F457288

General Info

Members Datasets Scaffolds Average Seq Length
511 253 1022 105

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10830285|Ga0207684_108302851
Length 130
Sequence MPPICTHVDHVRVTELPESVDGCVDCLALGSLWLHLRICLECGHVGCCDDSPNKHATAHARSTAHPIIRSLEPGEEWAWCYIDRIGMLTPEVRGTTRIPPSPLGPCAGFAALGGVCMSRNRLPVAHDGSC

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
99 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
149 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
161 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
168 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
173 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
174 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
180 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
185 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
190 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
191 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
196 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
227 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
233 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
234 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
249 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
253 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.83
Metatranscriptomes 1.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0
Rhizoplane 8.02
Rhizosphere 86.5
Stem 0
Stem Tuber 0
Unclassified 2.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10830285 3300025910 Bacteria 780
2 JGI25407J50210_10118504 3300003373 Bacteria 652
3 Ga0070658_10026210 3300005327 Bacteria 4676
4 Ga0070658_10054599 3300005327 Bacteria 3244
5 Ga0070683_100041520 3300005329 Bacteria 4232
6 Ga0070683_100106032 3300005329 Bacteria 2649
7 Ga0070683_100123711 3300005329 Bacteria 2444
8 Ga0070683_101574494 3300005329 Bacteria 632
9 Ga0070690_100837430 3300005330 Bacteria 716
10 Ga0070666_10065959 3300005335 Bacteria 2456
11 Ga0070680_100145592 3300005336 Bacteria 1987
12 Ga0070680_101125450 3300005336 Bacteria 679
13 Ga0070682_100163205 3300005337 Bacteria 1541
14 Ga0070682_100693241 3300005337 Bacteria 816
15 Ga0070682_101724396 3300005337 Bacteria 545
16 Ga0070660_100106807 3300005339 Bacteria 2224
17 Ga0070691_10090870 3300005341 Bacteria 1505
18 Ga0070687_100314728 3300005343 Bacteria 998
19 Ga0070687_100514594 3300005343 Bacteria 808
20 Ga0070661_100004985 3300005344 Bacteria 9146
21 Ga0070668_100999498 3300005347 Bacteria 752
22 Ga0070659_100017534 3300005366 Bacteria 5392
23 Ga0070709_10304527 3300005434 Bacteria 1165
24 Ga0070714_100403083 3300005435 Bacteria 1293
25 Ga0070714_100898314 3300005435 Bacteria 860
26 Ga0070713_100055889 3300005436 Bacteria 3282
27 Ga0070713_101281823 3300005436 Bacteria 710
28 Ga0070713_101342860 3300005436 Bacteria 693
29 Ga0070710_10076464 3300005437 Bacteria 1943
30 Ga0070710_10129293 3300005437 Bacteria 1538
31 Ga0070710_10563812 3300005437 Bacteria 788
32 Ga0070710_10938408 3300005437 Bacteria 627
33 Ga0070701_11212560 3300005438 Bacteria 536
34 Ga0070711_100011972 3300005439 Bacteria 5404
35 Ga0070711_100082333 3300005439 Unclassified 2297
36 Ga0070711_100246270 3300005439 Bacteria 1400
37 Ga0070711_100249758 3300005439 Bacteria 1391
38 Ga0070711_100367592 3300005439 Bacteria 1160
39 Ga0070705_100800335 3300005440 Bacteria 750
40 Ga0070705_101823964 3300005440 Unclassified 516
41 Ga0070700_100055746 3300005441 Bacteria 2475
42 Ga0070700_100078874 3300005441 Bacteria 2121
43 Ga0070700_101271892 3300005441 Bacteria 617
44 Ga0070663_100143319 3300005455 Bacteria 1826
45 Ga0070678_100001225 3300005456 Bacteria 13544
46 Ga0070662_100088500 3300005457 Bacteria 2321
47 Ga0070681_10013816 3300005458 Bacteria 8036
48 Ga0070681_11107223 3300005458 Bacteria 713
49 Ga0068867_100119462 3300005459 Bacteria 2035
50 Ga0070679_100037373 3300005530 Bacteria 4823
51 Ga0070679_100234140 3300005530 Bacteria 1796
52 Ga0070679_101053131 3300005530 Bacteria 758
53 Ga0070684_100026971 3300005535 Bacteria 4843
54 Ga0070684_100045373 3300005535 Bacteria 3806
55 Ga0070684_100176877 3300005535 Bacteria 1939
56 Ga0070697_100261423 3300005536 Bacteria 1482
57 Ga0070697_100358706 3300005536 Bacteria 1260
58 Ga0068853_100090366 3300005539 Bacteria 2691
59 Ga0070686_100076481 3300005544 Bacteria 2204
60 Ga0070686_100813580 3300005544 Bacteria 754
61 Ga0070695_100882980 3300005545 Bacteria 721
62 Ga0070695_101843787 3300005545 Bacteria 508
63 Ga0070696_101462717 3300005546 Bacteria 584
64 Ga0070693_100074328 3300005547 Bacteria 2010
65 Ga0070693_101409057 3300005547 Bacteria 542
66 Ga0070665_100103926 3300005548 Bacteria 2843
67 Ga0070704_100550431 3300005549 Bacteria 1008
68 Ga0070704_100667522 3300005549 Bacteria 919
69 Ga0070704_101977600 3300005549 Bacteria 541
70 Ga0068855_100112509 3300005563 Bacteria 3124
71 Ga0070664_100293314 3300005564 Bacteria 1468
72 Ga0070664_100577399 3300005564 Bacteria 1041
