F457269

General Info

Members Datasets Scaffolds Average Seq Length
511 211 1020 298

Family's Representative Sequence

Representative Sequence 3300006846|Ga0075430_100039347|Ga0075430_1000393471
Length 328
Sequence LGCDARAQVNTNLYLNLLLLAQEAAHGAAEAQREGFDAGSTIIEHVSNSPIDHPLIHLPHIFGIDFSVTKHVFMLWLVAAIVFVLVTFTVRRYLKQDRLIPSGFMNALEAVVEFIRDSIVQPNVGRKWVLTWSPLILTFFFFILTANAMGLIPLFDFVGMLDRFVIHSSPETFLYKVIHGGTTATANFNVTAALATVTFGAIILAGSLAHGFVQHWKNLVPHGLSPVLYVILIPIEVIGMFVRPFALTMRLAANMTGGHIAILAILSFVFLFTEMFKSHIAGIGVGFLVSMPLAVGISALEIIVVLVQAYVFTLLTAVFIGMAIHVHH

Samples

Sample ID Description Type Environment
1 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
150 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
154 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
155 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
156 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
157 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
164 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
176 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
198 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
206 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.37
Rhizosphere 98.63
Stem 0
Stem Tuber 0
Unclassified 10.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075430_100039347 3300006846 Bacteria 4004
2 JGI24746J21847_1001253 3300001977 Unclassified 4046
3 JGI24035J26624_1005357 3300002126 Bacteria 1229
4 Ga0065704_10141678 3300005289 Bacteria 1511
5 Ga0065712_10017459 3300005290 Bacteria 1637
6 Ga0065712_10073707 3300005290 Bacteria 4303
7 Ga0065712_10108846 3300005290 Bacteria 1866
8 Ga0065712_10165721 3300005290 Bacteria 1274
9 Ga0065715_10011432 3300005293 Bacteria 4813
10 Ga0065715_10224452 3300005293 Bacteria 1258
11 Ga0065715_10265305 3300005293 Bacteria 1117
12 Ga0065707_10091118 3300005295 Bacteria 4000
13 Ga0065707_10137620 3300005295 Bacteria 1817
14 Ga0065707_10241918 3300005295 Bacteria 1153
15 Ga0070676_10022071 3300005328 Bacteria 3568
16 Ga0070683_100012297 3300005329 Bacteria 7435
17 Ga0070683_100288856 3300005329 Bacteria 1560
18 Ga0070690_100003409 3300005330 Bacteria 8691
19 Ga0070690_100031133 3300005330 Bacteria 3321
20 Ga0070690_100050032 3300005330 Bacteria 2666
21 Ga0070670_100003566 3300005331 Bacteria 12942
22 Ga0070670_100004718 3300005331 Bacteria 11438
23 Ga0070670_100154019 3300005331 Unclassified 1990
24 Ga0070677_10004850 3300005333 Bacteria 4414
25 Ga0070677_10010364 3300005333 Bacteria 3187
26 Ga0070677_10103163 3300005333 Bacteria 1261
27 Ga0070677_10120093 3300005333 Bacteria 1186
28 Ga0068869_100002749 3300005334 Bacteria 10651
29 Ga0068869_100085152 3300005334 Bacteria 2367
30 Ga0068869_100221711 3300005334 Bacteria 1499
31 Ga0070666_10023762 3300005335 Unclassified 3991
32 Ga0070666_10069291 3300005335 Bacteria 2398
33 Ga0070666_10079519 3300005335 Bacteria 2239
34 Ga0068868_100210731 3300005338 Bacteria 1624
35 Ga0068868_100430453 3300005338 Bacteria 1144
36 Ga0070689_100149903 3300005340 Bacteria 1880
37 Ga0070687_100008073 3300005343 Unclassified 4434
38 Ga0070687_100022218 3300005343 Bacteria 2996
39 Ga0070687_100103752 3300005343 Unclassified 1597
40 Ga0070687_100158474 3300005343 Bacteria 1336
41 Ga0070669_100038645 3300005353 Bacteria 3465
42 Ga0070669_100083980 3300005353 Bacteria 2375
43 Ga0070669_100086394 3300005353 Bacteria 2344
44 Ga0070669_100104573 3300005353 Bacteria 2140
45 Ga0070669_100353792 3300005353 Bacteria 1193
46 Ga0070675_100003516 3300005354 Bacteria 11879
47 Ga0070675_100033055 3300005354 Bacteria 4190
48 Ga0070675_100036026 3300005354 Bacteria 4024
49 Ga0070675_100036511 3300005354 Bacteria 3999
50 Ga0070675_100077252 3300005354 Bacteria 2771
51 Ga0070675_100081628 3300005354 Bacteria 2696
52 Ga0070675_100156409 3300005354 Bacteria 1957
53 Ga0070675_100343769 3300005354 Unclassified 1322
54 Ga0070671_100003935 3300005355 Bacteria 11685
55 Ga0070671_100009589 3300005355 Bacteria 7779
56 Ga0070674_100001990 3300005356 Bacteria 11187
57 Ga0070674_100041019 3300005356 Bacteria 3134
58 Ga0070674_100044400 3300005356 Bacteria 3029
59 Ga0070674_100110760 3300005356 Bacteria 2015
60 Ga0070674_100269709 3300005356 Bacteria 1344
61 Ga0070673_100008431 3300005364 Bacteria 6854
62 Ga0070673_100015634 3300005364 Bacteria 5337
63 Ga0070673_100050492 3300005364 Bacteria 3252
64 Ga0070673_100205608 3300005364 Bacteria 1697
65 Ga0070673_100322702 3300005364 Bacteria 1364
66 Ga0070688_100009723 3300005365 Bacteria 5277
67 Ga0070688_100100566 3300005365 Bacteria 1905
68 Ga0070667_100069521 3300005367 Bacteria 2996
69 Ga0070667_100158425 3300005367 Unclassified 1993
70 Ga0070701_10007885 3300005438 Bacteria 4578
71 Ga0070705_100005920 3300005440 Bacteria 5980
72 Ga0070705_100010531 3300005440 Bacteria 4633
73 Ga0070705_100038000 3300005440 Bacteria 2720
74 Ga0070700_100003485 3300005441 Bacteria 8116
75 Ga0070700_100029716 3300005441 Bacteria 3260
76 Ga0070700_100143290 3300005441 Bacteria 1626
77 Ga0070694_100000901 3300005444 Bacteria 16782
