3300025981 Bacteria 3012
281 Ga0207640_10056579 3300025981 Bacteria 2576
282 Ga0207640_10191539 3300025981 Bacteria 1542
283 Ga0207658_10001030 3300025986 Bacteria 22692
284 Ga0207677_10002654 3300026023 Bacteria 9414
285 Ga0207677_10310854 3300026023 Bacteria 1306
286 Ga0207677_10426996 3300026023 Bacteria 1130
287 Ga0207703_10001128 3300026035 Bacteria 25174
288 Ga0207703_10045083 3300026035 Bacteria 3546
289 Ga0207703_10559259 3300026035 Bacteria 1079
290 Ga0207639_10025301 3300026041 Bacteria 4303
291 Ga0207639_10032439 3300026041 Bacteria 3845
292 Ga0207639_10033899 3300026041 Bacteria 3770
293 Ga0207639_10106886 3300026041 Bacteria 2272
294 Ga0207678_10002050 3300026067 Bacteria 18282
295 Ga0207678_10007179 3300026067 Bacteria 9880
296 Ga0207678_10050319 3300026067 Bacteria 3600
297 Ga0207678_10063585 3300026067 Bacteria 3171
298 Ga0207678_10145294 3300026067 Bacteria 2024
299 Ga0207678_10153653 3300026067 Bacteria 1965
300 Ga0207702_10018359 3300026078 Bacteria 5787
301 Ga0207702_10019886 3300026078 Bacteria 5562
302 Ga0207702_10230088 3300026078 Bacteria 1732
303 Ga0207702_10241279 3300026078 Bacteria 1693
304 Ga0207641_10208703 3300026088 Bacteria 1805
305 Ga0207648_10001174 3300026089 Bacteria 29284
306 Ga0207676_10003070 3300026095 Bacteria 11917
307 Ga0207676_10003305 3300026095 Bacteria 11447
308 Ga0207676_10030956 3300026095 Bacteria 4021
309 Ga0207676_10053465 3300026095 Bacteria 3161
310 Ga0207676_10063422 3300026095 Bacteria 2935
311 Ga0207674_10000567 3300026116 Bacteria 48417
312 Ga0207674_10007772 3300026116 Bacteria 12476
313 Ga0207674_10014781 3300026116 Bacteria 8609
314 Ga0207674_10019963 3300026116 Bacteria 7251
315 Ga0207674_10085531 3300026116 Bacteria 3149
316 Ga0207675_100109316 3300026118 Bacteria 2608
317 Ga0207683_10002114 3300026121 Bacteria 17471
318 Ga0207683_10065778 3300026121 Bacteria 3196
319 Ga0207683_10086467 3300026121 Bacteria 2787
320 Ga0207698_10002033 3300026142 Bacteria 11927
321 Ga0207698_10030539 3300026142 Bacteria 3876
322 Ga0207698_10050499 3300026142 Bacteria 3173
323 Ga0207698_10084269 3300026142 Bacteria 2576
324 Ga0207698_10105943 3300026142 Bacteria 2344
325 Ga0207698_10123822 3300026142 Bacteria 2194
326 Ga0207698_10482173 3300026142 Bacteria 1203
327 Ga0268266_10217069 3300028379 Bacteria 1756
328 Ga0268264_10029374 3300028381 Bacteria 4502
329 Ga0307408_100109545 3300031548 Bacteria 2118
330 Ga0307405_10029040 3300031731 Bacteria 3228
331 Ga0307413_10079273 3300031824 Bacteria 2098
332 Ga0307413_10154244 3300031824 Bacteria 1604
333 Ga0307413_10228729 3300031824 Bacteria 1364
334 Ga0307410_10017956 3300031852 Bacteria 4262
335 Ga0307410_10041127 3300031852 Bacteria 3046
336 Ga0307410_10180256 3300031852 Bacteria 1599
337 Ga0307406_10007150 3300031901 Bacteria 6183
338 Ga0307407_10225791 3300031903 Bacteria 1269
339 Ga0307412_10059166 3300031911 Bacteria 2566
340 Ga0307412_10161714 3300031911 Bacteria 1664
341 Ga0307409_100045294 3300031995 Bacteria 3320
342 Ga0307409_100138819 3300031995 Bacteria 2091
343 Ga0307409_100191330 3300031995 Bacteria 1821
344 Ga0307409_100223777 3300031995 Bacteria 1700
345 Ga0307409_100403385 3300031995 Bacteria 1306
346 Ga0307416_100027845 3300032002 Bacteria 4192
347 Ga0307416_100034947 3300032002 Bacteria 3832
348 Ga0307414_10050741 3300032004 Bacteria 2875
349 Ga0307411_10010197 3300032005 Bacteria 4995
350 Ga0307411_10019856 3300032005 Bacteria 3892
351 Ga0307415_100010661 3300032126 Bacteria 5215
352 Ga0307415_100165703 3300032126 Bacteria 1718
353 Ga0373960_0003130 3300035121 Bacteria 3739
354 Ga0373955_0197989 3300035172 Bacteria 1196
355 Ga0395899_0000112 3300037312 Bacteria 138389
356 Ga0395899_0002666 3300037312 Bacteria 14397
357 Ga0395899_0018114 3300037312 Bacteria 5359
358 Ga0395899_0019167 3300037312 Bacteria 5199
359 Ga0395899_0020389 3300037312 Bacteria 5026
360 Ga0395899_0038798 3300037312 Bacteria 3566
361 Ga0395899_0092624 3300037312 Bacteria 2188
362 Ga0395899_0160527 3300037312 Bacteria 1588
363 Ga0395899_0168428 3300037312 Bacteria 1544
364 Ga0395899_0250837 3300037312 Bacteria 1214
365 Ga0395899_0352777 3300037312 Bacteria 983
366 Ga0395900_0000126 3300037418 Bacteria 127586
367 Ga0395900_0001168 3300037418 Bacteria 32771
368 Ga0395900_0008362 3300037418 Bacteria 10648
369 Ga0395900_0012868 3300037418 Bacteria 8548
370 Ga0395900_0015856 3300037418 Bacteria 7678
371 Ga0395900_0030347 3300037418 Bacteria 5551
372 Ga0395900_0057164 3300037418 Bacteria 4016
373 Ga0395900_0074136 3300037418 Bacteria 3499
374 Ga0395900_0082858 3300037418 Bacteria 3295
375 Ga0395900_0084764 3300037418 Bacteria 3256
376 Ga0395900_0118982 3300037418 Bacteria 2711
377 Ga0395900_0173871 3300037418 Bacteria 2191
378 Ga0395900_0178201 3300037418 Bacteria 2161
379 Ga0395900_0182649 3300037418 Bacteria 2130
380 Ga0395900_0202633 3300037418 Bacteria 2007
381 Ga0395900_0275507 3300037418 Bacteria 1676
382 Ga0395900_0356414 3300037418 Bacteria 1435
383 Ga0395900_0357755 3300037418 Bacteria 1432
384 Ga0395900_0359538 3300037418 Bacteria 1427
385 Ga0395900_0412295 3300037418 Bacteria 1313
386 Ga0395898_0021159 3300037466 Bacteria 6598
387 Ga0395898_0032179 3300037466 Bacteria 5234
388 Ga0395898_0068897 3300037466 Bacteria 3423
389 Ga0395898_0070440 3300037466 Bacteria 3380
390 Ga0395898_0071691 3300037466 Bacteria 3347
391 Ga0395898_0079802 3300037466 Bacteria 3156
392 Ga0395898_0139928 3300037466 Bacteria 2317
393 Ga0395898_0212312 3300037466 Bacteria 1846
394 Ga0395898_0331003 3300037466 Bacteria 1452
