F457347

General Info

Members Datasets Scaffolds Average Seq Length
511 277 1022 107

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_1323200|Ga0501075_1323200_130_471
Length 113
Sequence MDRRSATDVLLPGTLEMLILQTLTGGPMHGYGIASHIWRTSAELLRVEEGSLYPALRRLQVKGWVKSRWQLTPTKRRARYYELTSAGSRALGQEVERYERVTLGIARVMGTAS

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
169 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
170 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
176 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
177 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
178 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
179 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
180 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
181 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
182 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
185 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
186 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
196 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
199 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
210 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
211 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
214 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
251 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
261 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
262 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
267 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
270 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
271 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
272 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
276 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
277 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.8
Metatranscriptomes 0.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.28
Nodule 0
Rhizoplane 2.74
Rhizosphere 90.8
Stem 0
Stem Tuber 0
Unclassified 36.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_1323200 3300049591 Unclassified 546
2 MRS1b_contig_3737759 2162886011 Bacteria 825
3 MRS1b_contig_4810271 2162886011 Bacteria 1062
4 Ga0065712_10076964 3300005290 Bacteria 3568
5 Ga0065715_10115649 3300005293 Bacteria 2408
6 Ga0065707_10134631 3300005295 Unclassified 1862
7 Ga0070676_10292530 3300005328 Unclassified 1101
8 Ga0070683_100000001 3300005329 Bacteria 529385
9 Ga0070683_100010238 3300005329 Bacteria 8055
10 Ga0070683_100696622 3300005329 Bacteria 973
11 Ga0070683_100700006 3300005329 Unclassified 970
12 Ga0070683_101142470 3300005329 Bacteria 748
13 Ga0070690_101147609 3300005330 Unclassified 618
14 Ga0070670_100098487 3300005331 Bacteria 2516
15 Ga0070670_100628592 3300005331 Bacteria 962
16 Ga0070670_101620447 3300005331 Unclassified 595
17 Ga0070670_101763011 3300005331 Bacteria 570
18 Ga0070670_101864299 3300005331 Unclassified 554
19 Ga0068869_100771038 3300005334 Unclassified 825
20 Ga0068869_102154666 3300005334 Unclassified 501
21 Ga0070666_10014789 3300005335 Bacteria 4973
22 Ga0070680_101113972 3300005336 Bacteria 682
23 Ga0070682_100232036 3300005337 Unclassified 1320
24 Ga0070682_101088416 3300005337 Unclassified 668
25 Ga0068868_102352408 3300005338 Unclassified 509
26 Ga0070689_100006735 3300005340 Bacteria 7986
27 Ga0070689_100442268 3300005340 Bacteria 1105
28 Ga0070689_101296717 3300005340 Unclassified 656
29 Ga0070689_102037255 3300005340 Unclassified 525
30 Ga0070687_100547120 3300005343 Bacteria 787
31 Ga0070661_100440988 3300005344 Unclassified 1035
32 Ga0070668_100453583 3300005347 Bacteria 1103
33 Ga0070668_100486909 3300005347 Bacteria 1066
34 Ga0070668_100770569 3300005347 Unclassified 853
35 Ga0070669_100158368 3300005353 Bacteria 1758
36 Ga0070669_100620747 3300005353 Unclassified 907
37 Ga0070675_100303694 3300005354 Bacteria 1407
38 Ga0070675_100348403 3300005354 Bacteria 1313
39 Ga0070675_101526038 3300005354 Bacteria 616
40 Ga0070671_100033459 3300005355 Bacteria 4252
41 Ga0070671_100529622 3300005355 Bacteria 1015
42 Ga0070674_100081547 3300005356 Bacteria 2312
43 Ga0070674_101481671 3300005356 Bacteria 609
44 Ga0070673_100483055 3300005364 Bacteria 1118
45 Ga0070688_100078726 3300005365 Bacteria 2127
46 Ga0070688_100319781 3300005365 Unclassified 1127
47 Ga0070688_100659096 3300005365 Bacteria 807
48 Ga0070667_100211186 3300005367 Bacteria 1725
49 Ga0070709_10087513 3300005434 Unclassified 2047
50 Ga0070711_100923127 3300005439 Archaea 746
51 Ga0070705_100900329 3300005440 Unclassified 711
52 Ga0070694_100571849 3300005444 Unclassified 907
53 Ga0070694_101553319 3300005444 Unclassified 561
54 Ga0070708_100296430 3300005445 Unclassified 1523
55 Ga0070708_100384983 3300005445 Bacteria 1322
56 Ga0070663_100053765 3300005455 Bacteria 2875
57 Ga0070663_100853280 3300005455 Bacteria 784
58 Ga0070678_100584955 3300005456 Bacteria 995
59 Ga0070678_101630966 3300005456 Bacteria 606
60 Ga0070662_100210178 3300005457 Bacteria 1548
61 Ga0068867_101486192 3300005459 Unclassified 630
62 Ga0068867_101936246 3300005459 Bacteria 556