78 Ga0070694_100061541 3300005444 Bacteria 2562
79 Ga0070678_100039943 3300005456 Unclassified 3316
80 Ga0070678_100547929 3300005456 Bacteria 1026
81 Ga0070662_100011937 3300005457 Bacteria 5744
82 Ga0070662_100029157 3300005457 Bacteria 3850
83 Ga0070662_100100630 3300005457 Bacteria 2187
84 Ga0070662_100329023 3300005457 Bacteria 1248
85 Ga0070681_10001438 3300005458 Bacteria 20959
86 Ga0068867_100016729 3300005459 Bacteria 5211
87 Ga0068867_100034213 3300005459 Bacteria 3682
88 Ga0068867_100049581 3300005459 Bacteria 3092
89 Ga0068867_100124885 3300005459 Bacteria 1993
90 Ga0068867_100237117 3300005459 Unclassified 1477
91 Ga0070685_10006613 3300005466 Bacteria 5914
92 Ga0070706_100000003 3300005467 Bacteria 284182
93 Ga0070707_100006026 3300005468 Bacteria 11314
94 Ga0070707_100011598 3300005468 Bacteria 8222
95 Ga0070707_100025574 3300005468 Bacteria 5603
96 Ga0070707_100179835 3300005468 Bacteria 2062
97 Ga0070698_100024814 3300005471 Bacteria 6251
98 Ga0070698_100060317 3300005471 Bacteria 3828
99 Ga0070698_100229910 3300005471 Bacteria 1788
100 Ga0070699_100005549 3300005518 Bacteria 11060
101 Ga0070699_100058957 3300005518 Bacteria 3326
102 Ga0070679_100120564 3300005530 Bacteria 2608
103 Ga0070684_100030695 3300005535 Bacteria 4569
104 Ga0070697_100006893 3300005536 Bacteria 8828
105 Ga0070697_100026767 3300005536 Bacteria 4611
106 Ga0070697_100061488 3300005536 Bacteria 3063
107 Ga0070697_100108501 3300005536 Bacteria 2311
108 Ga0070672_100027217 3300005543 Bacteria 4263
109 Ga0070672_100059689 3300005543 Bacteria 3001
110 Ga0070672_100096805 3300005543 Bacteria 2388
111 Ga0070686_100023292 3300005544 Bacteria 3699
112 Ga0070686_100095336 3300005544 Bacteria 1999
113 Ga0070695_100006579 3300005545 Bacteria 6865
114 Ga0070696_100011592 3300005546 Bacteria 5907
115 Ga0070665_100020168 3300005548 Bacteria 6692
116 Ga0070665_100115440 3300005548 Bacteria 2688
117 Ga0070665_100355403 3300005548 Bacteria 1471
118 Ga0070704_100008503 3300005549 Bacteria 6156
119 Ga0070704_100011200 3300005549 Bacteria 5488
120 Ga0070704_100012249 3300005549 Bacteria 5295
121 Ga0070704_100110599 3300005549 Unclassified 2090
122 Ga0068855_100415121 3300005563 Bacteria 1473
123 Ga0070664_100014803 3300005564 Bacteria 6367
124 Ga0070664_100104908 3300005564 Bacteria 2461
125 Ga0070664_100286447 3300005564 Bacteria 1486
126 Ga0068854_100025369 3300005578 Bacteria 4067
127 Ga0068854_100096886 3300005578 Bacteria 2204
128 Ga0070702_100009252 3300005615 Bacteria 4815
129 Ga0070702_100071526 3300005615 Bacteria 2050
130 Ga0070702_100120176 3300005615 Unclassified 1644
131 Ga0068859_100005603 3300005617 Bacteria 12794
132 Ga0068859_100018328 3300005617 Bacteria 7038
133 Ga0068859_100039425 3300005617 Bacteria 4738
134 Ga0068859_100152261 3300005617 Bacteria 2388
135 Ga0068859_100302939 3300005617 Bacteria 1692
136 Ga0068859_100303837 3300005617 Bacteria 1689
137 Ga0068859_100353798 3300005617 Unclassified 1564
138 Ga0068864_100128630 3300005618 Bacteria 2272
139 Ga0068864_100196920 3300005618 Unclassified 1849
140 Ga0068866_10019947 3300005718 Bacteria 3063
141 Ga0068861_100044090 3300005719 Bacteria 3352
142 Ga0068861_100382057 3300005719 Bacteria 1245
143 Ga0068851_10058814 3300005834 Bacteria 1965
144 Ga0068870_10011611 3300005840 Bacteria 4092
145 Ga0068870_10064049 3300005840 Bacteria 1984
146 Ga0068870_10123488 3300005840 Bacteria 1494
147 Ga0068863_100203169 3300005841 Bacteria 1907
148 Ga0068858_100000616 3300005842 Bacteria 37281
149 Ga0068858_100049485 3300005842 Bacteria 3892
150 Ga0068858_100051252 3300005842 Bacteria 3818
151 Ga0068860_100015442 3300005843 Bacteria 7459
152 Ga0068860_100092697 3300005843 Bacteria 2878
153 Ga0068862_100042195 3300005844 Bacteria 3885
154 Ga0068862_100140809 3300005844 Bacteria 2141
155 Ga0068862_100180361 3300005844 Bacteria 1895
156 Ga0097621_100040776 3300006237 Bacteria 3734
157 Ga0097621_100130169 3300006237 Bacteria 2141
158 Ga0097621_100239461 3300006237 Bacteria 1586
159 Ga0068871_100183333 3300006358 Bacteria 1800
160 Ga0068871_100186785 3300006358 Bacteria 1784
161 Ga0075428_100000005 3300006844 Bacteria 326130
162 Ga0075428_100000575 3300006844 Bacteria 37520
163 Ga0075428_100135159 3300006844 Bacteria 2682
164 Ga0075428_100200619 3300006844 Bacteria 2157
165 Ga0075430_100000443 3300006846 Bacteria 30826
166 Ga0075430_100017982 3300006846 Bacteria 6018
167 Ga0075430_100238564 3300006846 Bacteria 1507
168 Ga0075431_100001934 3300006847 Bacteria 19739
169 Ga0075431_100057341 3300006847 Bacteria 4017
170 Ga0075431_100197739 3300006847 Bacteria 2058
171 Ga0075431_100197776 3300006847 Unclassified 2058
172 Ga0075433_10002869 3300006852 Bacteria 13209
173 Ga0075433_10012565 3300006852 Bacteria 6846
174 Ga0075433_10080300 3300006852 Unclassified 2875
175 Ga0075433_10088215 3300006852 Bacteria 2740
176 Ga0075433_10462156 3300006852 Bacteria 1118
177 Ga0075434_100021899 3300006871 Bacteria 6221
178 Ga0075434_100025827 3300006871 Bacteria 5750
179 Ga0075434_100047901 3300006871 Bacteria 4241