73 Ga0068856_100007445 3300005614 Bacteria 10682
74 Ga0068856_100036450 3300005614 Bacteria 4821
75 Ga0068856_100890180 3300005614 Bacteria 909
76 Ga0068856_101040357 3300005614 Bacteria 837
77 Ga0068852_100348245 3300005616 Bacteria 1446
78 Ga0068852_100723930 3300005616 Bacteria 1006
79 Ga0068864_100172492 3300005618 Bacteria 1973
80 Ga0068866_10045495 3300005718 Bacteria 2202
81 Ga0068866_10600347 3300005718 Bacteria 743
82 Ga0068861_100148316 3300005719 Bacteria 1922
83 Ga0068861_100161729 3300005719 Bacteria 1847
84 Ga0068861_100390493 3300005719 Bacteria 1232
85 Ga0068861_100812855 3300005719 Bacteria 878
86 Ga0068860_100081571 3300005843 Bacteria 3076
87 Ga0081455_10042778 3300005937 Bacteria 3969
88 Ga0081455_10097076 3300005937 Bacteria 2375
89 Ga0081538_10000882 3300005981 Bacteria 32411
90 Ga0081538_10055777 3300005981 Bacteria 2322
91 Ga0081538_10064622 3300005981 Bacteria 2068
92 Ga0081540_1002831 3300005983 Bacteria 14047
93 Ga0081539_10221659 3300005985 Bacteria 860
94 Ga0081539_10345078 3300005985 Unclassified 627
95 Ga0070717_10796638 3300006028 Bacteria 860
96 Ga0075365_10093228 3300006038 Bacteria 2054
97 Ga0075364_10122274 3300006051 Bacteria 1743
98 Ga0075432_10293921 3300006058 Bacteria 672
99 Ga0070715_10086275 3300006163 Bacteria 1435
100 Ga0070716_100023525 3300006173 Bacteria 3269
101 Ga0070716_100264343 3300006173 Bacteria 1179
102 Ga0070712_100034590 3300006175 Unclassified 3425
103 Ga0070712_100172212 3300006175 Bacteria 1681
104 Ga0070712_100202019 3300006175 Bacteria 1562
105 Ga0070712_100239701 3300006175 Bacteria 1444
106 Ga0070712_100420710 3300006175 Bacteria 1107
107 Ga0070712_101585012 3300006175 Bacteria 573
108 Ga0070712_101967922 3300006175 Bacteria 512
109 Ga0097621_100042381 3300006237 Bacteria 3666
110 Ga0068871_100742664 3300006358 Bacteria 902
111 Ga0075428_100241446 3300006844 Bacteria 1949
112 Ga0075428_101618667 3300006844 Bacteria 677
113 Ga0075430_100463229 3300006846 Bacteria 1046
114 Ga0075430_100604343 3300006846 Bacteria 905
115 Ga0075431_100003668 3300006847 Bacteria 14900
116 Ga0075431_100064144 3300006847 Bacteria 3792
117 Ga0075431_100100928 3300006847 Bacteria 2977
118 Ga0075431_100178401 3300006847 Bacteria 2180
119 Ga0075431_101711271 3300006847 Bacteria 586
120 Ga0075433_10229209 3300006852 Unclassified 1650
121 Ga0075434_100032067 3300006871 Bacteria 5180
122 Ga0075434_100092762 3300006871 Bacteria 3022
123 Ga0075434_100097794 3300006871 Bacteria 2940
124 Ga0075429_100642502 3300006880 Bacteria 930
125 Ga0075429_100792315 3300006880 Bacteria 830
126 Ga0068865_100177780 3300006881 Bacteria 1637
127 Ga0068865_101090509 3300006881 Bacteria 703
128 Ga0075436_100050731 3300006914 Bacteria 2863
129 Ga0075435_100104590 3300007076 Bacteria 2349
130 Ga0075435_100699751 3300007076 Unclassified 881
131 Ga0105240_10036201 3300009093 Bacteria 6351
132 Ga0105240_10229604 3300009093 Bacteria 2158
133 Ga0111539_10006971 3300009094 Bacteria 14503
134 Ga0111539_10007650 3300009094 Bacteria 13806
135 Ga0111539_10012239 3300009094 Bacteria 10759
136 Ga0111539_10073225 3300009094 Bacteria 4039
137 Ga0111539_10918583 3300009094 Bacteria 1018
138 Ga0111539_12244123 3300009094 Unclassified 633
139 Ga0105245_10339286 3300009098 Bacteria 1485
140 Ga0105245_12764185 3300009098 Bacteria 544
141 Ga0105247_10041820 3300009101 Bacteria 2805
142 Ga0114129_10190175 3300009147 Bacteria 2788
143 Ga0114129_10298534 3300009147 Bacteria 2148
144 Ga0114129_10358858 3300009147 Bacteria 1929
145 Ga0114129_11297022 3300009147 Bacteria 903
146 Ga0114129_11326430 3300009147 Bacteria 891
147 Ga0114129_11909971 3300009147 Bacteria 720
148 Ga0114129_12170146 3300009147 Bacteria 669
149 Ga0114129_12563438 3300009147 Unclassified 609
150 Ga0114129_12657181 3300009147 Bacteria 597
151 Ga0114129_12965840 3300009147 Bacteria 559
152 Ga0105243_10004965 3300009148 Bacteria 10425
153 Ga0105243_10165423 3300009148 Bacteria 1911
154 Ga0105243_10214949 3300009148 Bacteria 1695
155 Ga0105243_11477372 3300009148 Bacteria 703
156 Ga0105243_12094534 3300009148 Bacteria 601
157 Ga0105241_10021677 3300009174 Bacteria 4753
158 Ga0105242_10001616 3300009176 Bacteria 17751
159 Ga0105242_10064832 3300009176 Bacteria 3012
160 Ga0105242_10111772 3300009176 Bacteria 2330
161 Ga0105242_10380661 3300009176 Bacteria 1312
162 Ga0105242_10546404 3300009176 Bacteria 1110
163 Ga0105242_12185531 3300009176 Unclassified 598
164 Ga0105248_10044039 3300009177 Bacteria 5005
165 Ga0105248_11987530 3300009177 Bacteria 660
166 Ga0105237_10298990 3300009545 Bacteria 1612
167 Ga0105237_11357531 3300009545 Bacteria 717
168 Ga0105237_11904123 3300009545 Bacteria 603
169 Ga0105238_10054283 3300009551 Bacteria 4024
170 Ga0105238_11347428 3300009551 Bacteria 740
171 Ga0105249_10005418 3300009553 Bacteria 11017
172 Ga0105249_10673554 3300009553 Bacteria 1093
173 Ga0105249_11812635 3300009553 Bacteria 683
174 Ga0105239_10020432 3300010375 Bacteria 7306