395 Ga0395898_0349920 3300037466 Bacteria 1409
396 Ga0395898_0536961 3300037466 Bacteria 1111
397 Ga0395905_0001936 3300037471 Bacteria 23765
398 Ga0395905_0001952 3300037471 Bacteria 23608
399 Ga0395905_0004699 3300037471 Bacteria 14117
400 Ga0395905_0011211 3300037471 Bacteria 8667
401 Ga0395905_0012617 3300037471 Bacteria 8128
402 Ga0395905_0018395 3300037471 Bacteria 6633
403 Ga0395905_0020228 3300037471 Bacteria 6306
404 Ga0395905_0026320 3300037471 Bacteria 5485
405 Ga0395905_0035374 3300037471 Bacteria 4690
406 Ga0395905_0042453 3300037471 Bacteria 4268
407 Ga0395905_0057675 3300037471 Bacteria 3632
408 Ga0395905_0058134 3300037471 Bacteria 3617
409 Ga0395905_0077403 3300037471 Bacteria 3116
410 Ga0395905_0094841 3300037471 Bacteria 2799
411 Ga0395905_0098479 3300037471 Bacteria 2746
412 Ga0395905_0099290 3300037471 Bacteria 2734
413 Ga0395905_0131978 3300037471 Bacteria 2349
414 Ga0395905_0133493 3300037471 Bacteria 2335
415 Ga0395905_0151353 3300037471 Bacteria 2183
416 Ga0395905_0228527 3300037471 Bacteria 1740
417 Ga0395905_0282592 3300037471 Bacteria 1546
418 Ga0395905_0316629 3300037471 Bacteria 1449
419 Ga0395905_0350718 3300037471 Bacteria 1368
420 Ga0395905_0353081 3300037471 Bacteria 1362
421 Ga0395905_0440216 3300037471 Bacteria 1201
422 Ga0395901_0000249 3300038443 Bacteria 66993
423 Ga0395901_0005045 3300038443 Bacteria 13333
424 Ga0395901_0005436 3300038443 Bacteria 12893
425 Ga0395901_0008595 3300038443 Bacteria 10321
426 Ga0395901_0009665 3300038443 Bacteria 9781
427 Ga0395901_0014990 3300038443 Bacteria 7878
428 Ga0395901_0028606 3300038443 Bacteria 5732
429 Ga0395901_0032611 3300038443 Bacteria 5372
430 Ga0395901_0061710 3300038443 Bacteria 3901
431 Ga0395901_0071690 3300038443 Bacteria 3610
432 Ga0395901_0103049 3300038443 Bacteria 2994
433 Ga0395901_0128629 3300038443 Bacteria 2662
434 Ga0395901_0144659 3300038443 Bacteria 2499
435 Ga0395901_0250719 3300038443 Bacteria 1844
436 Ga0395901_0368168 3300038443 Bacteria 1481
437 Ga0395901_0376425 3300038443 Bacteria 1462
438 Ga0395901_0500157 3300038443 Bacteria 1237
439 Ga0439448_0006213 3300042005 Bacteria 3428
440 Ga0439455_0039520 3300042012 Bacteria 1203
441 Ga0439458_0000058 3300042157 Bacteria 19198
442 Ga0466969_0085400 3300044656 Bacteria 1500
443 Ga0466972_0009706 3300044658 Bacteria 4830
444 Ga0466972_0051803 3300044658 Bacteria 1980
445 Ga0466966_0016527 3300044684 Bacteria 4873
446 Ga0466966_0061394 3300044684 Bacteria 2371
447 Ga0466966_0070497 3300044684 Bacteria 2191
448 Ga0466966_0238465 3300044684 Bacteria 1096
449 Ga0466961_0019528 3300044693 Bacteria 4359
450 Ga0466961_0033291 3300044693 Bacteria 3312
451 Ga0466961_0048978 3300044693 Bacteria 2701
452 Ga0466961_0066464 3300044693 Bacteria 2290
453 Ga0466963_0001057 3300044694 Bacteria 14336
454 Ga0466963_0002344 3300044694 Bacteria 10566
455 Ga0466963_0013369 3300044694 Bacteria 5039
456 Ga0466963_0054836 3300044694 Bacteria 2650
457 Ga0466971_0003699 3300044719 Bacteria 6540
458 Ga0466971_0006400 3300044719 Bacteria 5114
459 Ga0466971_0156400 3300044719 Bacteria 1066
460 Ga0466970_0048694 3300044765 Bacteria 2260
461 Ga0466970_0069961 3300044765 Bacteria 1887
462 Ga0466970_0160055 3300044765 Unclassified 1245
463 Ga0466957_0001390 3300044842 Bacteria 12631
464 Ga0466957_0032151 3300044842 Bacteria 3140
465 Ga0466957_0264207 3300044842 Bacteria 1148
466 Ga0466960_0033573 3300044901 Bacteria 2386
467 Ga0466959_0011168 3300045049 Bacteria 6445
468 Ga0466959_0054805 3300045049 Bacteria 2912
469 Ga0466959_0063067 3300045049 Bacteria 2692
470 Ga0466959_0136970 3300045049 Bacteria 1732
471 Ga0466958_0000384 3300045836 Bacteria 17986
472 Ga0466958_0121219 3300045836 Bacteria 1637
473 Ga0466958_0226634 3300045836 Bacteria 1193
474 Ga0466967_0089536 3300045976 Bacteria 2794
475 Ga0466967_0101862 3300045976 Bacteria 2625
476 Ga0466967_0107326 3300045976 Bacteria 2561
477 Ga0466967_0112111 3300045976 Bacteria 2507
478 Ga0466967_0197223 3300045976 Bacteria 1905
479 Ga0466967_0365883 3300045976 Bacteria 1398
480 Ga0466967_0383489 3300045976 Bacteria 1365
481 Ga0495642_0062038 3300046528 Bacteria 1552
482 Ga0495635_0404803 3300046663 Bacteria 906
483 Ga0495669_0001195 3300046684 Bacteria 10796
484 Ga0495677_0066709 3300047445 Bacteria 1338
485 Ga0496101_0013340 3300048904 Bacteria 5501
486 Ga0496101_0040879 3300048904 Bacteria 3303
487 Ga0496106_0003898 3300048909 Bacteria 11134
488 Ga0496106_0052448 3300048909 Bacteria 3077
489 Ga0496107_0006313 3300048910 Bacteria 8146
490 Ga0496108_0005349 3300048911 Bacteria 10379
491 Ga0496108_0011282 3300048911 Bacteria 7258
492 Ga0496108_0011492 3300048911 Bacteria 7195
493 Ga0496108_0024399 3300048911 Bacteria 4978
494 Ga0496108_0048127 3300048911 Bacteria 3564
495 Ga0496109_0015678 3300048912 Bacteria 6611
496 Ga0496109_0015817 3300048912 Bacteria 6587
497 Ga0496109_0136798 3300048912 Bacteria 2289
498 Ga0496110_0013583 3300048913 Bacteria 6740
499 Ga0496110_0087032 3300048913 Bacteria 2790
500 Ga0496111_0001326 3300048914 Bacteria 13920
501 Ga0496111_0002419 3300048914 Bacteria 11264
502 Ga0496112_0000738 3300048915 Bacteria 22790
503 Ga0496112_0041728 3300048915 Bacteria 4489
504 Ga0496112_0094431 3300048915 Bacteria 2961
505 Ga0496113_0010641 3300048916 Bacteria 6091
506 Ga0496113_0011946 3300048916 Bacteria 5820
507 Ga0496113_0076221 3300048916 Bacteria 2561
508 Ga0496114_0000006 3300048917 Bacteria 472921
509 Ga0496114_0062230 3300048917 Bacteria 3123
510 Ga0500616_0032184 3300053153 Bacteria 2868
511 Ga0466962_0003911 3300061719 Bacteria 7122