180 Ga0075434_100056129 3300006871 Unclassified 3914
181 Ga0075434_100068359 3300006871 Bacteria 3539
182 Ga0075434_100113282 3300006871 Bacteria 2724
183 Ga0075434_100254859 3300006871 Bacteria 1774
184 Ga0075434_100295762 3300006871 Bacteria 1639
185 Ga0075434_100500864 3300006871 Unclassified 1235
186 Ga0075429_100008570 3300006880 Bacteria 8896
187 Ga0075429_100054776 3300006880 Bacteria 3469
188 Ga0075429_100058453 3300006880 Bacteria 3358
189 Ga0075429_100070096 3300006880 Bacteria 3052
190 Ga0068865_100005014 3300006881 Bacteria 8010
191 Ga0075436_100040192 3300006914 Bacteria 3228
192 Ga0075436_100049489 3300006914 Bacteria 2900
193 Ga0097620_100005603 3300006931 Bacteria 12794
194 Ga0097620_100018328 3300006931 Bacteria 7038
195 Ga0097620_100039431 3300006931 Bacteria 4738
196 Ga0097620_100152249 3300006931 Bacteria 2388
197 Ga0097620_100302934 3300006931 Bacteria 1692
198 Ga0097620_100303837 3300006931 Bacteria 1689
199 Ga0097620_100353831 3300006931 Unclassified 1564
200 Ga0075435_100012775 3300007076 Bacteria 6221
201 Ga0075435_100026758 3300007076 Bacteria 4505
202 Ga0111539_10000008 3300009094 Bacteria 382609
203 Ga0111539_10004942 3300009094 Bacteria 17336
204 Ga0111539_10004955 3300009094 Bacteria 17322
205 Ga0111539_10010374 3300009094 Bacteria 11728
206 Ga0111539_10185923 3300009094 Bacteria 2426
207 Ga0105245_10016064 3300009098 Bacteria 6522
208 Ga0105245_10515179 3300009098 Bacteria 1214
209 Ga0105245_10639438 3300009098 Bacteria 1093
210 Ga0105247_10018501 3300009101 Bacteria 4179
211 Ga0105247_10117678 3300009101 Unclassified 1718
212 Ga0105247_10173347 3300009101 Bacteria 1436
213 Ga0114129_10004186 3300009147 Bacteria 20378
214 Ga0114129_10005981 3300009147 Bacteria 17235
215 Ga0114129_10009597 3300009147 Bacteria 13803
216 Ga0114129_10058938 3300009147 Bacteria 5369
217 Ga0114129_10085345 3300009147 Bacteria 4380
218 Ga0114129_10096389 3300009147 Unclassified 4095
219 Ga0114129_10257915 3300009147 Bacteria 2338
220 Ga0114129_10297810 3300009147 Bacteria 2151
221 Ga0114129_10336354 3300009147 Bacteria 2004
222 Ga0114129_10492899 3300009147 Unclassified 1601
223 Ga0114129_10865620 3300009147 Bacteria 1148
224 Ga0105243_10010908 3300009148 Bacteria 6874
225 Ga0105241_10364076 3300009174 Bacteria 1259
226 Ga0105242_10010337 3300009176 Bacteria 7155
227 Ga0105242_10042121 3300009176 Bacteria 3685
228 Ga0105242_10045440 3300009176 Bacteria 3560
229 Ga0105242_10107348 3300009176 Bacteria 2374
230 Ga0105242_10130133 3300009176 Bacteria 2171
231 Ga0105248_10024982 3300009177 Bacteria 6640
232 Ga0105248_10042730 3300009177 Bacteria 5083
233 Ga0105248_10300812 3300009177 Bacteria 1806
234 Ga0105248_10568931 3300009177 Bacteria 1279
235 Ga0105237_10332227 3300009545 Bacteria 1524
236 Ga0105238_10004828 3300009551 Bacteria 13339
237 Ga0105249_10002507 3300009553 Bacteria 15870
238 Ga0105249_10020271 3300009553 Bacteria 5943
239 Ga0105249_10062253 3300009553 Bacteria 3426
240 Ga0105246_10073847 3300011119 Bacteria 2409
241 Ga0105246_10080194 3300011119 Bacteria 2323
242 Ga0105246_10192571 3300011119 Bacteria 1579
243 Ga0157371_10140764 3300013102 Bacteria 1718
244 Ga0157374_10011588 3300013296 Bacteria 7643
245 Ga0157374_10016677 3300013296 Bacteria 6462
246 Ga0163162_10211358 3300013306 Bacteria 2070
247 Ga0157375_10089775 3300013308 Bacteria 3130
248 Ga0157375_10118563 3300013308 Unclassified 2753
249 Ga0157375_10356012 3300013308 Bacteria 1630
250 Ga0157375_10417964 3300013308 Unclassified 1507
251 Ga0163163_10002928 3300014325 Bacteria 14441
252 Ga0163163_10047304 3300014325 Unclassified 4228
253 Ga0163163_10060484 3300014325 Bacteria 3751
254 Ga0163163_10264747 3300014325 Bacteria 1770
255 Ga0157380_10001453 3300014326 Bacteria 15501
256 Ga0157380_10049766 3300014326 Bacteria 3307
257 Ga0157380_10062524 3300014326 Bacteria 2983
258 Ga0157380_10161451 3300014326 Bacteria 1948
259 Ga0157380_10189674 3300014326 Bacteria 1813
260 Ga0157380_10218842 3300014326 Bacteria 1702
261 Ga0157380_10484760 3300014326 Bacteria 1197
262 Ga0157377_10047446 3300014745 Bacteria 2406
263 Ga0157377_10091780 3300014745 Bacteria 1794
264 Ga0157379_10015365 3300014968 Bacteria 6717
265 Ga0157379_10185791 3300014968 Bacteria 1878
266 Ga0157376_10015281 3300014969 Bacteria 5794
267 Ga0207697_10001259 3300025315 Bacteria 13903
268 Ga0207697_10046928 3300025315 Bacteria 1780
269 Ga0207682_10000515 3300025893 Bacteria 17793
270 Ga0207682_10007609 3300025893 Bacteria 4311
271 Ga0207682_10037378 3300025893 Bacteria 1967
272 Ga0207682_10045552 3300025893 Bacteria 1800
273 Ga0207682_10075722 3300025893 Bacteria 1433
274 Ga0207642_10020254 3300025899 Bacteria 2592
275 Ga0207710_10094838 3300025900 Unclassified 1401
276 Ga0207688_10005305 3300025901 Bacteria 6998
277 Ga0207688_10052629 3300025901 Bacteria 2282
278 Ga0207688_10170278 3300025901 Bacteria 1295
279 Ga0207680_10088186 3300025903 Bacteria 1966
280 Ga0207680_10119175 3300025903 Bacteria 1723
281 Ga0207647_10090033 3300025904 Bacteria 1831
282 Ga0207645_10001344 3300025907 Bacteria 20211