175 Ga0105239_10189920 3300010375 Bacteria 2299
176 Ga0105239_13041233 3300010375 Bacteria 546
177 Ga0105239_13336384 3300010375 Bacteria 522
178 Ga0105246_10931659 3300011119 Bacteria 781
179 Ga0105246_11967997 3300011119 Bacteria 563
180 Ga0157369_10332795 3300013105 Bacteria 1578
181 Ga0157369_10693402 3300013105 Bacteria 1049
182 Ga0157374_10551720 3300013296 Bacteria 1160
183 Ga0157374_11503273 3300013296 Bacteria 697
184 Ga0157378_10073833 3300013297 Bacteria 3067
185 Ga0163162_10103680 3300013306 Bacteria 2939
186 Ga0163162_10362301 3300013306 Bacteria 1583
187 Ga0163162_11776377 3300013306 Bacteria 705
188 Ga0157372_10997587 3300013307 Bacteria 970
189 Ga0157372_11402813 3300013307 Bacteria 805
190 Ga0163163_12180123 3300014325 Bacteria 613
191 Ga0157380_10182977 3300014326 Bacteria 1843
192 Ga0182008_10615613 3300014497 Bacteria 611
193 Ga0157377_10340591 3300014745 Bacteria 1003
194 Ga0157379_10000843 3300014968 Bacteria 24832
195 Ga0157376_10264165 3300014969 Bacteria 1614
196 Ga0163161_10190262 3300017792 Bacteria 1577
197 Ga0197907_10664953 3300020069 Bacteria 1536
198 Ga0206356_11244119 3300020070 Bacteria 3162
199 Ga0206354_10124711 3300020081 Bacteria 907
200 Ga0206354_11287985 3300020081 Bacteria 686
201 Ga0206353_10839957 3300020082 Bacteria 783
202 Ga0213873_10020470 3300021358 Bacteria 1546
203 Ga0213873_10083788 3300021358 Bacteria 896
204 Ga0213874_10015550 3300021377 Bacteria 2009
205 Ga0213874_10024639 3300021377 Bacteria 1689
206 Ga0213874_10035995 3300021377 Bacteria 1457
207 Ga0213874_10330682 3300021377 Bacteria 580
208 Ga0213876_10006953 3300021384 Bacteria 6166
209 Ga0213876_10031630 3300021384 Bacteria 2791
210 Ga0213876_10098754 3300021384 Bacteria 1547
211 Ga0213875_10010558 3300021388 Bacteria 4619
212 Ga0224712_10059636 3300022467 Bacteria 1516
213 Ga0207692_10094447 3300025898 Bacteria 1629
214 Ga0207692_10117683 3300025898 Bacteria 1483
215 Ga0207692_10127590 3300025898 Bacteria 1432
216 Ga0207692_10441830 3300025898 Bacteria 817
217 Ga0207642_10008294 3300025899 Bacteria 3555
218 Ga0207710_10061135 3300025900 Bacteria 1709
219 Ga0207688_10337546 3300025901 Bacteria 927
220 Ga0207680_10326333 3300025903 Bacteria 1074
221 Ga0207685_10009157 3300025905 Bacteria 2863
222 Ga0207699_10108525 3300025906 Bacteria 1775
223 Ga0207705_10092218 3300025909 Bacteria 2219
224 Ga0207705_10132826 3300025909 Bacteria 1853
225 Ga0207684_10076086 3300025910 Bacteria 2853
226 Ga0207654_10134841 3300025911 Bacteria 1567
227 Ga0207707_10144879 3300025912 Bacteria 2076
228 Ga0207695_10282430 3300025913 Bacteria 1554
229 Ga0207671_10073789 3300025914 Bacteria 2549
230 Ga0207693_10040204 3300025915 Bacteria 3683
231 Ga0207693_10151002 3300025915 Bacteria 1827
232 Ga0207693_10974698 3300025915 Bacteria 648
233 Ga0207663_10061880 3300025916 Bacteria 2377
234 Ga0207660_10714884 3300025917 Bacteria 817
235 Ga0207660_10986087 3300025917 Bacteria 687
236 Ga0207657_10001254 3300025919 Bacteria 27140
237 Ga0207657_10099081 3300025919 Bacteria 2421
238 Ga0207652_10131717 3300025921 Bacteria 2230
239 Ga0207652_10808262 3300025921 Bacteria 832
240 Ga0207694_10027171 3300025924 Bacteria 4358
241 Ga0207687_10105496 3300025927 Bacteria 2082
242 Ga0207687_10821683 3300025927 Bacteria 793
243 Ga0207700_10004257 3300025928 Bacteria 8411
244 Ga0207700_10103037 3300025928 Bacteria 2281
245 Ga0207700_10289404 3300025928 Unclassified 1412
246 Ga0207664_10053544 3300025929 Bacteria 3195
247 Ga0207664_10346289 3300025929 Bacteria 1314
248 Ga0207664_10589319 3300025929 Bacteria 998
249 Ga0207664_10678137 3300025929 Bacteria 927
250 Ga0207664_10760671 3300025929 Bacteria 871
251 Ga0207664_11105523 3300025929 Bacteria 708
252 Ga0207690_10179711 3300025932 Bacteria 1592
253 Ga0207706_10014303 3300025933 Bacteria 7192
254 Ga0207686_10041225 3300025934 Bacteria 2813
255 Ga0207686_10398354 3300025934 Bacteria 1048
256 Ga0207709_10023340 3300025935 Bacteria 3520
257 Ga0207709_10136010 3300025935 Bacteria 1682
258 Ga0207704_11134058 3300025938 Bacteria 665
259 Ga0207665_10093077 3300025939 Bacteria 2092
260 Ga0207665_10302048 3300025939 Bacteria 1197
261 Ga0207661_10328676 3300025944 Bacteria 1376
262 Ga0207661_10577921 3300025944 Bacteria 1031
263 Ga0207661_10750015 3300025944 Bacteria 898
264 Ga0207661_10992972 3300025944 Bacteria 773
265 Ga0207679_11143879 3300025945 Bacteria 714
266 Ga0207679_12042974 3300025945 Bacteria 521
267 Ga0207668_10095475 3300025972 Bacteria 2195
268 Ga0207668_10257474 3300025972 Bacteria 1420
269 Ga0207668_11679129 3300025972 Bacteria 573
270 Ga0207658_10108045 3300025986 Bacteria 2194
271 Ga0207677_11424358 3300026023 Bacteria 639
272 Ga0207677_11477823 3300026023 Bacteria 627
273 Ga0207703_10833929 3300026035 Bacteria 881
274 Ga0207639_10064452 3300026041 Bacteria 2841
275 Ga0207678_10117377 3300026067 Bacteria 2270
276 Ga0207678_10166574 3300026067 Bacteria 1882
277 Ga0207678_10260762 3300026067 Bacteria 1485