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035172 Ga0373955_0197989 Ga0373955_0197989_440_1171 243
2 3300037471 Ga0395905_0316629 Ga0395905_0316629_27_791 254
3 3300035121 Ga0373960_0003130 Ga0373960_0003130_2886_3728 255
4 3300037312 Ga0395899_0092624 Ga0395899_0092624_1329_2171 255
5 3300037418 Ga0395900_0008362 Ga0395900_0008362_1924_2808 269
6 3300037466 Ga0395898_0032179 Ga0395898_0032179_2681_3565 269
7 3300044684 Ga0466966_0238465 Ga0466966_0238465_243_1085 269
8 3300005343 Ga0070687_100080458 Ga0070687_1000804581 278
9 3300031995 Ga0307409_100045294 Ga0307409_1000452942 278
10 3300032126 Ga0307415_100165703 Ga0307415_1001657032 278
11 3300005341 Ga0070691_10055588 Ga0070691_100555882 279
12 3300005355 Ga0070671_100024725 Ga0070671_1000247254 279
13 3300005364 Ga0070673_100016707 Ga0070673_1000167073 279
14 3300005367 Ga0070667_100003837 Ga0070667_1000038375 279
15 3300005535 Ga0070684_100160633 Ga0070684_1001606332 279
16 3300005539 Ga0068853_100033137 Ga0068853_1000331372 279
17 3300005539 Ga0068853_100157252 Ga0068853_1001572522 279
18 3300037418 Ga0395900_0057164 Ga0395900_0057164_2477_3361 279
19 3300037471 Ga0395905_0440216 Ga0395905_0440216_131_988 279
20 3300038443 Ga0395901_0500157 Ga0395901_0500157_13_852 279
21 3300044658 Ga0466972_0051803 Ga0466972_0051803_527_1420 279
22 3300005327 Ga0070658_10036243 Ga0070658_100362432 280
23 3300005344 Ga0070661_100018229 Ga0070661_1000182291 280
24 3300005344 Ga0070661_100108661 Ga0070661_1001086612 280
25 3300005366 Ga0070659_100067163 Ga0070659_1000671633 280
26 3300005458 Ga0070681_10267610 Ga0070681_102676102 280
27 3300025949 Ga0207667_10101234 Ga0207667_101012342 280
28 3300026041 Ga0207639_10033899 Ga0207639_100338994 280
29 3300037471 Ga0395905_0151353 Ga0395905_0151353_1224_2066 280
30 3300046663 Ga0495635_0404803 Ga0495635_0404803_49_891 280
31 3300048911 Ga0496108_0024399 Ga0496108_0024399_759_1604 280
32 3300048915 Ga0496112_0041728 Ga0496112_0041728_1151_1996 280
33 3300005336 Ga0070680_100138748 Ga0070680_1001387482 281
34 3300005539 Ga0068853_100140918 Ga0068853_1001409182 281
35 3300009174 Ga0105241_10233601 Ga0105241_102336012 281
36 3300025919 Ga0207657_10009173 Ga0207657_100091737 281
37 3300005564 Ga0070664_100075366 Ga0070664_1000753662 282
38 3300005834 Ga0068851_10145310 Ga0068851_101453101 282
39 3300025945 Ga0207679_10189109 Ga0207679_101891092 282
40 3300026078 Ga0207702_10241279 Ga0207702_102412792 282
41 3300026116 Ga0207674_10019963 Ga0207674_100199636 282
42 3300044693 Ga0466961_0066464 Ga0466961_0066464_394_1278 282
43 3300045049 Ga0466959_0136970 Ga0466959_0136970_249_1133 283
44 3300045836 Ga0466958_0121219 Ga0466958_0121219_340_1224 283
45 3300025909 Ga0207705_10079667 Ga0207705_100796673 284
46 3300005539 Ga0068853_100183112 Ga0068853_1001831121 287
47 3300009093 Ga0105240_10024421 Ga0105240_100244216 287
48 3300009093 Ga0105240_10211504 Ga0105240_102115042 287
49 3300009545 Ga0105237_10047670 Ga0105237_100476702 287
50 3300013100 Ga0157373_10143522 Ga0157373_101435222 287
51 3300013104 Ga0157370_10241993 Ga0157370_102419932 287
52 3300013104 Ga0157370_10253852 Ga0157370_102538522 287
53 3300013105 Ga0157369_10068388 Ga0157369_100683882 287
54 3300013105 Ga0157369_10235963 Ga0157369_102359632 287
55 3300025913 Ga0207695_10120144 Ga0207695_101201442 287
56 3300025921 Ga0207652_10127208 Ga0207652_101272082 287
57 3300025924 Ga0207694_10043157 Ga0207694_100431573 287
58 3300026041 Ga0207639_10025301 Ga0207639_100253015 287
59 3300037312 Ga0395899_0020389 Ga0395899_0020389_3184_4047 287
60 3300037418 Ga0395900_0275507 Ga0395900_0275507_596_1459 287
61 3300037418 Ga0395900_0359538 Ga0395900_0359538_428_1291 287
62 3300037466 Ga0395898_0071691 Ga0395898_0071691_1133_1996 287
63 3300037466 Ga0395898_0212312 Ga0395898_0212312_422_1285 287
64 3300037471 Ga0395905_0042453 Ga0395905_0042453_219_1082 287
65 3300037471 Ga0395905_0094841 Ga0395905_0094841_184_1047 287
66 3300037471 Ga0395905_0133493 Ga0395905_0133493_380_1243 287
67 3300038443 Ga0395901_0128629 Ga0395901_0128629_733_1596 287
68 3300044694 Ga0466963_0054836 Ga0466963_0054836_788_1651 287
69 3300045976 Ga0466967_0101862 Ga0466967_0101862_1606_2469 287
70 3300048911 Ga0496108_0005349 Ga0496108_0005349_6165_7028 287
71 3300053153 Ga0500616_0032184 Ga0500616_0032184_1041_1952 289
72 3300005339 Ga0070660_100058053 Ga0070660_1000580532 293
73 3300005344 Ga0070661_100053410 Ga0070661_1000534102 293
74 3300005345 Ga0070692_10002433 Ga0070692_100024333 293
75 3300005455 Ga0070663_100019491 Ga0070663_1000194912 293
76 3300005564 Ga0070664_100009960 Ga0070664_1000099602 293
77 3300005578 Ga0068854_100065607 Ga0068854_1000656072 293
78 3300005834 Ga0068851_10013164 Ga0068851_100131643 293
79 3300025321 Ga0207656_10064923 Ga0207656_100649232 293
80 3300025907 Ga0207645_10004551 Ga0207645_100045518 293
81 3300025909 Ga0207705_10048893 Ga0207705_100488932 293
82 3300025919 Ga0207657_10030555 Ga0207657_100305553 293
83 3300025944 Ga0207661_10307806 Ga0207661_103078062 293
84 3300026067 Ga0207678_10002050 Ga0207678_1000205020 293
85 3300026142 Ga0207698_10030539 Ga0207698_100305394 293
86 3300026142 Ga0207698_10050499 Ga0207698_100504993 293
87 3300037466 Ga0395898_0079802 Ga0395898_0079802_99_983 293
88 3300037471 Ga0395905_0353081 Ga0395905_0353081_414_1298 293
89 3300001979 JGI24740J21852_10033656 JGI24740J21852_100336562 294
90 3300001990 JGI24737J22298_10006029 JGI24737J22298_100060292 294
91 3300005327 Ga0070658_10137799 Ga0070658_101377992 294
92 3300005329 Ga0070683_100018947 Ga0070683_1000189478 294
93 3300005330 Ga0070690_100000750 Ga0070690_1000007509 294
94 3300005331 Ga0070670_100002627 Ga0070670_10000262711 294
95 3300005331 Ga0070670_100007371 Ga0070670_1000073715 294
96 3300005331 Ga0070670_100030487 Ga0070670_1000304872 294
97 3300005334 Ga0068869_100101818 Ga0068869_1001018181 294
98 3300005335 Ga0070666_10000404 Ga0070666_1000040416 294
99 3300005335 Ga0070666_10002430 Ga0070666_1000243011 294
100 3300005335 Ga0070666_10041032 Ga0070666_100410322 294
101 3300005335 Ga0070666_10241040 Ga0070666_102410401 294
102 3300005336 Ga0070680_100025656 Ga0070680_1000256565 294
103 3300005336 Ga0070680_100050869 Ga0070680_1000508693 294