63 Ga0070685_10099076 3300005466 Bacteria 1777
64 Ga0070685_10976693 3300005466 Bacteria 634
65 Ga0070685_11360216 3300005466 Bacteria 544
66 Ga0070706_100232476 3300005467 Bacteria 1721
67 Ga0070698_100251207 3300005471 Bacteria 1701
68 Ga0070698_100808064 3300005471 Bacteria 882
69 Ga0070699_100014730 3300005518 Bacteria 6724
70 Ga0070699_100485878 3300005518 Unclassified 1121
71 Ga0070679_100461202 3300005530 Bacteria 1215
72 Ga0070679_101708508 3300005530 Unclassified 577
73 Ga0070684_100000055 3300005535 Bacteria 76528
74 Ga0070684_100062031 3300005535 Bacteria 3274
75 Ga0070684_100210164 3300005535 Bacteria 1773
76 Ga0070684_100681633 3300005535 Bacteria 958
77 Ga0070684_101099757 3300005535 Bacteria 747
78 Ga0070697_100660696 3300005536 Unclassified 921
79 Ga0068853_101852075 3300005539 Unclassified 585
80 Ga0070672_100150592 3300005543 Archaea 1924
81 Ga0070686_100492614 3300005544 Unclassified 950
82 Ga0070695_100137065 3300005545 Unclassified 1693
83 Ga0070696_100356283 3300005546 Unclassified 1134
84 Ga0070665_100280471 3300005548 Bacteria 1668
85 Ga0070665_100548583 3300005548 Unclassified 1168
86 Ga0068855_100058050 3300005563 Bacteria 4533
87 Ga0068855_100288288 3300005563 Unclassified 1821
88 Ga0070664_100002126 3300005564 Bacteria 15869
89 Ga0070664_100305989 3300005564 Archaea 1437
90 Ga0068857_101958916 3300005577 Unclassified 574
91 Ga0068854_100688954 3300005578 Unclassified 881
92 Ga0068856_100720322 3300005614 Unclassified 1018
93 Ga0068856_101676510 3300005614 Bacteria 648
94 Ga0070702_101891124 3300005615 Bacteria 500
95 Ga0068859_100100862 3300005617 Bacteria 2943
96 Ga0068859_100117181 3300005617 Bacteria 2728
97 Ga0068859_100139005 3300005617 Bacteria 2503
98 Ga0068859_101644039 3300005617 Bacteria 709
99 Ga0068859_101933371 3300005617 Unclassified 651
100 Ga0068859_102149859 3300005617 Unclassified 616
101 Ga0068864_100043785 3300005618 Bacteria 3834
102 Ga0068864_100272574 3300005618 Bacteria 1577
103 Ga0068861_100328829 3300005719 Bacteria 1334
104 Ga0068861_100824315 3300005719 Unclassified 873
105 Ga0068861_102314586 3300005719 Unclassified 539
106 Ga0068861_102710868 3300005719 Unclassified 500
107 Ga0068851_10058742 3300005834 Bacteria 1966
108 Ga0068863_100082502 3300005841 Bacteria 3047
109 Ga0068863_100745050 3300005841 Bacteria 975
110 Ga0068863_100859510 3300005841 Bacteria 906
111 Ga0068863_100869580 3300005841 Unclassified 901
112 Ga0068858_100492345 3300005842 Bacteria 1184
113 Ga0068858_101082241 3300005842 Unclassified 787
114 Ga0068858_101857814 3300005842 Unclassified 595
115 Ga0068860_100363756 3300005843 Unclassified 1426
116 Ga0068860_101469707 3300005843 Bacteria 703
117 Ga0068860_102157010 3300005843 Unclassified 578
118 Ga0068862_101740085 3300005844 Bacteria 632
119 Ga0075365_10069394 3300006038 Unclassified 2369
120 Ga0075368_10071255 3300006042 Unclassified 1404
121 Ga0075368_10087964 3300006042 Unclassified 1269
122 Ga0075368_10363458 3300006042 Bacteria 631
123 Ga0075363_100375235 3300006048 Bacteria 833
124 Ga0075364_10046155 3300006051 Bacteria 2836
125 Ga0075364_10844745 3300006051 Unclassified 624
126 Ga0070715_10243949 3300006163 Archaea 936
127 Ga0070716_101663473 3300006173 Unclassified 526
128 Ga0075367_10025697 3300006178 Bacteria 3332
129 Ga0075367_10083709 3300006178 Bacteria 1933
130 Ga0075367_10325085 3300006178 Unclassified 969
131 Ga0075366_10026312 3300006195 Bacteria 3406
132 Ga0075366_10498932 3300006195 Unclassified 752
133 Ga0097621_100279251 3300006237 Bacteria 1470
134 Ga0097621_101026956 3300006237 Unclassified 772
135 Ga0075370_10031437 3300006353 Bacteria 2963
136 Ga0075370_10369077 3300006353 Unclassified 859
137 Ga0068871_100789324 3300006358 Unclassified 875
138 Ga0068871_100798563 3300006358 Unclassified 870
139 Ga0068871_101908679 3300006358 Bacteria 565
140 Ga0075428_100203760 3300006844 Bacteria 2138
141 Ga0075430_100491778 3300006846 Bacteria 1012
142 Ga0075431_100258211 3300006847 Bacteria 1769
143 Ga0075431_100554085 3300006847 Unclassified 1137
144 Ga0075431_101855080 3300006847 Unclassified 559
145 Ga0075433_10720071 3300006852 Bacteria 873
146 Ga0075434_100914616 3300006871 Bacteria 892
147 Ga0075429_100784156 3300006880 Bacteria 835
148 Ga0075436_100008116 3300006914 Bacteria 7186
149 Ga0075436_100683911 3300006914 Unclassified 759
150 Ga0097620_100100865 3300006931 Bacteria 2943
151 Ga0097620_100117190 3300006931 Bacteria 2728
152 Ga0097620_100139005 3300006931 Bacteria 2503
153 Ga0097620_101644329 3300006931 Bacteria 709
154 Ga0097620_101934131 3300006931 Unclassified 651
155 Ga0097620_102149595 3300006931 Unclassified 616
156 Ga0105240_10386149 3300009093 Bacteria 1580
157 Ga0111539_10115711 3300009094 Unclassified 3144
158 Ga0105245_10101286 3300009098 Bacteria 2666
159 Ga0105245_10256748 3300009098 Bacteria 1700
160 Ga0105245_10305530 3300009098 Unclassified 1562
161 Ga0105245_10875139 3300009098 Bacteria 939
162 Ga0105245_11002084 3300009098 Unclassified 880
163 Ga0105245_11432250 3300009098 Bacteria 741
164 Ga0105247_10288861 3300009101 Viruses 1134