283 Ga0207645_10023212 3300025907 Bacteria 4031
284 Ga0207645_10116982 3300025907 Bacteria 1729
285 Ga0207645_10142796 3300025907 Bacteria 1560
286 Ga0207684_10000032 3300025910 Bacteria 293234
287 Ga0207707_10035863 3300025912 Bacteria 4337
288 Ga0207662_10071798 3300025918 Unclassified 2097
289 Ga0207662_10087243 3300025918 Bacteria 1914
290 Ga0207662_10166145 3300025918 Bacteria 1413
291 Ga0207649_10032118 3300025920 Unclassified 3127
292 Ga0207646_10006382 3300025922 Bacteria 12194
293 Ga0207646_10011982 3300025922 Bacteria 8359
294 Ga0207681_10037963 3300025923 Bacteria 3187
295 Ga0207681_10042399 3300025923 Bacteria 3039
296 Ga0207681_10081300 3300025923 Bacteria 2287
297 Ga0207681_10129871 3300025923 Bacteria 1861
298 Ga0207694_10008452 3300025924 Bacteria 7772
299 Ga0207694_10173426 3300025924 Bacteria 1747
300 Ga0207650_10004606 3300025925 Bacteria 9433
301 Ga0207650_10023811 3300025925 Bacteria 4347
302 Ga0207659_10003092 3300025926 Bacteria 9938
303 Ga0207659_10006184 3300025926 Bacteria 7324
304 Ga0207659_10025079 3300025926 Bacteria 4002
305 Ga0207659_10025226 3300025926 Bacteria 3992
306 Ga0207659_10027648 3300025926 Bacteria 3843
307 Ga0207659_10127513 3300025926 Bacteria 1959
308 Ga0207659_10157649 3300025926 Unclassified 1779
309 Ga0207659_10189504 3300025926 Bacteria 1636
310 Ga0207659_10316313 3300025926 Bacteria 1286
311 Ga0207659_10390141 3300025926 Bacteria 1163
312 Ga0207644_10007527 3300025931 Bacteria 7101
313 Ga0207644_10047773 3300025931 Bacteria 3056
314 Ga0207706_10008207 3300025933 Bacteria 9633
315 Ga0207706_10039200 3300025933 Bacteria 4200
316 Ga0207706_10093057 3300025933 Bacteria 2651
317 Ga0207706_10125728 3300025933 Bacteria 2255
318 Ga0207686_10007457 3300025934 Bacteria 5886
319 Ga0207709_10022465 3300025935 Bacteria 3579
320 Ga0207670_10100973 3300025936 Bacteria 2061
321 Ga0207669_10020580 3300025937 Bacteria 3464
322 Ga0207669_10026906 3300025937 Bacteria 3138
323 Ga0207669_10032466 3300025937 Bacteria 2932
324 Ga0207669_10105101 3300025937 Bacteria 1877
325 Ga0207669_10113314 3300025937 Bacteria 1823
326 Ga0207669_10222793 3300025937 Bacteria 1385
327 Ga0207704_10009925 3300025938 Bacteria 4618
328 Ga0207704_10425633 3300025938 Bacteria 1054
329 Ga0207691_10010222 3300025940 Bacteria 9002
330 Ga0207691_10132868 3300025940 Bacteria 2197
331 Ga0207691_10147857 3300025940 Bacteria 2067
332 Ga0207691_10160067 3300025940 Bacteria 1975
333 Ga0207691_10306178 3300025940 Bacteria 1364
334 Ga0207711_10018657 3300025941 Bacteria 5768
335 Ga0207711_10026242 3300025941 Bacteria 4888
336 Ga0207711_10085190 3300025941 Bacteria 2768
337 Ga0207689_10002798 3300025942 Bacteria 16109
338 Ga0207689_10004573 3300025942 Bacteria 12528
339 Ga0207689_10100795 3300025942 Bacteria 2372
340 Ga0207661_10052471 3300025944 Bacteria 3258
341 Ga0207679_10115605 3300025945 Bacteria 2126
342 Ga0207679_10490363 3300025945 Bacteria 1095
343 Ga0207651_10000940 3300025960 Bacteria 12838
344 Ga0207651_10062980 3300025960 Bacteria 2587
345 Ga0207651_10083182 3300025960 Bacteria 2314
346 Ga0207651_10101513 3300025960 Bacteria 2136
347 Ga0207712_10161078 3300025961 Bacteria 1744
348 Ga0207712_10187012 3300025961 Bacteria 1632
349 Ga0207668_10082691 3300025972 Bacteria 2334
350 Ga0207668_10214358 3300025972 Bacteria 1542
351 Ga0207640_10010463 3300025981 Bacteria 5225
352 Ga0207640_10203165 3300025981 Bacteria 1503
353 Ga0207658_10047142 3300025986 Bacteria 3152
354 Ga0207677_10152000 3300026023 Bacteria 1787
355 Ga0207703_10012686 3300026035 Bacteria 6571
356 Ga0207703_10020179 3300026035 Bacteria 5211
357 Ga0207678_10017199 3300026067 Bacteria 6348
358 Ga0207708_10177574 3300026075 Bacteria 1689
359 Ga0207641_10096124 3300026088 Unclassified 2601
360 Ga0207648_10008023 3300026089 Bacteria 10289
361 Ga0207648_10015845 3300026089 Bacteria 6909
362 Ga0207648_10038883 3300026089 Bacteria 4186
363 Ga0207648_10176429 3300026089 Bacteria 1890
364 Ga0207648_10217237 3300026089 Unclassified 1698
365 Ga0207648_10355620 3300026089 Bacteria 1321
366 Ga0207648_10389173 3300026089 Unclassified 1262
367 Ga0207676_10058780 3300026095 Unclassified 3034
368 Ga0207676_10122812 3300026095 Bacteria 2193
369 Ga0207674_10227533 3300026116 Bacteria 1813
370 Ga0207675_100006490 3300026118 Bacteria 11065
371 Ga0207675_100017615 3300026118 Bacteria 6663
372 Ga0207675_100192602 3300026118 Bacteria 1956
373 Ga0207675_100225818 3300026118 Bacteria 1805
374 Ga0207675_100255966 3300026118 Bacteria 1696
375 Ga0207675_100407157 3300026118 Bacteria 1341
376 Ga0207683_10114889 3300026121 Bacteria 2413
377 Ga0207683_10456760 3300026121 Bacteria 1178
378 Ga0207698_10351311 3300026142 Bacteria 1393
379 Ga0207428_10000019 3300027907 Bacteria 276945
380 Ga0207428_10033621 3300027907 Unclassified 4209
381 Ga0207428_10050786 3300027907 Bacteria 3316
382 Ga0207428_10160769 3300027907 Unclassified 1705
383 Ga0268266_10297433 3300028379 Bacteria 1505
384 Ga0268265_10017626 3300028380 Bacteria 4933
385 Ga0268265_10211629 3300028380 Bacteria 1690