104 3300005337 Ga0070682_100075508 Ga0070682_1000755082 294
105 3300005338 Ga0068868_100001667 Ga0068868_1000016677 294
106 3300005339 Ga0070660_100003873 Ga0070660_1000038735 294
107 3300005339 Ga0070660_100006908 Ga0070660_1000069083 294
108 3300005339 Ga0070660_100066058 Ga0070660_1000660582 294
109 3300005339 Ga0070660_100154316 Ga0070660_1001543162 294
110 3300005339 Ga0070660_100257875 Ga0070660_1002578752 294
111 3300005344 Ga0070661_100044670 Ga0070661_1000446703 294
112 3300005344 Ga0070661_100064094 Ga0070661_1000640942 294
113 3300005344 Ga0070661_100111579 Ga0070661_1001115792 294
114 3300005354 Ga0070675_100010408 Ga0070675_1000104085 294
115 3300005354 Ga0070675_100076440 Ga0070675_1000764402 294
116 3300005355 Ga0070671_100003128 Ga0070671_1000031282 294
117 3300005355 Ga0070671_100006801 Ga0070671_1000068015 294
118 3300005355 Ga0070671_100009228 Ga0070671_1000092287 294
119 3300005355 Ga0070671_100012280 Ga0070671_1000122803 294
120 3300005355 Ga0070671_100021092 Ga0070671_1000210926 294
121 3300005355 Ga0070671_100100762 Ga0070671_1001007622 294
122 3300005355 Ga0070671_100231351 Ga0070671_1002313512 294
123 3300005356 Ga0070674_100017149 Ga0070674_1000171492 294
124 3300005356 Ga0070674_100048960 Ga0070674_1000489602 294
125 3300005356 Ga0070674_100050912 Ga0070674_1000509121 294
126 3300005356 Ga0070674_100086397 Ga0070674_1000863972 294
127 3300005364 Ga0070673_100002544 Ga0070673_10000254411 294
128 3300005364 Ga0070673_100071881 Ga0070673_1000718812 294
129 3300005364 Ga0070673_100138715 Ga0070673_1001387152 294
130 3300005366 Ga0070659_100008214 Ga0070659_1000082142 294
131 3300005366 Ga0070659_100011294 Ga0070659_1000112943 294
132 3300005366 Ga0070659_100022580 Ga0070659_1000225804 294
133 3300005366 Ga0070659_100114900 Ga0070659_1001149002 294
134 3300005435 Ga0070714_100028110 Ga0070714_1000281102 294
135 3300005435 Ga0070714_100122691 Ga0070714_1001226912 294
136 3300005436 Ga0070713_100179448 Ga0070713_1001794482 294
137 3300005455 Ga0070663_100029543 Ga0070663_1000295433 294
138 3300005455 Ga0070663_100052481 Ga0070663_1000524811 294
139 3300005455 Ga0070663_100179880 Ga0070663_1001798802 294
140 3300005455 Ga0070663_100234744 Ga0070663_1002347442 294
141 3300005456 Ga0070678_100001957 Ga0070678_10000195711 294
142 3300005456 Ga0070678_100026119 Ga0070678_1000261193 294
143 3300005456 Ga0070678_100142395 Ga0070678_1001423952 294
144 3300005457 Ga0070662_100000866 Ga0070662_1000008667 294
145 3300005457 Ga0070662_100003728 Ga0070662_1000037285 294
146 3300005457 Ga0070662_100012251 Ga0070662_1000122513 294
147 3300005457 Ga0070662_100055311 Ga0070662_1000553112 294
148 3300005457 Ga0070662_100272633 Ga0070662_1002726332 294
149 3300005459 Ga0068867_100512329 Ga0068867_1005123291 294
150 3300005530 Ga0070679_100045525 Ga0070679_1000455253 294
151 3300005530 Ga0070679_100140676 Ga0070679_1001406762 294
152 3300005539 Ga0068853_100024744 Ga0068853_1000247443 294
153 3300005539 Ga0068853_100058899 Ga0068853_1000588992 294
154 3300005543 Ga0070672_100004370 Ga0070672_1000043709 294
155 3300005543 Ga0070672_100039061 Ga0070672_1000390614 294
156 3300005547 Ga0070693_100025170 Ga0070693_1000251703 294
157 3300005548 Ga0070665_100153034 Ga0070665_1001530342 294
158 3300005563 Ga0068855_100133640 Ga0068855_1001336402 294
159 3300005563 Ga0068855_100407032 Ga0068855_1004070322 294
160 3300005564 Ga0070664_100003352 Ga0070664_1000033525 294
161 3300005564 Ga0070664_100003436 Ga0070664_10000343617 294
162 3300005564 Ga0070664_100023073 Ga0070664_1000230733 294
163 3300005564 Ga0070664_100024518 Ga0070664_1000245184 294
164 3300005564 Ga0070664_100070065 Ga0070664_1000700652 294
165 3300005564 Ga0070664_100250150 Ga0070664_1002501502 294
166 3300005577 Ga0068857_100000325 Ga0068857_10000032510 294
167 3300005577 Ga0068857_100021705 Ga0068857_1000217052 294
168 3300005577 Ga0068857_100139716 Ga0068857_1001397162 294
169 3300005577 Ga0068857_100283799 Ga0068857_1002837991 294
170 3300005578 Ga0068854_100067347 Ga0068854_1000673472 294
171 3300005614 Ga0068856_100014714 Ga0068856_1000147148 294
172 3300005614 Ga0068856_100144210 Ga0068856_1001442103 294
173 3300005614 Ga0068856_100204618 Ga0068856_1002046182 294
174 3300005616 Ga0068852_100010286 Ga0068852_1000102862 294
175 3300005616 Ga0068852_100019330 Ga0068852_1000193305 294
176 3300005616 Ga0068852_100035772 Ga0068852_1000357723 294
177 3300005616 Ga0068852_100054519 Ga0068852_1000545192 294
178 3300005616 Ga0068852_100357629 Ga0068852_1003576292 294
179 3300005616 Ga0068852_100412997 Ga0068852_1004129971 294
180 3300005617 Ga0068859_100029119 Ga0068859_1000291193 294
181 3300005617 Ga0068859_100104345 Ga0068859_1001043453 294
182 3300005618 Ga0068864_100000768 Ga0068864_10000076815 294
183 3300005618 Ga0068864_100004140 Ga0068864_10000414014 294
184 3300005618 Ga0068864_100090694 Ga0068864_1000906943 294
185 3300005718 Ga0068866_10005064 Ga0068866_100050645 294
186 3300005719 Ga0068861_100115426 Ga0068861_1001154262 294
187 3300005841 Ga0068863_100074911 Ga0068863_1000749113 294
188 3300005841 Ga0068863_100267016 Ga0068863_1002670162 294
189 3300005842 Ga0068858_100005036 Ga0068858_1000050364 294
190 3300005842 Ga0068858_100069212 Ga0068858_1000692122 294
191 3300005843 Ga0068860_100058657 Ga0068860_1000586572 294
192 3300005985 Ga0081539_10033654 Ga0081539_100336542 294
193 3300005985 Ga0081539_10071159 Ga0081539_100711592 294
194 3300006028 Ga0070717_10005365 Ga0070717_100053652 294
195 3300006173 Ga0070716_100167447 Ga0070716_1001674472 294
196 3300006237 Ga0097621_100003188 Ga0097621_10000318810 294
197 3300006237 Ga0097621_100101891 Ga0097621_1001018912 294
198 3300006358 Ga0068871_100048209 Ga0068871_1000482092 294
199 3300006358 Ga0068871_100242634 Ga0068871_1002426342 294
200 3300006358 Ga0068871_100312328 Ga0068871_1003123282 294
201 3300006881 Ga0068865_100015662 Ga0068865_1000156622 294
202 3300006931 Ga0097620_100029120 Ga0097620_1000291203 294
203 3300006931 Ga0097620_100104345 Ga0097620_1001043453 294
204 3300009098 Ga0105245_10156144 Ga0105245_101561442 294
205 3300009098 Ga0105245_10416992 Ga0105245_104169921 294
206 3300009176 Ga0105242_10265279 Ga0105242_102652792 294