165 Ga0114129_10009106 3300009147 Bacteria 14150
166 Ga0105241_10369027 3300009174 Bacteria 1251
167 Ga0105241_10490380 3300009174 Unclassified 1094
168 Ga0105241_12627118 3300009174 Unclassified 506
169 Ga0105242_10012242 3300009176 Bacteria 6602
170 Ga0105242_10068239 3300009176 Bacteria 2941
171 Ga0105242_10239956 3300009176 Bacteria 1629
172 Ga0105242_10666691 3300009176 Bacteria 1014
173 Ga0105242_11929919 3300009176 Unclassified 631
174 Ga0105242_12027240 3300009176 Unclassified 618
175 Ga0105242_12304861 3300009176 Unclassified 585
176 Ga0105248_10024738 3300009177 Bacteria 6678
177 Ga0105248_10195445 3300009177 Bacteria 2279
178 Ga0105248_10453782 3300009177 Bacteria 1445
179 Ga0105248_10512638 3300009177 Bacteria 1352
180 Ga0105248_11079184 3300009177 Bacteria 907
181 Ga0105248_11320284 3300009177 Bacteria 816
182 Ga0105237_10033994 3300009545 Bacteria 5165
183 Ga0105238_10888689 3300009551 Bacteria 909
184 Ga0105249_10700950 3300009553 Unclassified 1072
185 Ga0105239_10864737 3300010375 Unclassified 1037
186 Ga0105239_11140204 3300010375 Archaea 898
187 Ga0105239_11755252 3300010375 Unclassified 719
188 Ga0105246_11223660 3300011119 Bacteria 692
189 Ga0157371_10019333 3300013102 Bacteria 5026
190 Ga0157371_10672149 3300013102 Bacteria 774
191 Ga0157370_10146714 3300013104 Unclassified 2197
192 Ga0157370_10383200 3300013104 Bacteria 1295
193 Ga0157370_11132022 3300013104 Bacteria 707
194 Ga0157369_10051375 3300013105 Bacteria 4461
195 Ga0157369_10095744 3300013105 Bacteria 3167
196 Ga0157369_10340741 3300013105 Bacteria 1557
197 Ga0157369_10722904 3300013105 Bacteria 1025
198 Ga0157369_10724693 3300013105 Unclassified 1024
199 Ga0157374_10043046 3300013296 Bacteria 4169
200 Ga0157374_10494780 3300013296 Bacteria 1227
201 Ga0157374_10521217 3300013296 Bacteria 1194
202 Ga0157374_10768778 3300013296 Bacteria 978
203 Ga0157374_11313196 3300013296 Unclassified 745
204 Ga0157378_10458027 3300013297 Bacteria 1267
205 Ga0157378_10768257 3300013297 Unclassified 987
206 Ga0163162_10367333 3300013306 Unclassified 1572
207 Ga0163162_11010968 3300013306 Bacteria 940
208 Ga0163162_11350471 3300013306 Bacteria 810
209 Ga0163162_11713036 3300013306 Unclassified 718
210 Ga0163162_12230983 3300013306 Unclassified 629
211 Ga0163162_13171100 3300013306 Unclassified 528
212 Ga0157372_10699701 3300013307 Bacteria 1179
213 Ga0157372_11623965 3300013307 Bacteria 744
214 Ga0157372_12572174 3300013307 Unclassified 584
215 Ga0157375_10317401 3300013308 Bacteria 1723
216 Ga0157375_10385291 3300013308 Bacteria 1568
217 Ga0157375_10448153 3300013308 Bacteria 1456
218 Ga0157375_11963244 3300013308 Unclassified 695
219 Ga0157375_12014856 3300013308 Unclassified 686
220 Ga0163163_10041425 3300014325 Bacteria 4503
221 Ga0163163_10102589 3300014325 Bacteria 2884
222 Ga0163163_10182050 3300014325 Bacteria 2149
223 Ga0163163_10495704 3300014325 Archaea 1283
224 Ga0163163_10604057 3300014325 Bacteria 1160
225 Ga0163163_12097674 3300014325 Unclassified 625
226 Ga0157380_10011436 3300014326 Bacteria 6414
227 Ga0157380_10018513 3300014326 Bacteria 5170
228 Ga0157380_10413992 3300014326 Bacteria 1283
229 Ga0157380_10428430 3300014326 Bacteria 1264
230 Ga0157377_10819061 3300014745 Unclassified 688
231 Ga0157377_10967203 3300014745 Bacteria 642
232 Ga0157379_10082978 3300014968 Bacteria 2872
233 Ga0157379_10237093 3300014968 Bacteria 1654
234 Ga0157379_10693328 3300014968 Bacteria 956
235 Ga0157379_12259752 3300014968 Bacteria 541
236 Ga0157376_10182226 3300014969 Bacteria 1921
237 Ga0157376_10373498 3300014969 Bacteria 1371
238 Ga0157376_10595924 3300014969 Unclassified 1099
239 Ga0157376_10704114 3300014969 Bacteria 1015
240 Ga0157376_11270142 3300014969 Unclassified 766
241 Ga0157376_11584302 3300014969 Bacteria 689
242 Ga0213876_10613818 3300021384 Unclassified 579
243 Ga0207680_10119288 3300025903 Bacteria 1723
244 Ga0207647_10542152 3300025904 Unclassified 646
245 Ga0207699_10105221 3300025906 Bacteria 1799
246 Ga0207699_10584962 3300025906 Unclassified 812
247 Ga0207707_10028508 3300025912 Unclassified 4880
248 Ga0207707_10716999 3300025912 Unclassified 839
249 Ga0207695_10128392 3300025913 Bacteria 2495
250 Ga0207695_10406470 3300025913 Unclassified 1246
251 Ga0207671_10084035 3300025914 Archaea 2390
252 Ga0207663_10060511 3300025916 Bacteria 2400
253 Ga0207663_10353537 3300025916 Unclassified 1113
254 Ga0207660_10948363 3300025917 Bacteria 702
255 Ga0207657_10247198 3300025919 Bacteria 1423
256 Ga0207649_10177830 3300025920 Unclassified 1487
257 Ga0207652_10286302 3300025921 Bacteria 1487
258 Ga0207652_11632593 3300025921 Bacteria 549
259 Ga0207646_11570864 3300025922 Bacteria 568
260 Ga0207694_10887754 3300025924 Bacteria 754
261 Ga0207650_10341998 3300025925 Bacteria 1229
262 Ga0207659_10292224 3300025926 Bacteria 1336
263 Ga0207659_10381969 3300025926 Bacteria 1175
264 Ga0207659_10635050 3300025926 Unclassified 912
265 Ga0207687_10099994 3300025927 Bacteria 2132
266 Ga0207687_10858214 3300025927 Bacteria 776
267 Ga0207700_11726996 3300025928 Unclassified 551