278 Ga0207678_11896877 3300026067 Bacteria 520
279 Ga0207708_10096883 3300026075 Bacteria 2280
280 Ga0207702_10005559 3300026078 Bacteria 11008
281 Ga0207702_10303795 3300026078 Bacteria 1515
282 Ga0207702_10316533 3300026078 Bacteria 1485
283 Ga0207702_11316500 3300026078 Bacteria 716
284 Ga0207641_12431414 3300026088 Bacteria 523
285 Ga0207648_10084250 3300026089 Bacteria 2773
286 Ga0207674_10196997 3300026116 Bacteria 1964
287 Ga0207675_100006164 3300026118 Bacteria 11391
288 Ga0207675_100584815 3300026118 Bacteria 1118
289 Ga0207683_10000353 3300026121 Bacteria 42039
290 Ga0207698_10516398 3300026142 Bacteria 1165
291 Ga0207428_10022264 3300027907 Bacteria 5351
292 Ga0207428_10031719 3300027907 Bacteria 4355
293 Ga0207428_10242044 3300027907 Bacteria 1348
294 Ga0268264_10057831 3300028381 Bacteria 3244
295 Ga0265319_1048098 3300028563 Bacteria 1417
296 Ga0265319_1054837 3300028563 Bacteria 1306
297 Ga0265318_10173845 3300028577 Bacteria 789
298 Ga0265320_10061945 3300031240 Bacteria 1782
299 Ga0265320_10235101 3300031240 Bacteria 814
300 Ga0265314_10402126 3300031711 Bacteria 740
301 Ga0307410_10050758 3300031852 Bacteria 2792
302 Ga0307406_10922664 3300031901 Bacteria 745
303 Ga0307406_11787176 3300031901 Bacteria 546
304 Ga0307409_100349981 3300031995 Bacteria 1394
305 Ga0307416_101438326 3300032002 Bacteria 795
306 Ga0307416_103111307 3300032002 Bacteria 555
307 Ga0307411_11303353 3300032005 Bacteria 662
308 Ga0307415_100174287 3300032126 Bacteria 1681
309 Ga0373945_0225320 3300035116 Bacteria 785
310 Ga0373931_0880445 3300035691 Bacteria 601
311 Ga0395900_0030885 3300037418 Bacteria 5502
312 Ga0395900_0087550 3300037418 Bacteria 3201
313 Ga0395898_0020754 3300037466 Bacteria 6669
314 Ga0395898_0939220 3300037466 Bacteria 802
315 Ga0395898_0978881 3300037466 Bacteria 782
316 Ga0395905_0153058 3300037471 Bacteria 2169
317 Ga0436364_0397395 3300037853 Bacteria 30067
318 Ga0436364_1016261 3300037853 Bacteria 7562
319 Ga0436364_1089576 3300037853 Bacteria 2382
320 Ga0395901_0143114 3300038443 Bacteria 2513
321 Ga0395901_0893619 3300038443 Bacteria 871
322 Ga0395901_0942910 3300038443 Bacteria 842
323 Ga0395901_0963163 3300038443 Bacteria 831
324 Ga0395901_1202224 3300038443 Bacteria 724
325 Ga0395901_1382031 3300038443 Bacteria 663
326 Ga0436365_0182701 3300039437 Bacteria 4327
327 Ga0436365_0866838 3300039437 Bacteria 808
328 Ga0436365_1014574 3300039437 Bacteria 3784
329 Ga0436365_1273082 3300039437 Bacteria 11845
330 Ga0436360_1053208 3300039438 Bacteria 1282
331 Ga0436363_0008252 3300039450 Bacteria 9170
332 Ga0436363_0142330 3300039450 Bacteria 8273
333 Ga0436363_0390181 3300039450 Bacteria 903
334 Ga0436363_1622420 3300039450 Bacteria 1076
335 Ga0436363_1634984 3300039450 Bacteria 2399
336 Ga0436363_1709727 3300039450 Bacteria 9654
337 Ga0436362_0279908 3300039453 Bacteria 2847
338 Ga0436362_0815844 3300039453 Bacteria 2173
339 Ga0436362_1128375 3300039453 Bacteria 908
340 Ga0436362_1215302 3300039453 Bacteria 536
341 Ga0436362_1242633 3300039453 Bacteria 1901
342 Ga0466961_0864665 3300044693 Bacteria 539
343 Ga0466963_0027116 3300044694 Bacteria 3666
344 Ga0466963_0032505 3300044694 Bacteria 3379
345 Ga0466963_0059174 3300044694 Bacteria 2557
346 Ga0466963_0073251 3300044694 Bacteria 2309
347 Ga0466963_0107052 3300044694 Bacteria 1917
348 Ga0466963_0196485 3300044694 Bacteria 1410
349 Ga0466963_0278178 3300044694 Bacteria 1176
350 Ga0466964_0040147 3300044706 Bacteria 1889
351 Ga0466964_0620040 3300044706 Bacteria 595
352 Ga0466964_0840591 3300044706 Bacteria 521
353 Ga0466971_0025523 3300044719 Bacteria 2639
354 Ga0466971_0040980 3300044719 Bacteria 2080
355 Ga0466968_0314758 3300044735 Bacteria 755
356 Ga0466970_0429886 3300044765 Bacteria 755
357 Ga0466970_0463939 3300044765 Bacteria 727
358 Ga0466957_0029742 3300044842 Bacteria 3259
359 Ga0466957_0152438 3300044842 Bacteria 1496
360 Ga0466957_0230309 3300044842 Bacteria 1226
361 Ga0466957_0248090 3300044842 Bacteria 1183
362 Ga0466957_0730407 3300044842 Bacteria 700
363 Ga0466960_0000013 3300044901 Bacteria 58320
364 Ga0466960_0108551 3300044901 Bacteria 1439
365 Ga0466960_0363451 3300044901 Bacteria 828
366 Ga0466960_0945112 3300044901 Bacteria 527
367 Ga0466959_0162164 3300045049 Bacteria 1571
368 Ga0451576_1006683 3300045051 Bacteria 873
369 Ga0466958_0000799 3300045836 Bacteria 13886
370 Ga0466958_0028426 3300045836 Bacteria 3315
371 Ga0466958_0028652 3300045836 Bacteria 3302
372 Ga0466958_0094002 3300045836 Bacteria 1857
373 Ga0466958_0689286 3300045836 Bacteria 665
374 Ga0466958_0691166 3300045836 Bacteria 664
375 Ga0466967_0007525 3300045976 Bacteria 7865
376 Ga0466967_0027695 3300045976 Bacteria 4718
377 Ga0466967_0053315 3300045976 Bacteria 3554
378 Ga0466967_0059652 3300045976 Bacteria 3378
379 Ga0466967_0296921 3300045976 Bacteria 1553
380 Ga0466967_0360916 3300045976 Bacteria 1408
381 Ga0466967_0870730 3300045976 Bacteria 895
