F457246

General Info

Members Datasets Scaffolds Average Seq Length
511 212 1022 270

Family's Representative Sequence

Representative Sequence 3300005339|Ga0070660_100175305|Ga0070660_1001753052
Length 322
Sequence MRSGIVGSPFGPGARAVRRTDAGMVRFRNTARLDPSQVEDIRGRGPMRGLPGGGLTVGGXXLGLVGVLLYLVFAVLSGGGTDVNGPLGNLDGSTVSHGPPGQVLGRECRTGADANRRADCRIVGDINSIQAYWTSAFASGQYVPATTVFFTGSTSTGCGEASTDVGPFYCPVDKHVYIDLGFFDELKTRFGARGGPFAQAYVLAHEYGHHVQDLLGALGQRSQAQGAQGGSVRTELQADCYAGVWARHATQTGYLVGLTRADIADALNAAAAVGDDRIQAETQGQVDPETWTHGSSAERQHWFETGYSTGRPRACDTFHADL

Samples

Sample ID Description Type Environment
1 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
106 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
107 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
142 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
186 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
187 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.65
Metatranscriptomes 2.35
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 15.07
Rhizosphere 84.54
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070660_100175305 3300005339 Unclassified 1734
2 JGI25406J46586_10032409 3300003203 Bacteria 1942
3 Ga0070658_10009214 3300005327 Bacteria 7936
4 Ga0070658_10010471 3300005327 Bacteria 7440
5 Ga0070658_10011680 3300005327 Bacteria 7044
6 Ga0070658_10192794 3300005327 Bacteria 1718
7 Ga0070683_100007973 3300005329 Bacteria 8985
8 Ga0070683_100015753 3300005329 Bacteria 6646
9 Ga0070683_100058978 3300005329 Bacteria 3566
10 Ga0070683_100078128 3300005329 Bacteria 3095
11 Ga0070683_100187125 3300005329 Bacteria 1966
12 Ga0068869_100104537 3300005334 Bacteria 2147
13 Ga0070680_100004037 3300005336 Bacteria 10977
14 Ga0070680_100052035 3300005336 Bacteria 3343
15 Ga0070680_100190346 3300005336 Bacteria 1729
16 Ga0070680_100200736 3300005336 Bacteria 1682
17 Ga0070680_100258450 3300005336 Bacteria 1473
18 Ga0068868_100302949 3300005338 Bacteria 1358
19 Ga0070660_100006213 3300005339 Bacteria 8268
20 Ga0070660_100009678 3300005339 Bacteria 6789
21 Ga0070660_100037061 3300005339 Bacteria 3696
22 Ga0070660_100164414 3300005339 Bacteria 1790
23 Ga0070689_100290007 3300005340 Bacteria 1359
24 Ga0070661_100007123 3300005344 Bacteria 7712
25 Ga0070661_100040274 3300005344 Bacteria 3408
26 Ga0070661_100044722 3300005344 Bacteria 3235
27 Ga0070692_10055349 3300005345 Bacteria 2074
28 Ga0070659_100026115 3300005366 Bacteria 4492
29 Ga0070659_100133304 3300005366 Bacteria 2019
30 Ga0070659_100166617 3300005366 Unclassified 1803
31 Ga0070659_100488263 3300005366 Bacteria 1049
32 Ga0070714_100009829 3300005435 Bacteria 7540
33 Ga0070714_100090285 3300005435 Bacteria 2683
34 Ga0070714_100139898 3300005435 Bacteria 2171
35 Ga0070714_100402729 3300005435 Bacteria 1294
36 Ga0070714_100506462 3300005435 Bacteria 1152
37 Ga0070701_10033753 3300005438 Bacteria 2559
38 Ga0070711_100204721 3300005439 Bacteria 1525
39 Ga0070711_100257315 3300005439 Bacteria 1372
40 Ga0070694_100183099 3300005444 Bacteria 1550
41 Ga0070708_100000335 3300005445 Bacteria 35517
42 Ga0070708_100090887 3300005445 Bacteria 2780
43 Ga0070662_100088293 3300005457 Bacteria 2323
44 Ga0070681_10008977 3300005458 Bacteria 9830
45 Ga0070681_10030842 3300005458 Bacteria 5381
46 Ga0070681_10077995 3300005458 Bacteria 3269
47 Ga0070681_10130955 3300005458 Bacteria 2440
48 Ga0070681_10135694 3300005458 Bacteria 2392
49 Ga0070681_10171421 3300005458 Bacteria 2092
50 Ga0070681_10289025 3300005458 Bacteria 1549
51 Ga0068867_100279836 3300005459 Bacteria 1368
52 Ga0070706_100110468 3300005467 Bacteria 2558
53 Ga0070706_100117277 3300005467 Bacteria 2480
54 Ga0070707_100240752 3300005468 Bacteria 1761
55 Ga0070707_100251095 3300005468 Bacteria 1721
56 Ga0070698_100035380 3300005471 Bacteria 5165
57 Ga0070699_100177874 3300005518 Bacteria 1887
58 Ga0070679_100015432 3300005530 Bacteria 7342
59 Ga0070679_100034720 3300005530 Bacteria 4999
60 Ga0070679_100067414 3300005530 Bacteria 3569
61 Ga0070679_100152583 3300005530 Bacteria 2286