268 Ga0207664_10866803 3300025929 Unclassified 811
269 Ga0207644_10113429 3300025931 Unclassified 2052
270 Ga0207706_10139379 3300025933 Bacteria 2133
271 Ga0207706_11504411 3300025933 Unclassified 549
272 Ga0207686_10193750 3300025934 Bacteria 1451
273 Ga0207686_10836121 3300025934 Bacteria 740
274 Ga0207686_11664868 3300025934 Unclassified 527
275 Ga0207709_10880486 3300025935 Unclassified 727
276 Ga0207670_10373623 3300025936 Bacteria 1134
277 Ga0207670_11161074 3300025936 Unclassified 653
278 Ga0207669_11239192 3300025937 Unclassified 633
279 Ga0207711_10762377 3300025941 Bacteria 902
280 Ga0207711_10841293 3300025941 Unclassified 854
281 Ga0207711_10863552 3300025941 Bacteria 842
282 Ga0207711_11313651 3300025941 Unclassified 665
283 Ga0207661_10000005 3300025944 Bacteria 557888
284 Ga0207661_10030845 3300025944 Bacteria 4133
285 Ga0207661_10881370 3300025944 Bacteria 824
286 Ga0207661_11776884 3300025944 Bacteria 562
287 Ga0207679_10060861 3300025945 Bacteria 2807
288 Ga0207679_11617738 3300025945 Unclassified 593
289 Ga0207679_11645156 3300025945 Unclassified 588
290 Ga0207667_10946736 3300025949 Bacteria 851
291 Ga0207651_11183587 3300025960 Unclassified 686
292 Ga0207668_10280986 3300025972 Bacteria 1365
293 Ga0207668_10637159 3300025972 Bacteria 932
294 Ga0207640_11115688 3300025981 Bacteria 698
295 Ga0207640_11740569 3300025981 Unclassified 563
296 Ga0207658_10128709 3300025986 Bacteria 2031
297 Ga0207703_10316024 3300026035 Bacteria 1429
298 Ga0207703_10437522 3300026035 Bacteria 1219
299 Ga0207703_10476101 3300026035 Unclassified 1169
300 Ga0207639_11806311 3300026041 Bacteria 572
301 Ga0207678_10053477 3300026067 Bacteria 3480
302 Ga0207702_10505890 3300026078 Bacteria 1178
303 Ga0207641_10063558 3300026088 Bacteria 3153
304 Ga0207641_10585684 3300026088 Bacteria 1091
305 Ga0207641_11459938 3300026088 Bacteria 685
306 Ga0207648_11697556 3300026089 Bacteria 593
307 Ga0207676_10277588 3300026095 Bacteria 1520
308 Ga0207676_10653818 3300026095 Bacteria 1015
309 Ga0207675_100059787 3300026118 Bacteria 3557
310 Ga0207675_100284522 3300026118 Bacteria 1607
311 Ga0207683_10436015 3300026121 Bacteria 1207
312 Ga0209813_10046983 3300027866 Unclassified 1335
313 Ga0207428_10007201 3300027907 Bacteria 10174
314 Ga0207428_10876409 3300027907 Bacteria 635
315 Ga0268266_10121705 3300028379 Bacteria 2323
316 Ga0268266_10182617 3300028379 Bacteria 1911
317 Ga0268266_10560616 3300028379 Unclassified 1095
318 Ga0268266_11529173 3300028379 Unclassified 643
319 Ga0268265_10647140 3300028380 Bacteria 1016
320 Ga0268265_12258492 3300028380 Unclassified 551
321 Ga0268264_10732523 3300028381 Bacteria 984
322 Ga0268264_11658009 3300028381 Bacteria 650
323 Ga0265762_1078201 3300030760 Bacteria 705
324 Ga0265328_10193689 3300031239 Unclassified 771
325 Ga0265339_10150008 3300031249 Unclassified 1180
326 Ga0265331_10124272 3300031250 Bacteria 1179
327 Ga0265316_10003057 3300031344 Bacteria 17084
328 Ga0265316_10068367 3300031344 Unclassified 2745
329 Ga0265316_10179557 3300031344 Bacteria 1576
330 Ga0265316_10676835 3300031344 Unclassified 728
331 Ga0307509_10224788 3300031507 Bacteria 1686
332 Ga0307408_100006207 3300031548 Bacteria 7938
333 Ga0307408_100013955 3300031548 Bacteria 5336
334 Ga0265314_10206278 3300031711 Bacteria 1157
335 Ga0265342_10129654 3300031712 Unclassified 1414
336 Ga0265342_10165805 3300031712 Bacteria 1218
337 Ga0307405_10121763 3300031731 Unclassified 1786
338 Ga0307410_10242788 3300031852 Bacteria 1396
339 Ga0307406_10017574 3300031901 Unclassified 4167
340 Ga0307406_10615132 3300031901 Bacteria 897
341 Ga0307407_10074344 3300031903 Bacteria 2033
342 Ga0307412_10097962 3300031911 Unclassified 2067
343 Ga0307416_100248167 3300032002 Unclassified 1730
344 Ga0307416_101499750 3300032002 Bacteria 780
345 Ga0307414_11404252 3300032004 Unclassified 649
346 Ga0307411_10044102 3300032005 Unclassified 2858
347 Ga0307415_100112038 3300032126 Bacteria 2027
348 Ga0373923_0116213 3300035111 Bacteria 1192
349 Ga0373932_0379341 3300035112 Unclassified 543
350 Ga0373936_0577609 3300035113 Unclassified 527
351 Ga0373939_0249809 3300035114 Unclassified 690
352 Ga0373945_0477485 3300035116 Unclassified 553
353 Ga0373953_0155737 3300035117 Bacteria 981
354 Ga0373954_0184483 3300035118 Bacteria 1023
355 Ga0373943_0544734 3300035170 Unclassified 681
356 Ga0373943_0627812 3300035170 Unclassified 634
357 Ga0373946_0131256 3300035171 Bacteria 1153
358 Ga0373955_0168430 3300035172 Bacteria 1296
359 Ga0373955_0328108 3300035172 Bacteria 925
360 Ga0373924_0500651 3300035410 Unclassified 546
361 Ga0373931_0768013 3300035691 Unclassified 641
362 Ga0373935_0530720 3300035692 Unclassified 857
363 Ga0373927_0123389 3300035695 Bacteria 1691
364 Ga0373933_0315732 3300035724 Unclassified 1013
365 Ga0373933_0926042 3300035724 Bacteria 574
366 Ga0373947_0247084 3300035725 Bacteria 1179
367 Ga0373947_0795146 3300035725 Bacteria 646
368 Ga0373937_0061242 3300036401 Unclassified 3459
369 Ga0373937_0476225 3300036401 Unclassified 1186