386 Ga0268265_10332600 3300028380 Unclassified 1380
387 Ga0268264_10016907 3300028381 Bacteria 5970
388 Ga0307408_100182401 3300031548 Unclassified 1684
389 Ga0307405_10014990 3300031731 Bacteria 4184
390 Ga0307413_10215250 3300031824 Bacteria 1399
391 Ga0307410_10052464 3300031852 Bacteria 2755
392 Ga0307410_10068742 3300031852 Bacteria 2447
393 Ga0307406_10002867 3300031901 Bacteria 9391
394 Ga0307407_10042845 3300031903 Bacteria 2541
395 Ga0307411_10013330 3300032005 Bacteria 4532
396 Ga0307411_10055459 3300032005 Bacteria 2607
397 Ga0373953_0071798 3300035117 Bacteria 1429
398 Ga0373943_0181584 3300035170 Bacteria 1157
399 Ga0373931_0006638 3300035691 Bacteria 5419
400 Ga0373937_0006221 3300036401 Bacteria 10289
401 Ga0373937_0030713 3300036401 Unclassified 4866
402 Ga0439453_0023828 3300041408 Bacteria 1119
403 Ga0439455_0032447 3300042012 Bacteria 1306
404 Ga0439446_0009915 3300042156 Unclassified 2558
405 Ga0451577_0256615 3300042876 Bacteria 1583
406 Ga0453683_0044835 3300044673 Unclassified 2773
407 Ga0451576_0009290 3300045051 Bacteria 11421
408 Ga0451576_0087786 3300045051 Bacteria 3235
409 Ga0451576_0171355 3300045051 Bacteria 2265
410 Ga0451576_0219689 3300045051 Unclassified 1984
411 Ga0451576_0239853 3300045051 Bacteria 1894
412 Ga0466967_0158648 3300045976 Bacteria 2122
413 Ga0495629_0094942 3300046459 Bacteria 2081
414 Ga0495651_0203305 3300046462 Bacteria 1384
415 Ga0495582_0124874 3300046473 Bacteria 1452
416 Ga0495643_0003923 3300046522 Bacteria 10655
417 Ga0495640_0080917 3300046533 Bacteria 2160
418 Ga0495598_0011330 3300046537 Bacteria 2159
419 Ga0495645_0223475 3300046543 Bacteria 1265
420 Ga0495656_0057471 3300046615 Unclassified 1685
421 Ga0495634_0022979 3300046642 Bacteria 4390
422 Ga0495635_0082811 3300046663 Bacteria 2196
423 Ga0495658_0017742 3300046683 Bacteria 3684
424 Ga0495674_0129361 3300047319 Bacteria 2128
425 Ga0495674_0133143 3300047319 Bacteria 2094
426 Ga0495684_0209095 3300047471 Bacteria 1436
427 Ga0495684_0299320 3300047471 Bacteria 1156
428 Ga0496101_0162249 3300048904 Unclassified 1715
429 Ga0496104_0165608 3300048907 Bacteria 2120
430 Ga0496104_0444950 3300048907 Bacteria 1208
431 Ga0496106_0291487 3300048909 Bacteria 1308
432 Ga0496109_0057451 3300048912 Bacteria 3552
433 Ga0496109_0161880 3300048912 Bacteria 2097
434 Ga0496114_0135039 3300048917 Unclassified 2133
435 Ga0501033_0056391 3300049570 Bacteria 2904
436 Ga0501034_0250082 3300049571 Bacteria 1717
437 Ga0501040_0003548 3300049576 Bacteria 10083
438 Ga0501042_0010714 3300049578 Bacteria 6162
439 Ga0501046_0016563 3300049580 Bacteria 6167
440 Ga0501047_0198926 3300049581 Bacteria 1865
441 Ga0501048_0322939 3300049582 Bacteria 1100
442 Ga0501070_0150511 3300049586 Bacteria 1920
443 Ga0501071_0002389 3300049587 Bacteria 11372
444 Ga0501071_0074047 3300049587 Bacteria 2485
445 Ga0501072_0021955 3300049588 Bacteria 4952
446 Ga0501073_0080234 3300049589 Bacteria 2271
447 Ga0501075_0119623 3300049591 Bacteria 2004
448 Ga0501076_0004183 3300049592 Bacteria 10219
449 Ga0501076_0193927 3300049592 Bacteria 1658
450 Ga0501079_0005205 3300049741 Bacteria 9666
451 Ga0501081_0000884 3300049743 Bacteria 17702
452 Ga0501044_0023245 3300049823 Bacteria 6595
453 Ga0501045_0003970 3300049824 Bacteria 10176
454 Ga0501045_0135759 3300049824 Bacteria 1829
455 nmdc:mga05p37_14012_c1 3300050507 Bacteria 9616
456 nmdc:mga05p37_174788_c1 3300050507 Unclassified 2617
457 nmdc:mga05p37_213158_c1 3300050507 Bacteria 2334
458 nmdc:mga05p37_24920_c1 3300050507 Bacteria 7272
459 nmdc:mga05p37_273668_c1 3300050507 Bacteria 2017
460 nmdc:mga05p37_302247_c1 3300050507 Unclassified 1901
461 nmdc:mga05p37_3060_c1 3300050507 Bacteria 19421
462 nmdc:mga05p37_460930_c1 3300050507 Unclassified 1469
463 nmdc:mga05p37_567132_c1 3300050507 Bacteria 1289
464 nmdc:mga09592_1788_c1 3300050508 Bacteria 17258
465 nmdc:mga09592_198361_c1 3300050508 Unclassified 1738
466 nmdc:mga09592_60874_c1 3300050508 Bacteria 3192
467 nmdc:mga0qj67_15253_c1 3300050509 Bacteria 5816
468 nmdc:mga0qj67_1720_c1 3300050509 Bacteria 15439
469 nmdc:mga0qj67_249725_c1 3300050509 Bacteria 1439
470 nmdc:mga0qj67_66439_c1 3300050509 Bacteria 2872
471 nmdc:mga06r32_1414_c1 3300050510 Bacteria 21664
472 nmdc:mga06r32_160790_c1 3300050510 Bacteria 2228
473 nmdc:mga06r32_172110_c1 3300050510 Bacteria 2149
474 nmdc:mga06r32_179510_c1 3300050510 Bacteria 2102
475 nmdc:mga06r32_36329_c1 3300050510 Bacteria 4654
476 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
477 nmdc:mga08y16_329533_c1 3300050511 Bacteria 1571
478 nmdc:mga08y16_52488_c1 3300050511 Unclassified 4266
479 nmdc:mga08y16_5403_c1 3300050511 Bacteria 13361
480 nmdc:mga0n895_34763_c1 3300050512 Unclassified 4854
481 nmdc:mga0n895_68124_c1 3300050512 Unclassified 3525
482 nmdc:mga0n895_71409_c1 3300050512 Bacteria 3442
483 nmdc:mga0n895_78101_c1 3300050512 Bacteria 3294
484 nmdc:mga0n895_80631_c1 3300050512 Bacteria 3243
485 nmdc:mga0n895_93937_c1 3300050512 Bacteria 3003