382 Ga0466967_0876643 3300045976 Bacteria 892
383 Ga0466967_1193242 3300045976 Bacteria 758
384 Ga0466967_2260961 3300045976 Bacteria 539
385 Ga0495603_0007539 3300046455 Bacteria 6543
386 Ga0495629_1004234 3300046459 Bacteria 543
387 Ga0495651_0474385 3300046462 Bacteria 805
388 Ga0495664_0395700 3300046477 Bacteria 830
389 Ga0495584_0055066 3300046491 Bacteria 2002
390 Ga0495584_0434366 3300046491 Bacteria 668
391 Ga0495628_0331265 3300046516 Bacteria 1122
392 Ga0495630_0096519 3300046517 Bacteria 2235
393 Ga0495643_0369223 3300046522 Bacteria 639
394 Ga0495652_0176871 3300046529 Bacteria 1642
395 Ga0495665_0504809 3300046531 Bacteria 609
396 Ga0495645_0000022 3300046543 Bacteria 137019
397 Ga0495645_0779481 3300046543 Bacteria 575
398 Ga0495656_0458287 3300046615 Bacteria 672
399 Ga0495659_0325687 3300046664 Bacteria 653
400 Ga0495588_0210408 3300046674 Bacteria 1027
401 Ga0495623_0677170 3300046679 Bacteria 530
402 Ga0495676_0064058 3300047321 Bacteria 2862
403 Ga0495679_054622 3300047446 Bacteria 1189
404 Ga0495684_0003596 3300047471 Bacteria 12088
405 Ga0496100_0001874 3300048903 Bacteria 10543
406 Ga0496100_0005935 3300048903 Bacteria 6620
407 Ga0496100_0409144 3300048903 Bacteria 1034
408 Ga0496101_0191933 3300048904 Bacteria 1577
409 Ga0496101_0655229 3300048904 Bacteria 829
410 Ga0496102_0013149 3300048905 Bacteria 7161
411 Ga0496102_0095022 3300048905 Bacteria 2762
412 Ga0496102_0716048 3300048905 Bacteria 924
413 Ga0496103_0146144 3300048906 Bacteria 1513
414 Ga0496103_0878192 3300048906 Bacteria 563
415 Ga0496104_0070230 3300048907 Bacteria 3329
416 Ga0496104_0097607 3300048907 Bacteria 2812
417 Ga0496104_0933814 3300048907 Bacteria 772
418 Ga0496105_0008770 3300048908 Bacteria 7870
419 Ga0496106_0006362 3300048909 Bacteria 8743
420 Ga0496106_0079465 3300048909 Bacteria 2518
421 Ga0496107_0010118 3300048910 Bacteria 6542
422 Ga0496107_0019600 3300048910 Bacteria 4773
423 Ga0496107_0039020 3300048910 Bacteria 3406
424 Ga0496108_1065992 3300048911 Bacteria 688
425 Ga0496109_0001893 3300048912 Bacteria 17374
426 Ga0496109_0170566 3300048912 Bacteria 2041
427 Ga0496109_1143132 3300048912 Bacteria 715
428 Ga0496109_1394334 3300048912 Bacteria 636
429 Ga0496110_0322544 3300048913 Bacteria 1407
430 Ga0496110_0649892 3300048913 Bacteria 954
431 Ga0496111_0292271 3300048914 Bacteria 1208
432 Ga0496111_0441450 3300048914 Bacteria 961
433 Ga0496111_0734318 3300048914 Bacteria 717
434 Ga0496111_1008506 3300048914 Bacteria 596
435 Ga0496112_0362099 3300048915 Bacteria 1392
436 Ga0496112_0403825 3300048915 Bacteria 1306
437 Ga0496112_0568465 3300048915 Bacteria 1067
438 Ga0496113_0164204 3300048916 Bacteria 1757
439 Ga0496114_0009721 3300048917 Bacteria 7641
440 Ga0496114_1673830 3300048917 Bacteria 524
441 Ga0496115_0000051 3300048918 Bacteria 107411
442 Ga0496115_0000249 3300048918 Bacteria 48011
443 Ga0496115_0015089 3300048918 Bacteria 5854
444 Ga0496115_0125883 3300048918 Bacteria 2111
445 Ga0496115_1195150 3300048918 Bacteria 572
446 Ga0501031_0597800 3300049568 Bacteria 710
447 Ga0501034_1088393 3300049571 Bacteria 681
448 Ga0501036_0223183 3300049572 Bacteria 1582
449 Ga0501036_0495234 3300049572 Bacteria 1017
450 Ga0501038_0180740 3300049574 Bacteria 1702
451 Ga0501039_0191577 3300049575 Bacteria 1608
452 Ga0501040_1148424 3300049576 Bacteria 563
453 Ga0501041_0279625 3300049577 Bacteria 1050
454 Ga0501042_0023244 3300049578 Bacteria 4336
455 Ga0501043_0663523 3300049579 Bacteria 765
456 Ga0501046_0513398 3300049580 Unclassified 857
457 Ga0501048_0156212 3300049582 Bacteria 1614
458 Ga0501067_0199395 3300049583 Bacteria 1115
459 Ga0501069_0708942 3300049585 Bacteria 607
460 Ga0501071_0372106 3300049587 Bacteria 1089
461 Ga0501072_0612902 3300049588 Bacteria 858
462 Ga0501075_0045272 3300049591 Bacteria 3303
463 Ga0501075_0196876 3300049591 Bacteria 1537
464 Ga0501075_0264424 3300049591 Bacteria 1311
465 Ga0501076_0290392 3300049592 Bacteria 1340
466 Ga0501076_0347243 3300049592 Bacteria 1218
467 Ga0501079_0526636 3300049741 Bacteria 929
468 Ga0501080_1330882 3300049742 Bacteria 614
469 Ga0501081_0203608 3300049743 Bacteria 1436
470 Ga0501045_0227623 3300049824 Bacteria 1388
471 Ga0501045_0241164 3300049824 Bacteria 1346
472 nmdc:mga03n38_209008_c1 3300050490 Bacteria 1013
473 nmdc:mga03n38_939901_c1 3300050490 Bacteria 510
474 nmdc:mga0yw44_303952_c1 3300050492 Bacteria 1069
475 nmdc:mga05p37_156182_c1 3300050507 Bacteria 2788
476 nmdc:mga05p37_350340_c1 3300050507 Bacteria 1739
477 nmdc:mga05p37_424277_c1 3300050507 Bacteria 1547
478 nmdc:mga0qj67_796616_c1 3300050509 Unclassified 748
479 nmdc:mga06r32_12005_c1 3300050510 Bacteria 7807
480 nmdc:mga06r32_123929_c1 3300050510 Bacteria 2551
481 nmdc:mga06r32_156627_c1 3300050510 Bacteria 2259
482 nmdc:mga06r32_774981_c1 3300050510 Bacteria 921
483 nmdc:mga06r32_7951_c1 3300050510 Bacteria 9530
484 nmdc:mga08y16_202322_c1 3300050511 Bacteria 2058
485 nmdc:mga08y16_359095_c1 3300050511 Bacteria 1496