370 Ga0373937_1910302 3300036401 Bacteria 540
371 Ga0373937_1979725 3300036401 Unclassified 529
372 Ga0373925_0383529 3300037068 Bacteria 1145
373 Ga0373925_0486974 3300037068 Bacteria 1012
374 Ga0373925_0576835 3300037068 Bacteria 926
375 Ga0395905_1111138 3300037471 Unclassified 694
376 Ga0436364_1329204 3300037853 Bacteria 1564
377 Ga0436364_1419431 3300037853 Bacteria 1935
378 Ga0436365_0058172 3300039437 Unclassified 1188
379 Ga0436363_1109811 3300039450 Unclassified 880
380 Ga0436362_0455521 3300039453 Unclassified 1579
381 Ga0439437_038738 3300042000 Bacteria 614
382 Ga0439450_021208 3300042008 Bacteria 1393
383 Ga0439435_0062724 3300042436 Bacteria 1086
384 Ga0439464_0011986 3300042439 Unclassified 2303
385 Ga0439460_0025176 3300042461 Bacteria 1655
386 Ga0466963_1134197 3300044694 Bacteria 550
387 Ga0466957_0609403 3300044842 Bacteria 765
388 Ga0451576_0904813 3300045051 Bacteria 926
389 Ga0495592_0573382 3300046454 Bacteria 691
390 Ga0495603_0514391 3300046455 Bacteria 686
391 Ga0495629_0854979 3300046459 Unclassified 598
392 Ga0495653_0453123 3300046463 Unclassified 807
393 Ga0495580_0000327 3300046472 Bacteria 39015
394 Ga0495580_0080318 3300046472 Bacteria 2274
395 Ga0495580_0327284 3300046472 Unclassified 1041
396 Ga0495580_0607716 3300046472 Bacteria 722
397 Ga0495582_0125521 3300046473 Bacteria 1448
398 Ga0495582_0315889 3300046473 Bacteria 899
399 Ga0495582_0465007 3300046473 Bacteria 731
400 Ga0495639_0275227 3300046475 Bacteria 836
401 Ga0495662_0110370 3300046476 Unclassified 1348
402 Ga0495662_0171333 3300046476 Bacteria 1070
403 Ga0495662_0639259 3300046476 Unclassified 520
404 Ga0495664_0623652 3300046477 Bacteria 640
405 Ga0495594_0195969 3300046499 Unclassified 1151
406 Ga0495594_0405912 3300046499 Bacteria 775
407 Ga0495618_0416223 3300046514 Bacteria 820
408 Ga0495628_0627192 3300046516 Bacteria 765
409 Ga0495628_0848971 3300046516 Unclassified 636
410 Ga0495630_0439398 3300046517 Bacteria 1000
411 Ga0495630_0574517 3300046517 Bacteria 864
412 Ga0495652_0304720 3300046529 Bacteria 1157
413 Ga0495652_0502142 3300046529 Unclassified 841
414 Ga0495652_0586917 3300046529 Unclassified 762
415 Ga0495652_0666529 3300046529 Bacteria 703
416 Ga0495665_0151777 3300046531 Unclassified 1209
417 Ga0495640_0499497 3300046533 Bacteria 740
418 Ga0495640_0807037 3300046533 Unclassified 559
419 Ga0495587_0062866 3300046536 Bacteria 2173
420 Ga0495645_0396928 3300046543 Unclassified 880
421 Ga0495645_0422146 3300046543 Unclassified 846
422 Ga0495622_0501627 3300046557 Unclassified 519
423 Ga0495667_0318132 3300046559 Bacteria 985
424 Ga0495634_0385087 3300046642 Bacteria 835
425 Ga0495634_0442532 3300046642 Unclassified 768
426 Ga0495634_0514101 3300046642 Unclassified 701
427 Ga0495635_0858613 3300046663 Bacteria 583
428 Ga0495635_1048053 3300046663 Unclassified 518
429 Ga0495657_0323319 3300046675 Bacteria 916
430 Ga0495657_0526428 3300046675 Bacteria 688
431 Ga0495599_0069428 3300046678 Unclassified 2199
432 Ga0495599_0149344 3300046678 Unclassified 1448
433 Ga0495658_0450432 3300046683 Unclassified 822
434 Ga0495613_0209844 3300046689 Bacteria 1370
435 Ga0495613_0490427 3300046689 Unclassified 828
436 Ga0495613_0681675 3300046689 Bacteria 678
437 Ga0495604_0127600 3300047317 Bacteria 1832
438 Ga0495674_0244298 3300047319 Bacteria 1478
439 Ga0495674_0336477 3300047319 Bacteria 1227
440 Ga0495674_0687914 3300047319 Bacteria 804
441 Ga0495676_0282029 3300047321 Bacteria 1125
442 Ga0495680_0433632 3300047322 Unclassified 902
443 Ga0495680_0812568 3300047322 Unclassified 610
444 Ga0495675_0038264 3300047444 Bacteria 3054
445 Ga0495684_0138206 3300047471 Bacteria 1828
446 Ga0495684_0142067 3300047471 Bacteria 1800
447 Ga0495684_0438316 3300047471 Unclassified 910
448 Ga0496102_0525486 3300048905 Bacteria 1106
449 Ga0496103_0708711 3300048906 Bacteria 638
450 Ga0496104_0662480 3300048907 Unclassified 952
451 Ga0496105_0048507 3300048908 Bacteria 3505
452 Ga0496105_0885433 3300048908 Unclassified 674
453 Ga0496106_0590180 3300048909 Viruses 890
454 Ga0496107_0968218 3300048910 Unclassified 618
455 Ga0496108_0008710 3300048911 Bacteria 8224
456 Ga0496109_0085026 3300048912 Bacteria 2919
457 Ga0496110_0238411 3300048913 Bacteria 1655
458 Ga0496110_0324489 3300048913 Unclassified 1402
459 Ga0496111_0086984 3300048914 Bacteria 2287
460 Ga0496112_0035094 3300048915 Bacteria 4881
461 Ga0496112_0105746 3300048915 Bacteria 2784
462 Ga0501031_0567362 3300049568 Bacteria 731
463 Ga0501034_0004031 3300049571 Bacteria 16482
464 Ga0501040_0565480 3300049576 Unclassified 821
465 Ga0501040_1256458 3300049576 Bacteria 537
466 Ga0501071_0162029 3300049587 Bacteria 1672
467 Ga0501073_0242224 3300049589 Bacteria 1245
468 Ga0501074_0208266 3300049590 Bacteria 1393
469 Ga0501076_0093759 3300049592 Bacteria 2417
470 Ga0501077_0827763 3300049593 Unclassified 595
471 Ga0501079_0108048 3300049741 Bacteria 2160
472 Ga0501079_1131296 3300049741 Unclassified 617
473 Ga0501079_1420234 3300049741 Unclassified 546
474 Ga0501080_0256861 3300049742 Bacteria 1593