486 nmdc:mga0rr50_103393_c1 3300050513 Bacteria 2242
487 nmdc:mga0rr50_124715_c1 3300050513 Bacteria 2055
488 nmdc:mga0rr50_30176_c1 3300050513 Bacteria 3835
489 nmdc:mga0rr50_8043_c1 3300050513 Bacteria 6540
490 nmdc:mga08x19_75114_c1 3300050514 Bacteria 2209
491 nmdc:mga0a205_113824_c1 3300050515 Unclassified 2604
492 nmdc:mga0a205_1162_c1 3300050515 Bacteria 21892
493 nmdc:mga0a205_125667_c1 3300050515 Bacteria 2464
494 nmdc:mga0a205_18755_c1 3300050515 Bacteria 6511
495 nmdc:mga0a205_253123_c1 3300050515 Unclassified 1640
496 nmdc:mga0a205_492085_c1 3300050515 Bacteria 1084
497 Ga0495619_0037109 3300053085 Bacteria 3175
498 Ga0501084_0002947 3300054114 Bacteria 13783
499 Ga0501084_0449883 3300054114 Bacteria 1089
500 Ga0590071_000054 3300059421 Bacteria 30441
501 Ga0590071_010268 3300059421 Bacteria 2195
502 Ga0590074_000038 3300059423 Bacteria 12536
503 Ga0590075_000029 3300059424 Bacteria 38953
504 Ga0590077_002763 3300059426 Bacteria 3696
505 Ga0590077_008947 3300059426 Unclassified 2051
506 Ga0501082_0007039 3300060353 Bacteria 9705
507 Ga0501082_0065741 3300060353 Bacteria 3123
508 Ga0530510_0009116 3300061734 Bacteria 6954
509 Ga0530510_0036928 3300061734 Bacteria 3521
510 Ga0530510_0185837 3300061734 Bacteria 1542
511 Ga0075430_100039347
512 JGI24746J21847_1001253
513 JGI24035J26624_1005357
514 Ga0065704_10141678
515 Ga0065712_10017459
516 Ga0065712_10073707
517 Ga0065712_10108846
518 Ga0065712_10165721
519 Ga0065715_10011432
520 Ga0065715_10224452
521 Ga0065715_10265305
522 Ga0065707_10091118
523 Ga0065707_10137620
524 Ga0065707_10241918
525 Ga0070676_10022071
526 Ga0070683_100012297
527 Ga0070683_100288856
528 Ga0070690_100003409
529 Ga0070690_100031133
530 Ga0070690_100050032
531 Ga0070670_100003566
532 Ga0070670_100004718
533 Ga0070670_100154019
534 Ga0070677_10004850
535 Ga0070677_10010364
536 Ga0070677_10103163
537 Ga0070677_10120093
538 Ga0068869_100002749
539 Ga0068869_100085152
540 Ga0068869_100221711
541 Ga0070666_10023762
542 Ga0070666_10069291
543 Ga0070666_10079519
544 Ga0068868_100210731
545 Ga0068868_100430453
546 Ga0070689_100149903
547 Ga0070687_100008073
548 Ga0070687_100022218
549 Ga0070687_100103752
550 Ga0070687_100158474
551 Ga0070669_100038645
552 Ga0070669_100083980
553 Ga0070669_100086394
554 Ga0070669_100104573
555 Ga0070669_100353792
556 Ga0070675_100003516
557 Ga0070675_100033055
558 Ga0070675_100036026
559 Ga0070675_100036511
560 Ga0070675_100077252
561 Ga0070675_100081628
562 Ga0070675_100156409
563 Ga0070675_100343769
564 Ga0070671_100003935
565 Ga0070671_100009589
566 Ga0070674_100001990
567 Ga0070674_100041019
568 Ga0070674_100044400
569 Ga0070674_100110760
570 Ga0070674_100269709
571 Ga0070673_100008431
572 Ga0070673_100015634
573 Ga0070673_100050492
574 Ga0070673_100205608
575 Ga0070673_100322702
576 Ga0070688_100009723
577 Ga0070688_100100566
578 Ga0070667_100069521
579 Ga0070667_100158425
580 Ga0070701_10007885
581 Ga0070705_100005920
582 Ga0070705_100010531
583 Ga0070705_100038000
584 Ga0070700_100003485
585 Ga0070700_100029716
586 Ga0070700_100143290
587 Ga0070694_100000901
588 Ga0070694_100061541
589 Ga0070678_100039943
590 Ga0070678_100547929
591 Ga0070662_100011937
592 Ga0070662_100029157
593 Ga0070662_100100630
594 Ga0070662_100329023
595 Ga0070681_10001438
596 Ga0068867_100016729
597 Ga0068867_100034213
598 Ga0068867_100049581
599 Ga0068867_100124885
600 Ga0068867_100237117
601 Ga0070685_10006613
602 Ga0070706_100000003
603 Ga0070707_100006026
604 Ga0070707_100011598
605 Ga0070707_100025574
606 Ga0070707_100179835
607 Ga0070698_100024814
608 Ga0070698_100060317
609 Ga0070698_100229910
610 Ga0070699_100005549
611 Ga0070699_100058957
612 Ga0070679_100120564
613 Ga0070684_100030695
614 Ga0070697_100006893
615 Ga0070697_100026767
616 Ga0070697_100061488
617 Ga0070697_100108501
618 Ga0070672_100027217
619 Ga0070672_100059689
620 Ga0070672_100096805
621 Ga0070686_100023292
622 Ga0070686_100095336
623 Ga0070695_100006579
624 Ga0070696_100011592
625 Ga0070665_100020168
626 Ga0070665_100115440
627 Ga0070665_100355403
628 Ga0070704_100008503
629 Ga0070704_100011200
630 Ga0070704_100012249
631 Ga0070704_100110599
632 Ga0068855_100415121
633 Ga0070664_100014803
634 Ga0070664_100104908
635 Ga0070664_100286447
636 Ga0068854_100025369
637 Ga0068854_100096886
638 Ga0070702_100009252
639 Ga0070702_100071526
640 Ga0070702_100120176
641 Ga0068859_100005603
642 Ga0068859_100018328
643 Ga0068859_100039425
644 Ga0068859_100152261
645 Ga0068859_100302939
646 Ga0068859_100303837
647 Ga0068859_100353798
648 Ga0068864_100128630
649 Ga0068864_100196920
650 Ga0068866_10019947
651 Ga0068861_100044090
652 Ga0068861_100382057
653 Ga0068851_10058814
654 Ga0068870_10011611
655 Ga0068870_10064049
656 Ga0068870_10123488
657 Ga0068863_100203169
658 Ga0068858_100000616
659 Ga0068858_100049485
660 Ga0068858_100051252
661 Ga0068860_100015442
662 Ga0068860_100092697
663 Ga0068862_100042195
664 Ga0068862_100140809
665 Ga0068862_100180361
666 Ga0097621_100040776
667 Ga0097621_100130169
668 Ga0097621_100239461