486 nmdc:mga08y16_43704_c1 3300050511 Bacteria 4696
487 nmdc:mga0n895_113433_c1 3300050512 Bacteria 2728
488 nmdc:mga0n895_1314156_c1 3300050512 Bacteria 694
489 nmdc:mga0n895_50679_c1 3300050512 Bacteria 4070
490 nmdc:mga0n895_96452_c1 3300050512 Bacteria 2962
491 nmdc:mga0rr50_134728_c1 3300050513 Bacteria 1981
492 nmdc:mga0rr50_33387_c1 3300050513 Bacteria 3675
493 nmdc:mga0rr50_390682_c1 3300050513 Bacteria 1174
494 nmdc:mga0rr50_874842_c1 3300050513 Bacteria 766
495 nmdc:mga08x19_293674_c1 3300050514 Bacteria 1128
496 nmdc:mga08x19_84284_c1 3300050514 Bacteria 2090
497 nmdc:mga0a205_19428_c1 3300050515 Bacteria 6404
498 nmdc:mga0a205_214132_c1 3300050515 Bacteria 1814
499 Ga0495601_0004149 3300053077 Bacteria 8350
500 Ga0495601_0397436 3300053077 Bacteria 894
501 Ga0495601_0886117 3300053077 Bacteria 564
502 Ga0495612_0485516 3300053078 Bacteria 566
503 Ga0500616_0003624 3300053153 Bacteria 11632
504 Ga0500599_014078 3300053736 Bacteria 1087
505 Ga0501084_0781280 3300054114 Bacteria 804
506 Ga0590075_212616 3300059424 Bacteria 512
507 Ga0466962_0000997 3300061719 Bacteria 12937
508 Ga0466962_0015859 3300061719 Bacteria 3636
509 Ga0466962_0148061 3300061719 Bacteria 1139
510 Ga0530510_0276768 3300061734 Bacteria 1253
511 Ga0530510_1170693 3300061734 Bacteria 589
512 Ga0207684_10830285
513 JGI25407J50210_10118504
514 Ga0070658_10026210
515 Ga0070658_10054599
516 Ga0070683_100041520
517 Ga0070683_100106032
518 Ga0070683_100123711
519 Ga0070683_101574494
520 Ga0070690_100837430
521 Ga0070666_10065959
522 Ga0070680_100145592
523 Ga0070680_101125450
524 Ga0070682_100163205
525 Ga0070682_100693241
526 Ga0070682_101724396
527 Ga0070660_100106807
528 Ga0070691_10090870
529 Ga0070687_100314728
530 Ga0070687_100514594
531 Ga0070661_100004985
532 Ga0070668_100999498
533 Ga0070659_100017534
534 Ga0070709_10304527
535 Ga0070714_100403083
536 Ga0070714_100898314
537 Ga0070713_100055889
538 Ga0070713_101281823
539 Ga0070713_101342860
540 Ga0070710_10076464
541 Ga0070710_10129293
542 Ga0070710_10563812
543 Ga0070710_10938408
544 Ga0070701_11212560
545 Ga0070711_100011972
546 Ga0070711_100082333
547 Ga0070711_100246270
548 Ga0070711_100249758
549 Ga0070711_100367592
550 Ga0070705_100800335
551 Ga0070705_101823964
552 Ga0070700_100055746
553 Ga0070700_100078874
554 Ga0070700_101271892
555 Ga0070663_100143319
556 Ga0070678_100001225
557 Ga0070662_100088500
558 Ga0070681_10013816
559 Ga0070681_11107223
560 Ga0068867_100119462
561 Ga0070679_100037373
562 Ga0070679_100234140
563 Ga0070679_101053131
564 Ga0070684_100026971
565 Ga0070684_100045373
566 Ga0070684_100176877
567 Ga0070697_100261423
568 Ga0070697_100358706
569 Ga0068853_100090366
570 Ga0070686_100076481
571 Ga0070686_100813580
572 Ga0070695_100882980
573 Ga0070695_101843787
574 Ga0070696_101462717
575 Ga0070693_100074328
576 Ga0070693_101409057
577 Ga0070665_100103926
578 Ga0070704_100550431
579 Ga0070704_100667522
580 Ga0070704_101977600
581 Ga0068855_100112509
582 Ga0070664_100293314
583 Ga0070664_100577399
584 Ga0068856_100007445
585 Ga0068856_100036450
586 Ga0068856_100890180
587 Ga0068856_101040357
588 Ga0068852_100348245
589 Ga0068852_100723930
590 Ga0068864_100172492
591 Ga0068866_10045495
592 Ga0068866_10600347
593 Ga0068861_100148316
594 Ga0068861_100161729
595 Ga0068861_100390493
596 Ga0068861_100812855
597 Ga0068860_100081571
598 Ga0081455_10042778
599 Ga0081455_10097076
600 Ga0081538_10000882
601 Ga0081538_10055777
602 Ga0081538_10064622
603 Ga0081540_1002831
604 Ga0081539_10221659
605 Ga0081539_10345078
606 Ga0070717_10796638
607 Ga0075365_10093228
608 Ga0075364_10122274
609 Ga0075432_10293921
610 Ga0070715_10086275
611 Ga0070716_100023525
612 Ga0070716_100264343
613 Ga0070712_100034590
614 Ga0070712_100172212
615 Ga0070712_100202019
616 Ga0070712_100239701
617 Ga0070712_100420710
618 Ga0070712_101585012
619 Ga0070712_101967922
620 Ga0097621_100042381
621 Ga0068871_100742664
622 Ga0075428_100241446
623 Ga0075428_101618667
624 Ga0075430_100463229
625 Ga0075430_100604343
626 Ga0075431_100003668
627 Ga0075431_100064144
628 Ga0075431_100100928
629 Ga0075431_100178401
630 Ga0075431_101711271
631 Ga0075433_10229209
632 Ga0075434_100032067
633 Ga0075434_100092762
634 Ga0075434_100097794
635 Ga0075429_100642502
636 Ga0075429_100792315
637 Ga0068865_100177780
638 Ga0068865_101090509
639 Ga0075436_100050731
640 Ga0075435_100104590
641 Ga0075435_100699751
642 Ga0105240_10036201
643 Ga0105240_10229604
644 Ga0111539_10006971
645 Ga0111539_10007650
646 Ga0111539_10012239
647 Ga0111539_10073225
648 Ga0111539_10918583
649 Ga0111539_12244123
650 Ga0105245_10339286
651 Ga0105245_12764185
652 Ga0105247_10041820
653 Ga0114129_10190175
654 Ga0114129_10298534
655 Ga0114129_10358858
656 Ga0114129_11297022
657 Ga0114129_11326430
658 Ga0114129_11909971
659 Ga0114129_12170146
660 Ga0114129_12563438
661 Ga0114129_12657181
662 Ga0114129_12965840
663 Ga0105243_10004965