475 Ga0501080_0321115 3300049742 Unclassified 1402
476 Ga0501083_0067915 3300049744 Bacteria 2373
477 nmdc:mga03n38_379832_c1 3300050490 Bacteria 774
478 nmdc:mga00v17_577371_c1 3300050491 Unclassified 726
479 nmdc:mga0yw44_235273_c1 3300050492 Unclassified 1216
480 nmdc:mga0yw44_325280_c1 3300050492 Bacteria 1033
481 nmdc:mga0k408_46944_c1 3300050493 Bacteria 2495
482 nmdc:mga06z11_109469_c1 3300050494 Bacteria 1528
483 nmdc:mga06z11_409445_c1 3300050494 Bacteria 817
484 nmdc:mga06z11_745690_c1 3300050494 Unclassified 597
485 nmdc:mga04h51_56244_c1 3300050495 Unclassified 1335
486 nmdc:mga07m45_18537_c1 3300050496 Bacteria 3759
487 nmdc:mga05p37_29_c1 3300050507 Bacteria 114400
488 nmdc:mga05p37_524865_c1 3300050507 Bacteria 1353
489 nmdc:mga09592_1418465_c1 3300050508 Unclassified 567
490 nmdc:mga09592_345476_c1 3300050508 Bacteria 971
491 nmdc:mga0qj67_381587_c1 3300050509 Bacteria 1138
492 nmdc:mga06r32_124189_c1 3300050510 Unclassified 2548
493 nmdc:mga06r32_1294096_c1 3300050510 Unclassified 673
494 nmdc:mga06r32_13159_c1 3300050510 Bacteria 7492
495 nmdc:mga08y16_84347_c1 3300050511 Bacteria 3312
496 nmdc:mga08y16_930023_c1 3300050511 Bacteria 854
497 nmdc:mga0n895_850461_c1 3300050512 Bacteria 900
498 nmdc:mga0rr50_408007_c1 3300050513 Unclassified 1148
499 nmdc:mga0a205_168419_c1 3300050515 Bacteria 2086
500 nmdc:mga0a205_534760_c1 3300050515 Bacteria 1028
501 nmdc:mga0a205_673579_c1 3300050515 Bacteria 885
502 Ga0495601_0347937 3300053077 Unclassified 964
503 Ga0495601_0350292 3300053077 Bacteria 960
504 Ga0495619_0486422 3300053085 Bacteria 849
505 Ga0500568_0000445 3300053139 Bacteria 31037
506 Ga0500568_0040862 3300053139 Unclassified 1865
507 Ga0501084_0571453 3300054114 Bacteria 955
508 Ga0590075_174974 3300059424 Unclassified 567
509 Ga0501082_0000532 3300060353 Bacteria 33889
510 Ga0501082_0019117 3300060353 Bacteria 5903
511 Ga0501082_0129972 3300060353 Bacteria 2185
512 Ga0501075_1323200
513 MRS1b_contig_3737759
514 MRS1b_contig_4810271
515 Ga0065712_10076964
516 Ga0065715_10115649
517 Ga0065707_10134631
518 Ga0070676_10292530
519 Ga0070683_100000001
520 Ga0070683_100010238
521 Ga0070683_100696622
522 Ga0070683_100700006
523 Ga0070683_101142470
524 Ga0070690_101147609
525 Ga0070670_100098487
526 Ga0070670_100628592
527 Ga0070670_101620447
528 Ga0070670_101763011
529 Ga0070670_101864299
530 Ga0068869_100771038
531 Ga0068869_102154666
532 Ga0070666_10014789
533 Ga0070680_101113972
534 Ga0070682_100232036
535 Ga0070682_101088416
536 Ga0068868_102352408
537 Ga0070689_100006735
538 Ga0070689_100442268
539 Ga0070689_101296717
540 Ga0070689_102037255
541 Ga0070687_100547120
542 Ga0070661_100440988
543 Ga0070668_100453583
544 Ga0070668_100486909
545 Ga0070668_100770569
546 Ga0070669_100158368
547 Ga0070669_100620747
548 Ga0070675_100303694
549 Ga0070675_100348403
550 Ga0070675_101526038
551 Ga0070671_100033459
552 Ga0070671_100529622
553 Ga0070674_100081547
554 Ga0070674_101481671
555 Ga0070673_100483055
556 Ga0070688_100078726
557 Ga0070688_100319781
558 Ga0070688_100659096
559 Ga0070667_100211186
560 Ga0070709_10087513
561 Ga0070711_100923127
562 Ga0070705_100900329
563 Ga0070694_100571849
564 Ga0070694_101553319
565 Ga0070708_100296430
566 Ga0070708_100384983
567 Ga0070663_100053765
568 Ga0070663_100853280
569 Ga0070678_100584955
570 Ga0070678_101630966
571 Ga0070662_100210178
572 Ga0068867_101486192
573 Ga0068867_101936246
574 Ga0070685_10099076
575 Ga0070685_10976693
576 Ga0070685_11360216
577 Ga0070706_100232476
578 Ga0070698_100251207
579 Ga0070698_100808064
580 Ga0070699_100014730
581 Ga0070699_100485878
582 Ga0070679_100461202
583 Ga0070679_101708508
584 Ga0070684_100000055
585 Ga0070684_100062031
586 Ga0070684_100210164
587 Ga0070684_100681633
588 Ga0070684_101099757
589 Ga0070697_100660696
590 Ga0068853_101852075
591 Ga0070672_100150592
592 Ga0070686_100492614
593 Ga0070695_100137065
594 Ga0070696_100356283
595 Ga0070665_100280471
596 Ga0070665_100548583
597 Ga0068855_100058050
598 Ga0068855_100288288
599 Ga0070664_100002126
600 Ga0070664_100305989
601 Ga0068857_101958916
602 Ga0068854_100688954
603 Ga0068856_100720322
604 Ga0068856_101676510
605 Ga0070702_101891124
606 Ga0068859_100100862
607 Ga0068859_100117181
608 Ga0068859_100139005
609 Ga0068859_101644039
610 Ga0068859_101933371
611 Ga0068859_102149859
612 Ga0068864_100043785
613 Ga0068864_100272574
614 Ga0068861_100328829
615 Ga0068861_100824315
616 Ga0068861_102314586
617 Ga0068861_102710868
618 Ga0068851_10058742
619 Ga0068863_100082502
620 Ga0068863_100745050
621 Ga0068863_100859510
622 Ga0068863_100869580
623 Ga0068858_100492345
624 Ga0068858_101082241
625 Ga0068858_101857814
626 Ga0068860_100363756
627 Ga0068860_101469707
628 Ga0068860_102157010
629 Ga0068862_101740085
630 Ga0075365_10069394
631 Ga0075368_10071255
632 Ga0075368_10087964
633 Ga0075368_10363458
634 Ga0075363_100375235
635 Ga0075364_10046155
636 Ga0075364_10844745
637 Ga0070715_10243949
638 Ga0070716_101663473
639 Ga0075367_10025697
640 Ga0075367_10083709
641 Ga0075367_10325085
642 Ga0075366_10026312
643 Ga0075366_10498932