669 Ga0068871_100183333
670 Ga0068871_100186785
671 Ga0075428_100000005
672 Ga0075428_100000575
673 Ga0075428_100135159
674 Ga0075428_100200619
675 Ga0075430_100000443
676 Ga0075430_100017982
677 Ga0075430_100238564
678 Ga0075431_100001934
679 Ga0075431_100057341
680 Ga0075431_100197739
681 Ga0075431_100197776
682 Ga0075433_10002869
683 Ga0075433_10012565
684 Ga0075433_10080300
685 Ga0075433_10088215
686 Ga0075433_10462156
687 Ga0075434_100021899
688 Ga0075434_100025827
689 Ga0075434_100047901
690 Ga0075434_100056129
691 Ga0075434_100068359
692 Ga0075434_100113282
693 Ga0075434_100254859
694 Ga0075434_100295762
695 Ga0075434_100500864
696 Ga0075429_100008570
697 Ga0075429_100054776
698 Ga0075429_100058453
699 Ga0075429_100070096
700 Ga0068865_100005014
701 Ga0075436_100040192
702 Ga0075436_100049489
703 Ga0097620_100005603
704 Ga0097620_100018328
705 Ga0097620_100039431
706 Ga0097620_100152249
707 Ga0097620_100302934
708 Ga0097620_100303837
709 Ga0097620_100353831
710 Ga0075435_100012775
711 Ga0075435_100026758
712 Ga0111539_10000008
713 Ga0111539_10004942
714 Ga0111539_10004955
715 Ga0111539_10010374
716 Ga0111539_10185923
717 Ga0105245_10016064
718 Ga0105245_10515179
719 Ga0105245_10639438
720 Ga0105247_10018501
721 Ga0105247_10117678
722 Ga0105247_10173347
723 Ga0114129_10004186
724 Ga0114129_10005981
725 Ga0114129_10009597
726 Ga0114129_10058938
727 Ga0114129_10085345
728 Ga0114129_10096389
729 Ga0114129_10257915
730 Ga0114129_10297810
731 Ga0114129_10336354
732 Ga0114129_10492899
733 Ga0114129_10865620
734 Ga0105243_10010908
735 Ga0105241_10364076
736 Ga0105242_10010337
737 Ga0105242_10042121
738 Ga0105242_10045440
739 Ga0105242_10107348
740 Ga0105242_10130133
741 Ga0105248_10024982
742 Ga0105248_10042730
743 Ga0105248_10300812
744 Ga0105248_10568931
745 Ga0105237_10332227
746 Ga0105238_10004828
747 Ga0105249_10002507
748 Ga0105249_10020271
749 Ga0105249_10062253
750 Ga0105246_10073847
751 Ga0105246_10080194
752 Ga0105246_10192571
753 Ga0157371_10140764
754 Ga0157374_10011588
755 Ga0157374_10016677
756 Ga0163162_10211358
757 Ga0157375_10089775
758 Ga0157375_10118563
759 Ga0157375_10356012
760 Ga0157375_10417964
761 Ga0163163_10002928
762 Ga0163163_10047304
763 Ga0163163_10060484
764 Ga0163163_10264747
765 Ga0157380_10001453
766 Ga0157380_10049766
767 Ga0157380_10062524
768 Ga0157380_10161451
769 Ga0157380_10189674
770 Ga0157380_10218842
771 Ga0157380_10484760
772 Ga0157377_10047446
773 Ga0157377_10091780
774 Ga0157379_10015365
775 Ga0157379_10185791
776 Ga0157376_10015281
777 Ga0207697_10001259
778 Ga0207697_10046928
779 Ga0207682_10000515
780 Ga0207682_10007609
781 Ga0207682_10037378
782 Ga0207682_10045552
783 Ga0207682_10075722
784 Ga0207642_10020254
785 Ga0207710_10094838
786 Ga0207688_10005305
787 Ga0207688_10052629
788 Ga0207688_10170278
789 Ga0207680_10088186
790 Ga0207680_10119175
791 Ga0207647_10090033
792 Ga0207645_10001344
793 Ga0207645_10023212
794 Ga0207645_10116982
795 Ga0207645_10142796
796 Ga0207684_10000032
797 Ga0207707_10035863
798 Ga0207662_10071798
799 Ga0207662_10087243
800 Ga0207662_10166145
801 Ga0207649_10032118
802 Ga0207646_10006382
803 Ga0207646_10011982
804 Ga0207681_10037963
805 Ga0207681_10042399
806 Ga0207681_10081300
807 Ga0207681_10129871
808 Ga0207694_10008452
809 Ga0207694_10173426
810 Ga0207650_10004606
811 Ga0207650_10023811
812 Ga0207659_10003092
813 Ga0207659_10006184
814 Ga0207659_10025079
815 Ga0207659_10025226
816 Ga0207659_10027648
817 Ga0207659_10127513
818 Ga0207659_10157649
819 Ga0207659_10189504
820 Ga0207659_10316313
821 Ga0207659_10390141
822 Ga0207644_10007527
823 Ga0207644_10047773
824 Ga0207706_10008207
825 Ga0207706_10039200
826 Ga0207706_10093057
827 Ga0207706_10125728
828 Ga0207686_10007457
829 Ga0207709_10022465
830 Ga0207670_10100973
831 Ga0207669_10020580
832 Ga0207669_10026906
833 Ga0207669_10032466
834 Ga0207669_10105101
835 Ga0207669_10113314
836 Ga0207669_10222793
837 Ga0207704_10009925
838 Ga0207704_10425633
839 Ga0207691_10010222
840 Ga0207691_10132868
841 Ga0207691_10147857
842 Ga0207691_10160067
843 Ga0207691_10306178
844 Ga0207711_10018657
845 Ga0207711_10026242
846 Ga0207711_10085190
847 Ga0207689_10002798
848 Ga0207689_10004573
849 Ga0207689_10100795
850 Ga0207661_10052471
851 Ga0207679_10115605
852 Ga0207679_10490363
853 Ga0207651_10000940
854 Ga0207651_10062980
855 Ga0207651_10083182
856 Ga0207651_10101513
857 Ga0207712_10161078
858 Ga0207712_10187012
859 Ga0207668_10082691
860 Ga0207668_10214358
861 Ga0207640_10010463
862 Ga0207640_10203165
863 Ga0207658_10047142
864 Ga0207677_10152000
865 Ga0207703_10012686
866 Ga0207703_10020179
867 Ga0207678_10017199
868 Ga0207708_10177574
869 Ga0207641_10096124
870 Ga0207648_10008023
871 Ga0207648_10015845
872 Ga0207648_10038883
873 Ga0207648_10176429
874 Ga0207648_10217237
875 Ga0207648_10355620
876 Ga0207648_10389173
877 Ga0207676_10058780
878 Ga0207676_10122812
879 Ga0207674_10227533
880 Ga0207675_100006490
881 Ga0207675_100017615
882 Ga0207675_100192602
883 Ga0207675_100225818
884 Ga0207675_100255966