207 3300009177 Ga0105248_10001683 Ga0105248_1000168313 294
208 3300009177 Ga0105248_10001721 Ga0105248_1000172114 294
209 3300009177 Ga0105248_10003888 Ga0105248_1000388811 294
210 3300009177 Ga0105248_10008936 Ga0105248_100089366 294
211 3300009177 Ga0105248_10046894 Ga0105248_100468945 294
212 3300009177 Ga0105248_10052917 Ga0105248_100529173 294
213 3300009551 Ga0105238_10033305 Ga0105238_100333056 294
214 3300009551 Ga0105238_10381587 Ga0105238_103815872 294
215 3300013100 Ga0157373_10014370 Ga0157373_100143702 294
216 3300013100 Ga0157373_10045276 Ga0157373_100452762 294
217 3300013102 Ga0157371_10063548 Ga0157371_100635482 294
218 3300013102 Ga0157371_10132501 Ga0157371_101325012 294
219 3300013102 Ga0157371_10205260 Ga0157371_102052602 294
220 3300013104 Ga0157370_10036150 Ga0157370_100361505 294
221 3300013104 Ga0157370_10036320 Ga0157370_100363205 294
222 3300013104 Ga0157370_10279907 Ga0157370_102799072 294
223 3300013104 Ga0157370_10568058 Ga0157370_105680582 294
224 3300013105 Ga0157369_10197468 Ga0157369_101974682 294
225 3300013105 Ga0157369_10294988 Ga0157369_102949882 294
226 3300013105 Ga0157369_10308984 Ga0157369_103089842 294
227 3300013296 Ga0157374_10021539 Ga0157374_100215395 294
228 3300013296 Ga0157374_10139913 Ga0157374_101399132 294
229 3300013297 Ga0157378_10024540 Ga0157378_100245402 294
230 3300013297 Ga0157378_10162208 Ga0157378_101622082 294
231 3300013297 Ga0157378_10254504 Ga0157378_102545042 294
232 3300013306 Ga0163162_10001373 Ga0163162_1000137317 294
233 3300013307 Ga0157372_10088294 Ga0157372_100882943 294
234 3300013307 Ga0157372_10229267 Ga0157372_102292672 294
235 3300013308 Ga0157375_10088117 Ga0157375_100881172 294
236 3300013308 Ga0157375_10989989 Ga0157375_109899891 294
237 3300014325 Ga0163163_10003320 Ga0163163_1000332015 294
238 3300014325 Ga0163163_10039404 Ga0163163_100394045 294
239 3300014745 Ga0157377_10008638 Ga0157377_100086385 294
240 3300025315 Ga0207697_10004254 Ga0207697_100042543 294
241 3300025321 Ga0207656_10031205 Ga0207656_100312052 294
242 3300025321 Ga0207656_10104510 Ga0207656_101045102 294
243 3300025893 Ga0207682_10005716 Ga0207682_100057165 294
244 3300025899 Ga0207642_10011871 Ga0207642_100118712 294
245 3300025901 Ga0207688_10012378 Ga0207688_100123782 294
246 3300025901 Ga0207688_10044400 Ga0207688_100444002 294
247 3300025903 Ga0207680_10000398 Ga0207680_1000039816 294
248 3300025904 Ga0207647_10002018 Ga0207647_1000201812 294
249 3300025904 Ga0207647_10003169 Ga0207647_100031692 294
250 3300025904 Ga0207647_10003785 Ga0207647_100037858 294
251 3300025904 Ga0207647_10015489 Ga0207647_100154895 294
252 3300025904 Ga0207647_10026714 Ga0207647_100267143 294
253 3300025907 Ga0207645_10034374 Ga0207645_100343742 294
254 3300025908 Ga0207643_10028903 Ga0207643_100289032 294
255 3300025909 Ga0207705_10004521 Ga0207705_100045214 294
256 3300025909 Ga0207705_10014010 Ga0207705_100140106 294
257 3300025909 Ga0207705_10034746 Ga0207705_100347463 294
258 3300025909 Ga0207705_10090133 Ga0207705_100901332 294
259 3300025913 Ga0207695_10016569 Ga0207695_100165692 294
260 3300025914 Ga0207671_10015904 Ga0207671_100159042 294
261 3300025914 Ga0207671_10062899 Ga0207671_100628993 294
262 3300025919 Ga0207657_10000631 Ga0207657_1000063110 294
263 3300025919 Ga0207657_10001922 Ga0207657_1000192223 294
264 3300025919 Ga0207657_10004647 Ga0207657_1000464710 294
265 3300025919 Ga0207657_10042536 Ga0207657_100425363 294
266 3300025919 Ga0207657_10058885 Ga0207657_100588852 294
267 3300025919 Ga0207657_10155159 Ga0207657_101551592 294
268 3300025920 Ga0207649_10004815 Ga0207649_100048153 294
269 3300025920 Ga0207649_10025930 Ga0207649_100259303 294
270 3300025920 Ga0207649_10064666 Ga0207649_100646663 294
271 3300025920 Ga0207649_10102083 Ga0207649_101020832 294
272 3300025920 Ga0207649_10168906 Ga0207649_101689062 294
273 3300025925 Ga0207650_10017346 Ga0207650_100173463 294
274 3300025925 Ga0207650_10051469 Ga0207650_100514692 294
275 3300025925 Ga0207650_10116667 Ga0207650_101166672 294
276 3300025926 Ga0207659_10039563 Ga0207659_100395632 294
277 3300025927 Ga0207687_10253459 Ga0207687_102534592 294
278 3300025928 Ga0207700_10016449 Ga0207700_100164493 294
279 3300025929 Ga0207664_10031771 Ga0207664_100317713 294
280 3300025931 Ga0207644_10000664 Ga0207644_1000066414 294
281 3300025931 Ga0207644_10008194 Ga0207644_100081947 294
282 3300025931 Ga0207644_10008537 Ga0207644_100085373 294
283 3300025931 Ga0207644_10017336 Ga0207644_100173363 294
284 3300025931 Ga0207644_10120368 Ga0207644_101203682 294
285 3300025931 Ga0207644_10132653 Ga0207644_101326532 294
286 3300025932 Ga0207690_10014745 Ga0207690_100147455 294
287 3300025932 Ga0207690_10039976 Ga0207690_100399762 294
288 3300025932 Ga0207690_10139353 Ga0207690_101393532 294
289 3300025932 Ga0207690_10245220 Ga0207690_102452202 294
290 3300025932 Ga0207690_10281955 Ga0207690_102819552 294
291 3300025933 Ga0207706_10014196 Ga0207706_100141965 294
292 3300025933 Ga0207706_10025624 Ga0207706_100256243 294
293 3300025933 Ga0207706_10037644 Ga0207706_100376443 294
294 3300025933 Ga0207706_10079794 Ga0207706_100797943 294
295 3300025933 Ga0207706_10178304 Ga0207706_101783042 294
296 3300025933 Ga0207706_10188585 Ga0207706_101885852 294
297 3300025933 Ga0207706_10357730 Ga0207706_103577302 294
298 3300025934 Ga0207686_10165818 Ga0207686_101658182 294
299 3300025937 Ga0207669_10258919 Ga0207669_102589192 294
300 3300025937 Ga0207669_10323423 Ga0207669_103234231 294
301 3300025938 Ga0207704_10104727 Ga0207704_101047272 294
302 3300025939 Ga0207665_10072954 Ga0207665_100729542 294
303 3300025940 Ga0207691_10006999 Ga0207691_100069998 294
304 3300025940 Ga0207691_10054895 Ga0207691_100548952 294
305 3300025940 Ga0207691_10078186 Ga0207691_100781862 294
306 3300025941 Ga0207711_10001247 Ga0207711_1000124715 294
307 3300025941 Ga0207711_10001618 Ga0207711_1000161813 294
308 3300025941 Ga0207711_10002775 Ga0207711_100027758 294
309 3300025941 Ga0207711_10015104 Ga0207711_100151046 294
310 3300025942 Ga0207689_10084575 Ga0207689_100845752 294
311 3300025944 Ga0207661_10203994 Ga0207661_102039942 294
312 3300025945 Ga0207679_10002922 Ga0207679_100029222 294