644 Ga0097621_100279251
645 Ga0097621_101026956
646 Ga0075370_10031437
647 Ga0075370_10369077
648 Ga0068871_100789324
649 Ga0068871_100798563
650 Ga0068871_101908679
651 Ga0075428_100203760
652 Ga0075430_100491778
653 Ga0075431_100258211
654 Ga0075431_100554085
655 Ga0075431_101855080
656 Ga0075433_10720071
657 Ga0075434_100914616
658 Ga0075429_100784156
659 Ga0075436_100008116
660 Ga0075436_100683911
661 Ga0097620_100100865
662 Ga0097620_100117190
663 Ga0097620_100139005
664 Ga0097620_101644329
665 Ga0097620_101934131
666 Ga0097620_102149595
667 Ga0105240_10386149
668 Ga0111539_10115711
669 Ga0105245_10101286
670 Ga0105245_10256748
671 Ga0105245_10305530
672 Ga0105245_10875139
673 Ga0105245_11002084
674 Ga0105245_11432250
675 Ga0105247_10288861
676 Ga0114129_10009106
677 Ga0105241_10369027
678 Ga0105241_10490380
679 Ga0105241_12627118
680 Ga0105242_10012242
681 Ga0105242_10068239
682 Ga0105242_10239956
683 Ga0105242_10666691
684 Ga0105242_11929919
685 Ga0105242_12027240
686 Ga0105242_12304861
687 Ga0105248_10024738
688 Ga0105248_10195445
689 Ga0105248_10453782
690 Ga0105248_10512638
691 Ga0105248_11079184
692 Ga0105248_11320284
693 Ga0105237_10033994
694 Ga0105238_10888689
695 Ga0105249_10700950
696 Ga0105239_10864737
697 Ga0105239_11140204
698 Ga0105239_11755252
699 Ga0105246_11223660
700 Ga0157371_10019333
701 Ga0157371_10672149
702 Ga0157370_10146714
703 Ga0157370_10383200
704 Ga0157370_11132022
705 Ga0157369_10051375
706 Ga0157369_10095744
707 Ga0157369_10340741
708 Ga0157369_10722904
709 Ga0157369_10724693
710 Ga0157374_10043046
711 Ga0157374_10494780
712 Ga0157374_10521217
713 Ga0157374_10768778
714 Ga0157374_11313196
715 Ga0157378_10458027
716 Ga0157378_10768257
717 Ga0163162_10367333
718 Ga0163162_11010968
719 Ga0163162_11350471
720 Ga0163162_11713036
721 Ga0163162_12230983
722 Ga0163162_13171100
723 Ga0157372_10699701
724 Ga0157372_11623965
725 Ga0157372_12572174
726 Ga0157375_10317401
727 Ga0157375_10385291
728 Ga0157375_10448153
729 Ga0157375_11963244
730 Ga0157375_12014856
731 Ga0163163_10041425
732 Ga0163163_10102589
733 Ga0163163_10182050
734 Ga0163163_10495704
735 Ga0163163_10604057
736 Ga0163163_12097674
737 Ga0157380_10011436
738 Ga0157380_10018513
739 Ga0157380_10413992
740 Ga0157380_10428430
741 Ga0157377_10819061
742 Ga0157377_10967203
743 Ga0157379_10082978
744 Ga0157379_10237093
745 Ga0157379_10693328
746 Ga0157379_12259752
747 Ga0157376_10182226
748 Ga0157376_10373498
749 Ga0157376_10595924
750 Ga0157376_10704114
751 Ga0157376_11270142
752 Ga0157376_11584302
753 Ga0213876_10613818
754 Ga0207680_10119288
755 Ga0207647_10542152
756 Ga0207699_10105221
757 Ga0207699_10584962
758 Ga0207707_10028508
759 Ga0207707_10716999
760 Ga0207695_10128392
761 Ga0207695_10406470
762 Ga0207671_10084035
763 Ga0207663_10060511
764 Ga0207663_10353537
765 Ga0207660_10948363
766 Ga0207657_10247198
767 Ga0207649_10177830
768 Ga0207652_10286302
769 Ga0207652_11632593
770 Ga0207646_11570864
771 Ga0207694_10887754
772 Ga0207650_10341998
773 Ga0207659_10292224
774 Ga0207659_10381969
775 Ga0207659_10635050
776 Ga0207687_10099994
777 Ga0207687_10858214
778 Ga0207700_11726996
779 Ga0207664_10866803
780 Ga0207644_10113429
781 Ga0207706_10139379
782 Ga0207706_11504411
783 Ga0207686_10193750
784 Ga0207686_10836121
785 Ga0207686_11664868
786 Ga0207709_10880486
787 Ga0207670_10373623
788 Ga0207670_11161074
789 Ga0207669_11239192
790 Ga0207711_10762377
791 Ga0207711_10841293
792 Ga0207711_10863552
793 Ga0207711_11313651
794 Ga0207661_10000005
795 Ga0207661_10030845
796 Ga0207661_10881370
797 Ga0207661_11776884
798 Ga0207679_10060861
799 Ga0207679_11617738
800 Ga0207679_11645156
801 Ga0207667_10946736
802 Ga0207651_11183587
803 Ga0207668_10280986
804 Ga0207668_10637159
805 Ga0207640_11115688
806 Ga0207640_11740569
807 Ga0207658_10128709
808 Ga0207703_10316024
809 Ga0207703_10437522
810 Ga0207703_10476101
811 Ga0207639_11806311
812 Ga0207678_10053477
813 Ga0207702_10505890
814 Ga0207641_10063558
815 Ga0207641_10585684
816 Ga0207641_11459938
817 Ga0207648_11697556
818 Ga0207676_10277588
819 Ga0207676_10653818
820 Ga0207675_100059787
821 Ga0207675_100284522
822 Ga0207683_10436015
823 Ga0209813_10046983
824 Ga0207428_10007201
825 Ga0207428_10876409
826 Ga0268266_10121705
827 Ga0268266_10182617
828 Ga0268266_10560616
829 Ga0268266_11529173
830 Ga0268265_10647140
831 Ga0268265_12258492
832 Ga0268264_10732523
833 Ga0268264_11658009
834 Ga0265762_1078201
835 Ga0265328_10193689
836 Ga0265339_10150008
837 Ga0265331_10124272
838 Ga0265316_10003057
839 Ga0265316_10068367
840 Ga0265316_10179557
841 Ga0265316_10676835
842 Ga0307509_10224788
843 Ga0307408_100006207
844 Ga0307408_100013955
845 Ga0265314_10206278
846 Ga0265342_10129654
847 Ga0265342_10165805
848 Ga0307405_10121763
849 Ga0307410_10242788
850 Ga0307406_10017574
851 Ga0307406_10615132
852 Ga0307407_10074344
853 Ga0307412_10097962
854 Ga0307416_100248167
855 Ga0307416_101499750
856 Ga0307414_11404252
857 Ga0307411_10044102
858 Ga0307415_100112038
859 Ga0373923_0116213
860 Ga0373932_0379341
861 Ga0373936_0577609