885 Ga0207675_100407157
886 Ga0207683_10114889
887 Ga0207683_10456760
888 Ga0207698_10351311
889 Ga0207428_10000019
890 Ga0207428_10033621
891 Ga0207428_10050786
892 Ga0207428_10160769
893 Ga0268266_10297433
894 Ga0268265_10017626
895 Ga0268265_10211629
896 Ga0268265_10332600
897 Ga0268264_10016907
898 Ga0307408_100182401
899 Ga0307405_10014990
900 Ga0307413_10215250
901 Ga0307410_10052464
902 Ga0307410_10068742
903 Ga0307406_10002867
904 Ga0307407_10042845
905 Ga0307411_10013330
906 Ga0307411_10055459
907 Ga0373953_0071798
908 Ga0373943_0181584
909 Ga0373931_0006638
910 Ga0373937_0006221
911 Ga0373937_0030713
912 Ga0439453_0023828
913 Ga0439455_0032447
914 Ga0439446_0009915
915 Ga0451577_0256615
916 Ga0453683_0044835
917 Ga0451576_0009290
918 Ga0451576_0087786
919 Ga0451576_0171355
920 Ga0451576_0219689
921 Ga0451576_0239853
922 Ga0466967_0158648
923 Ga0495629_0094942
924 Ga0495651_0203305
925 Ga0495582_0124874
926 Ga0495643_0003923
927 Ga0495640_0080917
928 Ga0495598_0011330
929 Ga0495645_0223475
930 Ga0495656_0057471
931 Ga0495634_0022979
932 Ga0495635_0082811
933 Ga0495658_0017742
934 Ga0495674_0129361
935 Ga0495674_0133143
936 Ga0495684_0209095
937 Ga0495684_0299320
938 Ga0496101_0162249
939 Ga0496104_0165608
940 Ga0496104_0444950
941 Ga0496106_0291487
942 Ga0496109_0057451
943 Ga0496109_0161880
944 Ga0496114_0135039
945 Ga0501033_0056391
946 Ga0501034_0250082
947 Ga0501040_0003548
948 Ga0501042_0010714
949 Ga0501046_0016563
950 Ga0501047_0198926
951 Ga0501048_0322939
952 Ga0501070_0150511
953 Ga0501071_0002389
954 Ga0501071_0074047
955 Ga0501072_0021955
956 Ga0501073_0080234
957 Ga0501075_0119623
958 Ga0501076_0004183
959 Ga0501076_0193927
960 Ga0501079_0005205
961 Ga0501081_0000884
962 Ga0501044_0023245
963 Ga0501045_0003970
964 Ga0501045_0135759
965 nmdc:mga05p37_14012_c1
966 nmdc:mga05p37_174788_c1
967 nmdc:mga05p37_213158_c1
968 nmdc:mga05p37_24920_c1
969 nmdc:mga05p37_273668_c1
970 nmdc:mga05p37_302247_c1
971 nmdc:mga05p37_3060_c1
972 nmdc:mga05p37_460930_c1
973 nmdc:mga05p37_567132_c1
974 nmdc:mga09592_1788_c1
975 nmdc:mga09592_198361_c1
976 nmdc:mga09592_60874_c1
977 nmdc:mga0qj67_15253_c1
978 nmdc:mga0qj67_1720_c1
979 nmdc:mga0qj67_249725_c1
980 nmdc:mga0qj67_66439_c1
981 nmdc:mga06r32_1414_c1
982 nmdc:mga06r32_160790_c1
983 nmdc:mga06r32_172110_c1
984 nmdc:mga06r32_179510_c1
985 nmdc:mga06r32_36329_c1
986 nmdc:mga08y16_17_c1
987 nmdc:mga08y16_329533_c1
988 nmdc:mga08y16_52488_c1
989 nmdc:mga08y16_5403_c1
990 nmdc:mga0n895_34763_c1
991 nmdc:mga0n895_68124_c1
992 nmdc:mga0n895_71409_c1
993 nmdc:mga0n895_78101_c1
994 nmdc:mga0n895_80631_c1
995 nmdc:mga0n895_93937_c1
996 nmdc:mga0rr50_103393_c1
997 nmdc:mga0rr50_124715_c1
998 nmdc:mga0rr50_30176_c1
999 nmdc:mga0rr50_8043_c1
1000 nmdc:mga08x19_75114_c1
1001 nmdc:mga0a205_113824_c1
1002 nmdc:mga0a205_1162_c1
1003 nmdc:mga0a205_125667_c1
1004 nmdc:mga0a205_18755_c1
1005 nmdc:mga0a205_253123_c1
1006 nmdc:mga0a205_492085_c1
1007 Ga0495619_0037109
1008 Ga0501084_0002947
1009 Ga0501084_0449883
1010 Ga0590071_000054
1011 Ga0590071_010268
1012 Ga0590074_000038
1013 Ga0590075_000029
1014 Ga0590077_002763
1015 Ga0590077_008947
1016 Ga0501082_0007039
1017 Ga0501082_0065741
1018 Ga0530510_0009116
1019 Ga0530510_0036928
1020 Ga0530510_0185837

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

72

321

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g07-assembly1.cif.gz_a cryo-em structure of sq31f-bound mycobacterium smegmatis atp synthase fo region 0.7531 30 308
8g08-assembly1.cif.gz_a cryo-em structure of sq31f-bound mycobacterium smegmatis atp synthase rotational state 1 (backbone model) 0.752 30 308
8dbw-assembly1.cif.gz_a "e. coli atp synthase imaged in 10mm mgatp state3 ""down"" fo classified" 0.7481 43 308
7njp-assembly1.cif.gz_a mycobacterium smegmatis atp synthase state 2 0.7455 44 308
8g07-assembly1.cif.gz_a cryo-em structure of sq31f-bound mycobacterium smegmatis atp synthase fo region 0.7418 30 308
ID Description Score Start End Superfamily
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8058 113 311 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.7976 113 311 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.7689 116 311 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.7607 116 311 1.20.120.220
af_P00854_92_259_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.7264 115 308 1.20.120.220
ID Description Score Start End GO Terms
AF-A0A3N0ZRR3-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.8469 43 311 GO:0005886
GO:0016787
GO:0045263
GO:0046933
AF-A0A353BBY2-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.8332 49 311 GO:0005886
GO:0045263
GO:0046933
AF-A0A5Q3L7T8-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.8275 49 311 GO:0005886
GO:0045263
GO:0046933
AF-A0A2E8E836-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.8255 14 312 GO:0005886
GO:0042777
GO:0045263
GO:0046933
AF-A0A0S4QLG5-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.8236 44 311 GO:0005886
GO:0045263
GO:0046933

Map