313 3300025945 Ga0207679_10012018 Ga0207679_100120186 294
314 3300025945 Ga0207679_10013805 Ga0207679_100138055 294
315 3300025945 Ga0207679_10276541 Ga0207679_102765411 294
316 3300025945 Ga0207679_10321280 Ga0207679_103212802 294
317 3300025949 Ga0207667_10009340 Ga0207667_1000934015 294
318 3300025960 Ga0207651_10029924 Ga0207651_100299242 294
319 3300025972 Ga0207668_10074838 Ga0207668_100748383 294
320 3300025972 Ga0207668_10236004 Ga0207668_102360042 294
321 3300025981 Ga0207640_10002139 Ga0207640_1000213915 294
322 3300025981 Ga0207640_10038722 Ga0207640_100387222 294
323 3300025981 Ga0207640_10056579 Ga0207640_100565792 294
324 3300025981 Ga0207640_10191539 Ga0207640_101915392 294
325 3300025986 Ga0207658_10001030 Ga0207658_1000103020 294
326 3300026023 Ga0207677_10002654 Ga0207677_100026543 294
327 3300026023 Ga0207677_10310854 Ga0207677_103108542 294
328 3300026023 Ga0207677_10426996 Ga0207677_104269962 294
329 3300026035 Ga0207703_10001128 Ga0207703_1000112814 294
330 3300026035 Ga0207703_10045083 Ga0207703_100450834 294
331 3300026035 Ga0207703_10559259 Ga0207703_105592592 294
332 3300026041 Ga0207639_10032439 Ga0207639_100324392 294
333 3300026041 Ga0207639_10106886 Ga0207639_101068862 294
334 3300026067 Ga0207678_10007179 Ga0207678_100071797 294
335 3300026067 Ga0207678_10050319 Ga0207678_100503193 294
336 3300026067 Ga0207678_10063585 Ga0207678_100635852 294
337 3300026067 Ga0207678_10145294 Ga0207678_101452941 294
338 3300026067 Ga0207678_10153653 Ga0207678_101536532 294
339 3300026078 Ga0207702_10018359 Ga0207702_100183595 294
340 3300026078 Ga0207702_10019886 Ga0207702_100198865 294
341 3300026078 Ga0207702_10230088 Ga0207702_102300882 294
342 3300026088 Ga0207641_10208703 Ga0207641_102087032 294
343 3300026089 Ga0207648_10001174 Ga0207648_1000117429 294
344 3300026095 Ga0207676_10003070 Ga0207676_1000307014 294
345 3300026095 Ga0207676_10003305 Ga0207676_100033054 294
346 3300026095 Ga0207676_10030956 Ga0207676_100309564 294
347 3300026095 Ga0207676_10053465 Ga0207676_100534653 294
348 3300026095 Ga0207676_10063422 Ga0207676_100634222 294
349 3300026116 Ga0207674_10000567 Ga0207674_1000056738 294
350 3300026116 Ga0207674_10007772 Ga0207674_1000777210 294
351 3300026116 Ga0207674_10014781 Ga0207674_100147812 294
352 3300026116 Ga0207674_10085531 Ga0207674_100855312 294
353 3300026118 Ga0207675_100109316 Ga0207675_1001093162 294
354 3300026121 Ga0207683_10002114 Ga0207683_1000211411 294
355 3300026121 Ga0207683_10065778 Ga0207683_100657782 294
356 3300026121 Ga0207683_10086467 Ga0207683_100864672 294
357 3300026142 Ga0207698_10002033 Ga0207698_100020332 294
358 3300026142 Ga0207698_10084269 Ga0207698_100842692 294
359 3300026142 Ga0207698_10105943 Ga0207698_101059433 294
360 3300026142 Ga0207698_10123822 Ga0207698_101238222 294
361 3300026142 Ga0207698_10482173 Ga0207698_104821732 294
362 3300028379 Ga0268266_10217069 Ga0268266_102170692 294
363 3300028381 Ga0268264_10029374 Ga0268264_100293743 294
364 3300031548 Ga0307408_100109545 Ga0307408_1001095452 294
365 3300031731 Ga0307405_10029040 Ga0307405_100290402 294
366 3300031824 Ga0307413_10079273 Ga0307413_100792731 294
367 3300031824 Ga0307413_10154244 Ga0307413_101542442 294
368 3300031824 Ga0307413_10228729 Ga0307413_102287292 294
369 3300031852 Ga0307410_10017956 Ga0307410_100179562 294
370 3300031852 Ga0307410_10041127 Ga0307410_100411272 294
371 3300031852 Ga0307410_10180256 Ga0307410_101802562 294
372 3300031901 Ga0307406_10007150 Ga0307406_100071506 294
373 3300031903 Ga0307407_10225791 Ga0307407_102257912 294
374 3300031911 Ga0307412_10059166 Ga0307412_100591662 294
375 3300031911 Ga0307412_10161714 Ga0307412_101617142 294
376 3300031995 Ga0307409_100138819 Ga0307409_1001388192 294
377 3300031995 Ga0307409_100191330 Ga0307409_1001913302 294
378 3300031995 Ga0307409_100223777 Ga0307409_1002237772 294
379 3300031995 Ga0307409_100403385 Ga0307409_1004033851 294
380 3300032002 Ga0307416_100027845 Ga0307416_1000278455 294
381 3300032002 Ga0307416_100034947 Ga0307416_1000349472 294
382 3300032004 Ga0307414_10050741 Ga0307414_100507412 294
383 3300032005 Ga0307411_10010197 Ga0307411_100101974 294
384 3300032005 Ga0307411_10019856 Ga0307411_100198562 294
385 3300032126 Ga0307415_100010661 Ga0307415_1000106614 294
386 3300037312 Ga0395899_0000112 Ga0395899_0000112_134216_135103 294
387 3300037312 Ga0395899_0002666 Ga0395899_0002666_6904_7788 294
388 3300037312 Ga0395899_0018114 Ga0395899_0018114_2571_3455 294
389 3300037312 Ga0395899_0019167 Ga0395899_0019167_3390_4274 294
390 3300037312 Ga0395899_0038798 Ga0395899_0038798_1467_2351 294
391 3300037312 Ga0395899_0160527 Ga0395899_0160527_648_1532 294
392 3300037312 Ga0395899_0168428 Ga0395899_0168428_393_1277 294
393 3300037312 Ga0395899_0250837 Ga0395899_0250837_77_961 294
394 3300037312 Ga0395899_0352777 Ga0395899_0352777_78_962 294
395 3300037418 Ga0395900_0000126 Ga0395900_0000126_49903_50790 294
396 3300037418 Ga0395900_0001168 Ga0395900_0001168_6368_7252 294
397 3300037418 Ga0395900_0012868 Ga0395900_0012868_5903_6787 294
398 3300037418 Ga0395900_0015856 Ga0395900_0015856_548_1432 294
399 3300037418 Ga0395900_0030347 Ga0395900_0030347_1446_2330 294
400 3300037418 Ga0395900_0074136 Ga0395900_0074136_850_1734 294
401 3300037418 Ga0395900_0082858 Ga0395900_0082858_1898_2782 294
402 3300037418 Ga0395900_0084764 Ga0395900_0084764_2156_3040 294
403 3300037418 Ga0395900_0118982 Ga0395900_0118982_1340_2227 294
404 3300037418 Ga0395900_0173871 Ga0395900_0173871_736_1620 294
405 3300037418 Ga0395900_0178201 Ga0395900_0178201_1080_1988 294
406 3300037418 Ga0395900_0182649 Ga0395900_0182649_788_1672 294
407 3300037418 Ga0395900_0202633 Ga0395900_0202633_1001_1888 294
408 3300037418 Ga0395900_0356414 Ga0395900_0356414_310_1194 294
409 3300037418 Ga0395900_0357755 Ga0395900_0357755_223_1107 294
410 3300037418 Ga0395900_0412295 Ga0395900_0412295_33_917 294
411 3300037466 Ga0395898_0021159 Ga0395898_0021159_4147_5034 294
412 3300037466 Ga0395898_0068897 Ga0395898_0068897_63_947 294
413 3300037466 Ga0395898_0070440 Ga0395898_0070440_749_1633 294
414 3300037466 Ga0395898_0139928 Ga0395898_0139928_649_1536 294
415 3300037466 Ga0395898_0331003 Ga0395898_0331003_504_1388 294