862 Ga0373939_0249809
863 Ga0373945_0477485
864 Ga0373953_0155737
865 Ga0373954_0184483
866 Ga0373943_0544734
867 Ga0373943_0627812
868 Ga0373946_0131256
869 Ga0373955_0168430
870 Ga0373955_0328108
871 Ga0373924_0500651
872 Ga0373931_0768013
873 Ga0373935_0530720
874 Ga0373927_0123389
875 Ga0373933_0315732
876 Ga0373933_0926042
877 Ga0373947_0247084
878 Ga0373947_0795146
879 Ga0373937_0061242
880 Ga0373937_0476225
881 Ga0373937_1910302
882 Ga0373937_1979725
883 Ga0373925_0383529
884 Ga0373925_0486974
885 Ga0373925_0576835
886 Ga0395905_1111138
887 Ga0436364_1329204
888 Ga0436364_1419431
889 Ga0436365_0058172
890 Ga0436363_1109811
891 Ga0436362_0455521
892 Ga0439437_038738
893 Ga0439450_021208
894 Ga0439435_0062724
895 Ga0439464_0011986
896 Ga0439460_0025176
897 Ga0466963_1134197
898 Ga0466957_0609403
899 Ga0451576_0904813
900 Ga0495592_0573382
901 Ga0495603_0514391
902 Ga0495629_0854979
903 Ga0495653_0453123
904 Ga0495580_0000327
905 Ga0495580_0080318
906 Ga0495580_0327284
907 Ga0495580_0607716
908 Ga0495582_0125521
909 Ga0495582_0315889
910 Ga0495582_0465007
911 Ga0495639_0275227
912 Ga0495662_0110370
913 Ga0495662_0171333
914 Ga0495662_0639259
915 Ga0495664_0623652
916 Ga0495594_0195969
917 Ga0495594_0405912
918 Ga0495618_0416223
919 Ga0495628_0627192
920 Ga0495628_0848971
921 Ga0495630_0439398
922 Ga0495630_0574517
923 Ga0495652_0304720
924 Ga0495652_0502142
925 Ga0495652_0586917
926 Ga0495652_0666529
927 Ga0495665_0151777
928 Ga0495640_0499497
929 Ga0495640_0807037
930 Ga0495587_0062866
931 Ga0495645_0396928
932 Ga0495645_0422146
933 Ga0495622_0501627
934 Ga0495667_0318132
935 Ga0495634_0385087
936 Ga0495634_0442532
937 Ga0495634_0514101
938 Ga0495635_0858613
939 Ga0495635_1048053
940 Ga0495657_0323319
941 Ga0495657_0526428
942 Ga0495599_0069428
943 Ga0495599_0149344
944 Ga0495658_0450432
945 Ga0495613_0209844
946 Ga0495613_0490427
947 Ga0495613_0681675
948 Ga0495604_0127600
949 Ga0495674_0244298
950 Ga0495674_0336477
951 Ga0495674_0687914
952 Ga0495676_0282029
953 Ga0495680_0433632
954 Ga0495680_0812568
955 Ga0495675_0038264
956 Ga0495684_0138206
957 Ga0495684_0142067
958 Ga0495684_0438316
959 Ga0496102_0525486
960 Ga0496103_0708711
961 Ga0496104_0662480
962 Ga0496105_0048507
963 Ga0496105_0885433
964 Ga0496106_0590180
965 Ga0496107_0968218
966 Ga0496108_0008710
967 Ga0496109_0085026
968 Ga0496110_0238411
969 Ga0496110_0324489
970 Ga0496111_0086984
971 Ga0496112_0035094
972 Ga0496112_0105746
973 Ga0501031_0567362
974 Ga0501034_0004031
975 Ga0501040_0565480
976 Ga0501040_1256458
977 Ga0501071_0162029
978 Ga0501073_0242224
979 Ga0501074_0208266
980 Ga0501076_0093759
981 Ga0501077_0827763
982 Ga0501079_0108048
983 Ga0501079_1131296
984 Ga0501079_1420234
985 Ga0501080_0256861
986 Ga0501080_0321115
987 Ga0501083_0067915
988 nmdc:mga03n38_379832_c1
989 nmdc:mga00v17_577371_c1
990 nmdc:mga0yw44_235273_c1
991 nmdc:mga0yw44_325280_c1
992 nmdc:mga0k408_46944_c1
993 nmdc:mga06z11_109469_c1
994 nmdc:mga06z11_409445_c1
995 nmdc:mga06z11_745690_c1
996 nmdc:mga04h51_56244_c1
997 nmdc:mga07m45_18537_c1
998 nmdc:mga05p37_29_c1
999 nmdc:mga05p37_524865_c1
1000 nmdc:mga09592_1418465_c1
1001 nmdc:mga09592_345476_c1
1002 nmdc:mga0qj67_381587_c1
1003 nmdc:mga06r32_124189_c1
1004 nmdc:mga06r32_1294096_c1
1005 nmdc:mga06r32_13159_c1
1006 nmdc:mga08y16_84347_c1
1007 nmdc:mga08y16_930023_c1
1008 nmdc:mga0n895_850461_c1
1009 nmdc:mga0rr50_408007_c1
1010 nmdc:mga0a205_168419_c1
1011 nmdc:mga0a205_534760_c1
1012 nmdc:mga0a205_673579_c1
1013 Ga0495601_0347937
1014 Ga0495601_0350292
1015 Ga0495619_0486422
1016 Ga0500568_0000445
1017 Ga0500568_0040862
1018 Ga0501084_0571453
1019 Ga0590075_174974
1020 Ga0501082_0000532
1021 Ga0501082_0019117
1022 Ga0501082_0129972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

19

93

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.9097 4 102
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8982 4 100
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8963 4 103
6abq-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8917 4 102
7cbv-assembly1.cif.gz_A-3 crystal structure of the transcriptional regulator padr from bacillus subtilis (space group h32) 0.8779 8 89
ID Description Score Start End Superfamily
af_Q57682_5_95_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8866 12 77 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8721 8 89 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8683 4 107 1.10.10.10
af_Q9C106_1_81_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8682 8 77 1.10.10.10
5x11A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8635 1 86 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A6J4LS10-F1-model_v4 Transcriptional regulator, PadR family 0.9884 6 102
AF-A0A7W0YJI2-F1-model_v4 PadR family transcriptional regulator 0.9882 11 102
AF-A0A7Y3C032-F1-model_v4 PadR family transcriptional regulator 0.9804 6 102
AF-A0A2V6MFC0-F1-model_v4 PadR family transcriptional regulator 0.9784 6 91
AF-A0A518K0B9-F1-model_v4 Lineage-specific thermal regulator protein 0.9779 4 103

Map