664 Ga0105243_10165423
665 Ga0105243_10214949
666 Ga0105243_11477372
667 Ga0105243_12094534
668 Ga0105241_10021677
669 Ga0105242_10001616
670 Ga0105242_10064832
671 Ga0105242_10111772
672 Ga0105242_10380661
673 Ga0105242_10546404
674 Ga0105242_12185531
675 Ga0105248_10044039
676 Ga0105248_11987530
677 Ga0105237_10298990
678 Ga0105237_11357531
679 Ga0105237_11904123
680 Ga0105238_10054283
681 Ga0105238_11347428
682 Ga0105249_10005418
683 Ga0105249_10673554
684 Ga0105249_11812635
685 Ga0105239_10020432
686 Ga0105239_10189920
687 Ga0105239_13041233
688 Ga0105239_13336384
689 Ga0105246_10931659
690 Ga0105246_11967997
691 Ga0157369_10332795
692 Ga0157369_10693402
693 Ga0157374_10551720
694 Ga0157374_11503273
695 Ga0157378_10073833
696 Ga0163162_10103680
697 Ga0163162_10362301
698 Ga0163162_11776377
699 Ga0157372_10997587
700 Ga0157372_11402813
701 Ga0163163_12180123
702 Ga0157380_10182977
703 Ga0182008_10615613
704 Ga0157377_10340591
705 Ga0157379_10000843
706 Ga0157376_10264165
707 Ga0163161_10190262
708 Ga0197907_10664953
709 Ga0206356_11244119
710 Ga0206354_10124711
711 Ga0206354_11287985
712 Ga0206353_10839957
713 Ga0213873_10020470
714 Ga0213873_10083788
715 Ga0213874_10015550
716 Ga0213874_10024639
717 Ga0213874_10035995
718 Ga0213874_10330682
719 Ga0213876_10006953
720 Ga0213876_10031630
721 Ga0213876_10098754
722 Ga0213875_10010558
723 Ga0224712_10059636
724 Ga0207692_10094447
725 Ga0207692_10117683
726 Ga0207692_10127590
727 Ga0207692_10441830
728 Ga0207642_10008294
729 Ga0207710_10061135
730 Ga0207688_10337546
731 Ga0207680_10326333
732 Ga0207685_10009157
733 Ga0207699_10108525
734 Ga0207705_10092218
735 Ga0207705_10132826
736 Ga0207684_10076086
737 Ga0207654_10134841
738 Ga0207707_10144879
739 Ga0207695_10282430
740 Ga0207671_10073789
741 Ga0207693_10040204
742 Ga0207693_10151002
743 Ga0207693_10974698
744 Ga0207663_10061880
745 Ga0207660_10714884
746 Ga0207660_10986087
747 Ga0207657_10001254
748 Ga0207657_10099081
749 Ga0207652_10131717
750 Ga0207652_10808262
751 Ga0207694_10027171
752 Ga0207687_10105496
753 Ga0207687_10821683
754 Ga0207700_10004257
755 Ga0207700_10103037
756 Ga0207700_10289404
757 Ga0207664_10053544
758 Ga0207664_10346289
759 Ga0207664_10589319
760 Ga0207664_10678137
761 Ga0207664_10760671
762 Ga0207664_11105523
763 Ga0207690_10179711
764 Ga0207706_10014303
765 Ga0207686_10041225
766 Ga0207686_10398354
767 Ga0207709_10023340
768 Ga0207709_10136010
769 Ga0207704_11134058
770 Ga0207665_10093077
771 Ga0207665_10302048
772 Ga0207661_10328676
773 Ga0207661_10577921
774 Ga0207661_10750015
775 Ga0207661_10992972
776 Ga0207679_11143879
777 Ga0207679_12042974
778 Ga0207668_10095475
779 Ga0207668_10257474
780 Ga0207668_11679129
781 Ga0207658_10108045
782 Ga0207677_11424358
783 Ga0207677_11477823
784 Ga0207703_10833929
785 Ga0207639_10064452
786 Ga0207678_10117377
787 Ga0207678_10166574
788 Ga0207678_10260762
789 Ga0207678_11896877
790 Ga0207708_10096883
791 Ga0207702_10005559
792 Ga0207702_10303795
793 Ga0207702_10316533
794 Ga0207702_11316500
795 Ga0207641_12431414
796 Ga0207648_10084250
797 Ga0207674_10196997
798 Ga0207675_100006164
799 Ga0207675_100584815
800 Ga0207683_10000353
801 Ga0207698_10516398
802 Ga0207428_10022264
803 Ga0207428_10031719
804 Ga0207428_10242044
805 Ga0268264_10057831
806 Ga0265319_1048098
807 Ga0265319_1054837
808 Ga0265318_10173845
809 Ga0265320_10061945
810 Ga0265320_10235101
811 Ga0265314_10402126
812 Ga0307410_10050758
813 Ga0307406_10922664
814 Ga0307406_11787176
815 Ga0307409_100349981
816 Ga0307416_101438326
817 Ga0307416_103111307
818 Ga0307411_11303353
819 Ga0307415_100174287
820 Ga0373945_0225320
821 Ga0373931_0880445
822 Ga0395900_0030885
823 Ga0395900_0087550
824 Ga0395898_0020754
825 Ga0395898_0939220
826 Ga0395898_0978881
827 Ga0395905_0153058
828 Ga0436364_0397395
829 Ga0436364_1016261
830 Ga0436364_1089576
831 Ga0395901_0143114
832 Ga0395901_0893619
833 Ga0395901_0942910
834 Ga0395901_0963163
835 Ga0395901_1202224
836 Ga0395901_1382031
837 Ga0436365_0182701
838 Ga0436365_0866838
839 Ga0436365_1014574
840 Ga0436365_1273082
841 Ga0436360_1053208
842 Ga0436363_0008252
843 Ga0436363_0142330
844 Ga0436363_0390181
845 Ga0436363_1622420
846 Ga0436363_1634984
847 Ga0436363_1709727
848 Ga0436362_0279908
849 Ga0436362_0815844
850 Ga0436362_1128375
851 Ga0436362_1215302
852 Ga0436362_1242633
853 Ga0466961_0864665
854 Ga0466963_0027116
855 Ga0466963_0032505
856 Ga0466963_0059174
857 Ga0466963_0073251
858 Ga0466963_0107052
859 Ga0466963_0196485
860 Ga0466963_0278178
861 Ga0466964_0040147
862 Ga0466964_0620040
863 Ga0466964_0840591
864 Ga0466971_0025523
865 Ga0466971_0040980
866 Ga0466968_0314758
867 Ga0466970_0429886
868 Ga0466970_0463939
869 Ga0466957_0029742
870 Ga0466957_0152438
871 Ga0466957_0230309
872 Ga0466957_0248090
873 Ga0466957_0730407
874 Ga0466960_0000013
875 Ga0466960_0108551
876 Ga0466960_0363451
877 Ga0466960_0945112
878 Ga0466959_0162164
879 Ga0451576_1006683