416 3300037466 Ga0395898_0349920 Ga0395898_0349920_45_929 294
417 3300037466 Ga0395898_0536961 Ga0395898_0536961_126_1010 294
418 3300037471 Ga0395905_0001936 Ga0395905_0001936_18489_19373 294
419 3300037471 Ga0395905_0001952 Ga0395905_0001952_8391_9275 294
420 3300037471 Ga0395905_0004699 Ga0395905_0004699_856_1740 294
421 3300037471 Ga0395905_0011211 Ga0395905_0011211_1894_2778 294
422 3300037471 Ga0395905_0012617 Ga0395905_0012617_7224_8108 294
423 3300037471 Ga0395905_0018395 Ga0395905_0018395_4572_5456 294
424 3300037471 Ga0395905_0020228 Ga0395905_0020228_3543_4430 294
425 3300037471 Ga0395905_0026320 Ga0395905_0026320_3464_4348 294
426 3300037471 Ga0395905_0035374 Ga0395905_0035374_473_1360 294
427 3300037471 Ga0395905_0057675 Ga0395905_0057675_524_1408 294
428 3300037471 Ga0395905_0058134 Ga0395905_0058134_710_1594 294
429 3300037471 Ga0395905_0077403 Ga0395905_0077403_818_1705 294
430 3300037471 Ga0395905_0098479 Ga0395905_0098479_50_934 294
431 3300037471 Ga0395905_0099290 Ga0395905_0099290_384_1268 294
432 3300037471 Ga0395905_0131978 Ga0395905_0131978_840_1724 294
433 3300037471 Ga0395905_0228527 Ga0395905_0228527_394_1278 294
434 3300037471 Ga0395905_0282592 Ga0395905_0282592_94_978 294
435 3300037471 Ga0395905_0350718 Ga0395905_0350718_336_1229 294
436 3300038443 Ga0395901_0000249 Ga0395901_0000249_49883_50770 294
437 3300038443 Ga0395901_0005045 Ga0395901_0005045_6255_7139 294
438 3300038443 Ga0395901_0005436 Ga0395901_0005436_3928_4812 294
439 3300038443 Ga0395901_0008595 Ga0395901_0008595_8356_9240 294
440 3300038443 Ga0395901_0009665 Ga0395901_0009665_5247_6131 294
441 3300038443 Ga0395901_0014990 Ga0395901_0014990_2472_3356 294
442 3300038443 Ga0395901_0028606 Ga0395901_0028606_4694_5578 294
443 3300038443 Ga0395901_0032611 Ga0395901_0032611_3848_4732 294
444 3300038443 Ga0395901_0061710 Ga0395901_0061710_1105_1989 294
445 3300038443 Ga0395901_0071690 Ga0395901_0071690_1747_2631 294
446 3300038443 Ga0395901_0103049 Ga0395901_0103049_1104_1988 294
447 3300038443 Ga0395901_0144659 Ga0395901_0144659_1455_2339 294
448 3300038443 Ga0395901_0250719 Ga0395901_0250719_752_1636 294
449 3300038443 Ga0395901_0368168 Ga0395901_0368168_31_915 294
450 3300038443 Ga0395901_0376425 Ga0395901_0376425_332_1216 294
451 3300042005 Ga0439448_0006213 Ga0439448_0006213_2347_3231 294
452 3300042012 Ga0439455_0039520 Ga0439455_0039520_129_1013 294
453 3300042157 Ga0439458_0000058 Ga0439458_0000058_15710_16594 294
454 3300044656 Ga0466969_0085400 Ga0466969_0085400_514_1398 294
455 3300044658 Ga0466972_0009706 Ga0466972_0009706_846_1730 294
456 3300044684 Ga0466966_0016527 Ga0466966_0016527_1597_2481 294
457 3300044684 Ga0466966_0061394 Ga0466966_0061394_1142_2029 294
458 3300044684 Ga0466966_0070497 Ga0466966_0070497_1243_2127 294
459 3300044693 Ga0466961_0019528 Ga0466961_0019528_1834_2718 294
460 3300044693 Ga0466961_0033291 Ga0466961_0033291_2248_3132 294
461 3300044693 Ga0466961_0048978 Ga0466961_0048978_874_1758 294
462 3300044694 Ga0466963_0001057 Ga0466963_0001057_5175_6059 294
463 3300044694 Ga0466963_0002344 Ga0466963_0002344_1643_2527 294
464 3300044694 Ga0466963_0013369 Ga0466963_0013369_2984_3868 294
465 3300044719 Ga0466971_0003699 Ga0466971_0003699_642_1526 294
466 3300044719 Ga0466971_0006400 Ga0466971_0006400_2791_3675 294
467 3300044719 Ga0466971_0156400 Ga0466971_0156400_127_1011 294
468 3300044765 Ga0466970_0048694 Ga0466970_0048694_1284_2168 294
469 3300044765 Ga0466970_0069961 Ga0466970_0069961_992_1876 294
470 3300044765 Ga0466970_0160055 Ga0466970_0160055_303_1187 294
471 3300044842 Ga0466957_0001390 Ga0466957_0001390_11123_12007 294
472 3300044842 Ga0466957_0032151 Ga0466957_0032151_286_1173 294
473 3300044842 Ga0466957_0264207 Ga0466957_0264207_37_921 294
474 3300044901 Ga0466960_0033573 Ga0466960_0033573_444_1328 294
475 3300045049 Ga0466959_0011168 Ga0466959_0011168_2625_3509 294
476 3300045049 Ga0466959_0054805 Ga0466959_0054805_324_1208 294
477 3300045049 Ga0466959_0063067 Ga0466959_0063067_582_1469 294
478 3300045836 Ga0466958_0000384 Ga0466958_0000384_10292_11176 294
479 3300045836 Ga0466958_0226634 Ga0466958_0226634_283_1167 294
480 3300045976 Ga0466967_0089536 Ga0466967_0089536_41_925 294
481 3300045976 Ga0466967_0107326 Ga0466967_0107326_720_1604 294
482 3300045976 Ga0466967_0112111 Ga0466967_0112111_127_1011 294
483 3300045976 Ga0466967_0197223 Ga0466967_0197223_598_1482 294
484 3300045976 Ga0466967_0365883 Ga0466967_0365883_397_1281 294
485 3300045976 Ga0466967_0383489 Ga0466967_0383489_25_909 294
486 3300046528 Ga0495642_0062038 Ga0495642_0062038_107_991 294
487 3300046684 Ga0495669_0001195 Ga0495669_0001195_5515_6399 294
488 3300047445 Ga0495677_0066709 Ga0495677_0066709_42_926 294
489 3300048904 Ga0496101_0013340 Ga0496101_0013340_1694_2578 294
490 3300048904 Ga0496101_0040879 Ga0496101_0040879_850_1734 294
491 3300048909 Ga0496106_0003898 Ga0496106_0003898_3884_4768 294
492 3300048909 Ga0496106_0052448 Ga0496106_0052448_2129_3013 294
493 3300048910 Ga0496107_0006313 Ga0496107_0006313_3019_3903 294
494 3300048911 Ga0496108_0011282 Ga0496108_0011282_3961_4845 294
495 3300048911 Ga0496108_0011492 Ga0496108_0011492_2028_2912 294
496 3300048911 Ga0496108_0048127 Ga0496108_0048127_1231_2115 294
497 3300048912 Ga0496109_0015678 Ga0496109_0015678_3426_4310 294
498 3300048912 Ga0496109_0015817 Ga0496109_0015817_1809_2693 294
499 3300048912 Ga0496109_0136798 Ga0496109_0136798_979_1863 294
500 3300048913 Ga0496110_0013583 Ga0496110_0013583_471_1355 294
501 3300048913 Ga0496110_0087032 Ga0496110_0087032_685_1569 294
502 3300048914 Ga0496111_0001326 Ga0496111_0001326_10388_11272 294
503 3300048914 Ga0496111_0002419 Ga0496111_0002419_8743_9627 294
504 3300048915 Ga0496112_0000738 Ga0496112_0000738_3977_4861 294
505 3300048915 Ga0496112_0094431 Ga0496112_0094431_1231_2115 294
506 3300048916 Ga0496113_0010641 Ga0496113_0010641_3758_4642 294
507 3300048916 Ga0496113_0011946 Ga0496113_0011946_3060_3944 294
508 3300048916 Ga0496113_0076221 Ga0496113_0076221_1199_2083 294
509 3300048917 Ga0496114_0000006 Ga0496114_0000006_20730_21614 294
510 3300048917 Ga0496114_0062230 Ga0496114_0062230_304_1188 294
511 3300061719 Ga0466962_0003911 Ga0466962_0003911_3492_4376 294