880 Ga0466958_0000799
881 Ga0466958_0028426
882 Ga0466958_0028652
883 Ga0466958_0094002
884 Ga0466958_0689286
885 Ga0466958_0691166
886 Ga0466967_0007525
887 Ga0466967_0027695
888 Ga0466967_0053315
889 Ga0466967_0059652
890 Ga0466967_0296921
891 Ga0466967_0360916
892 Ga0466967_0870730
893 Ga0466967_0876643
894 Ga0466967_1193242
895 Ga0466967_2260961
896 Ga0495603_0007539
897 Ga0495629_1004234
898 Ga0495651_0474385
899 Ga0495664_0395700
900 Ga0495584_0055066
901 Ga0495584_0434366
902 Ga0495628_0331265
903 Ga0495630_0096519
904 Ga0495643_0369223
905 Ga0495652_0176871
906 Ga0495665_0504809
907 Ga0495645_0000022
908 Ga0495645_0779481
909 Ga0495656_0458287
910 Ga0495659_0325687
911 Ga0495588_0210408
912 Ga0495623_0677170
913 Ga0495676_0064058
914 Ga0495679_054622
915 Ga0495684_0003596
916 Ga0496100_0001874
917 Ga0496100_0005935
918 Ga0496100_0409144
919 Ga0496101_0191933
920 Ga0496101_0655229
921 Ga0496102_0013149
922 Ga0496102_0095022
923 Ga0496102_0716048
924 Ga0496103_0146144
925 Ga0496103_0878192
926 Ga0496104_0070230
927 Ga0496104_0097607
928 Ga0496104_0933814
929 Ga0496105_0008770
930 Ga0496106_0006362
931 Ga0496106_0079465
932 Ga0496107_0010118
933 Ga0496107_0019600
934 Ga0496107_0039020
935 Ga0496108_1065992
936 Ga0496109_0001893
937 Ga0496109_0170566
938 Ga0496109_1143132
939 Ga0496109_1394334
940 Ga0496110_0322544
941 Ga0496110_0649892
942 Ga0496111_0292271
943 Ga0496111_0441450
944 Ga0496111_0734318
945 Ga0496111_1008506
946 Ga0496112_0362099
947 Ga0496112_0403825
948 Ga0496112_0568465
949 Ga0496113_0164204
950 Ga0496114_0009721
951 Ga0496114_1673830
952 Ga0496115_0000051
953 Ga0496115_0000249
954 Ga0496115_0015089
955 Ga0496115_0125883
956 Ga0496115_1195150
957 Ga0501031_0597800
958 Ga0501034_1088393
959 Ga0501036_0223183
960 Ga0501036_0495234
961 Ga0501038_0180740
962 Ga0501039_0191577
963 Ga0501040_1148424
964 Ga0501041_0279625
965 Ga0501042_0023244
966 Ga0501043_0663523
967 Ga0501046_0513398
968 Ga0501048_0156212
969 Ga0501067_0199395
970 Ga0501069_0708942
971 Ga0501071_0372106
972 Ga0501072_0612902
973 Ga0501075_0045272
974 Ga0501075_0196876
975 Ga0501075_0264424
976 Ga0501076_0290392
977 Ga0501076_0347243
978 Ga0501079_0526636
979 Ga0501080_1330882
980 Ga0501081_0203608
981 Ga0501045_0227623
982 Ga0501045_0241164
983 nmdc:mga03n38_209008_c1
984 nmdc:mga03n38_939901_c1
985 nmdc:mga0yw44_303952_c1
986 nmdc:mga05p37_156182_c1
987 nmdc:mga05p37_350340_c1
988 nmdc:mga05p37_424277_c1
989 nmdc:mga0qj67_796616_c1
990 nmdc:mga06r32_12005_c1
991 nmdc:mga06r32_123929_c1
992 nmdc:mga06r32_156627_c1
993 nmdc:mga06r32_774981_c1
994 nmdc:mga06r32_7951_c1
995 nmdc:mga08y16_202322_c1
996 nmdc:mga08y16_359095_c1
997 nmdc:mga08y16_43704_c1
998 nmdc:mga0n895_113433_c1
999 nmdc:mga0n895_1314156_c1
1000 nmdc:mga0n895_50679_c1
1001 nmdc:mga0n895_96452_c1
1002 nmdc:mga0rr50_134728_c1
1003 nmdc:mga0rr50_33387_c1
1004 nmdc:mga0rr50_390682_c1
1005 nmdc:mga0rr50_874842_c1
1006 nmdc:mga08x19_293674_c1
1007 nmdc:mga08x19_84284_c1
1008 nmdc:mga0a205_19428_c1
1009 nmdc:mga0a205_214132_c1
1010 Ga0495601_0004149
1011 Ga0495601_0397436
1012 Ga0495601_0886117
1013 Ga0495612_0485516
1014 Ga0500616_0003624
1015 Ga0500599_014078
1016 Ga0501084_0781280
1017 Ga0590075_212616
1018 Ga0466962_0000997
1019 Ga0466962_0015859
1020 Ga0466962_0148061
1021 Ga0530510_0276768
1022 Ga0530510_1170693

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02148

zf-UBP

Zn-finger in ubiquitin-hydrolases and other protein

23

91

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ida-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8429 1 92
3phd-assembly1.cif.gz_D crystal structure of human hdac6 in complex with ubiquitin 0.8405 2 85
2i50-assembly1.cif.gz_A solution structure of ubp-m znf-ubp domain 0.8162 21 87
3phd-assembly1.cif.gz_B crystal structure of human hdac6 in complex with ubiquitin 0.8069 2 96
5g0f-assembly1.cif.gz_A crystal structure of danio rerio hdac6 znf-ubp domain 0.7958 2 96
ID Description Score Start End Superfamily
af_Q55EJ1_913_1015_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.95 33 84 3.30.40.10
1s24A00 Mainly Beta;Single Sheet;Rubrerythrin, domain 2; 0.9304 32 43 2.20.28.10
af_I1MCC9_211_290_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.9225 33 85 3.30.40.10
af_Q7Z569_302_376_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8842 19 87 3.30.40.10
af_A4IA95_233_330_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8828 20 87 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A5N8YYI3-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9917 20 85 GO:0008270
AF-A0A7W0S772-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9905 32 87 GO:0008270
AF-A0A538KF98-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9885 1 101 GO:0008270
AF-A0A2W6D0K8-F1-model_v4 UBP-type domain-containing protein 0.9867 20 86 GO:0008270
AF-A0A7Y6CDF6-F1-model_v4 UBP-type zinc finger domain-containing protein 0.9807 3 87 GO:0008270

Map