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02899

Phage_int_SAM_1

Phage integrase, N-terminal SAM-like domain

7

89

0.99

PF00589

Phage_integrase

Phage integrase family

110

287

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2khv-assembly1.cif.gz_A solution nmr structure of protein nmul_a0922 from nitrosospira multiformis. northeast structural genomics consortium target nmr38b. 0.8201 7 92
2kkp-assembly1.cif.gz_A solution nmr structure of the phage integrase sam-like domain from moth 1796 from moorella thermoacetica. northeast structural genomics consortium target mtr39k (residues 64-171). 0.781 29 100
2kob-assembly1.cif.gz_A solution nmr structure of clolep_01837 (fragment 61-160) from clostridium leptum. northeast structural genomics consortium target qlr8a 0.7791 8 102
3lys-assembly6.cif.gz_F crystal structure of the n-terminal domain of the prophage pi2 protein 01 (integrase) from lactococcus lactis, northeast structural genomics consortium target kr124f 0.7512 8 97
5dcf-assembly1.cif.gz_A c-terminal domain of xerd recombinase in complex with gamma domain of ftsk 0.7089 108 286
ID Description Score Start End Superfamily
af_Q2FY74_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.9021 7 92 1.10.150.130
af_P9WF35_2_96_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8684 7 92 1.10.150.130
af_P0A8P6_5_99_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8503 7 92 1.10.150.130
1a0pA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8322 5 93 1.10.150.130
af_Q2FZ30_3_95_1.10.150.130 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;Tyrosine recombinase, N-terminal domain 0.8303 8 92 1.10.150.130
ID Description Score Start End GO Terms
AF-A0A3D4LZV6-F1-model_v4 deleted 0.9075 117 290
AF-A0A7V8KMK0-F1-model_v4 deleted 0.883 146 294
AF-A0A440K037-F1-model_v4 deleted 0.8805 108 240
AF-A0A3D4LZV6-F1-model_v4 deleted 0.869 117 290
AF-A0A2D5UYB8-F1-model_v4 Tyr recombinase domain-containing protein 0.853 97 290 GO:0003677
GO:0006310
GO:0015074

Feature Viewer

pLDDT pTM Quality
80.42 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map