62 Ga0070679_100171097 3300005530 Bacteria 2145
63 Ga0070679_100262697 3300005530 Bacteria 1681
64 Ga0070684_100032617 3300005535 Bacteria 4440
65 Ga0070684_100066014 3300005535 Bacteria 3177
66 Ga0070684_100085362 3300005535 Bacteria 2800
67 Ga0070684_100105914 3300005535 Bacteria 2517
68 Ga0070684_100135381 3300005535 Bacteria 2225
69 Ga0070697_100107214 3300005536 Bacteria 2324
70 Ga0068853_100034382 3300005539 Bacteria 4302
71 Ga0068853_100096670 3300005539 Bacteria 2606
72 Ga0070672_100116712 3300005543 Bacteria 2181
73 Ga0070696_100266600 3300005546 Bacteria 1301
74 Ga0070693_100145075 3300005547 Bacteria 1498
75 Ga0070665_100032824 3300005548 Bacteria 5223
76 Ga0068855_100014350 3300005563 Bacteria 9539
77 Ga0068855_100045858 3300005563 Bacteria 5168
78 Ga0068855_100264978 3300005563 Bacteria 1913
79 Ga0068855_100412947 3300005563 Bacteria 1477
80 Ga0068855_100582224 3300005563 Bacteria 1209
81 Ga0070664_100281786 3300005564 Bacteria 1499
82 Ga0068857_100025995 3300005577 Bacteria 5156
83 Ga0068857_100142474 3300005577 Bacteria 2167
84 Ga0068857_100209137 3300005577 Bacteria 1780
85 Ga0068856_100074113 3300005614 Bacteria 3370
86 Ga0068856_100148263 3300005614 Bacteria 2354
87 Ga0070702_100065965 3300005615 Bacteria 2121
88 Ga0068861_100057636 3300005719 Bacteria 2967
89 Ga0068861_100106101 3300005719 Bacteria 2243
90 Ga0081540_1001919 3300005983 Bacteria 17424
91 Ga0081539_10002145 3300005985 Bacteria 29161
92 Ga0070717_10150791 3300006028 Bacteria 2011
93 Ga0097621_100293769 3300006237 Unclassified 1433
94 Ga0075428_100000551 3300006844 Bacteria 38313
95 Ga0075428_100219839 3300006844 Bacteria 2051
96 Ga0075430_100012249 3300006846 Bacteria 7298
97 Ga0075431_100002303 3300006847 Bacteria 18341
98 Ga0075433_10103829 3300006852 Bacteria 2518
99 Ga0075433_10387211 3300006852 Bacteria 1234
100 Ga0075434_100009214 3300006871 Bacteria 9195
101 Ga0075429_100000530 3300006880 Bacteria 28977
102 Ga0105240_10041735 3300009093 Bacteria 5851
103 Ga0105240_10486496 3300009093 Bacteria 1375
104 Ga0105240_10788778 3300009093 Bacteria 1030
105 Ga0105245_10007153 3300009098 Bacteria 9789
106 Ga0105245_10045306 3300009098 Bacteria 3928
107 Ga0105245_10079658 3300009098 Bacteria 2991
108 Ga0105245_10092174 3300009098 Bacteria 2790
109 Ga0105245_10231970 3300009098 Bacteria 1785
110 Ga0105245_10261572 3300009098 Bacteria 1684
111 Ga0114129_10010017 3300009147 Bacteria 13510
112 Ga0114129_10463133 3300009147 Bacteria 1661
113 Ga0105243_10056524 3300009148 Bacteria 3121
114 Ga0105242_10118648 3300009176 Bacteria 2266
115 Ga0105242_10205735 3300009176 Bacteria 1750
116 Ga0105242_10254483 3300009176 Bacteria 1584
117 Ga0105248_10093127 3300009177 Bacteria 3393
118 Ga0105248_10094835 3300009177 Bacteria 3360
119 Ga0105237_10013298 3300009545 Bacteria 8632
120 Ga0105238_10103742 3300009551 Bacteria 2825
121 Ga0105238_10139399 3300009551 Unclassified 2402
122 Ga0105238_10365878 3300009551 Bacteria 1432
123 Ga0105249_10005501 3300009553 Bacteria 10946
124 Ga0105239_10123451 3300010375 Bacteria 2877
125 Ga0105239_10130606 3300010375 Bacteria 2794
126 Ga0105239_10153627 3300010375 Bacteria 2569
127 Ga0105239_10178359 3300010375 Bacteria 2376
128 Ga0105239_10178452 3300010375 Bacteria 2376
129 Ga0105239_10190398 3300010375 Bacteria 2296
130 Ga0157370_10015349 3300013104 Bacteria 7787
131 Ga0157370_10079404 3300013104 Bacteria 3090
132 Ga0157370_10498837 3300013104 Bacteria 1118
133 Ga0157369_10027188 3300013105 Bacteria 6344
134 Ga0157369_10086241 3300013105 Bacteria 3353
135 Ga0157369_10623816 3300013105 Bacteria 1112
136 Ga0157374_10096625 3300013296 Bacteria 2825
137 Ga0157378_10035689 3300013297 Bacteria 4399
138 Ga0157378_10198348 3300013297 Bacteria 1897
139 Ga0157378_10409671 3300013297 Bacteria 1338
140 Ga0157372_10018459 3300013307 Bacteria 7497
141 Ga0157372_10064366 3300013307 Bacteria 4115
142 Ga0157372_10114529 3300013307 Bacteria 3091
143 Ga0157372_10220505 3300013307 Bacteria 2199
144 Ga0157372_10655915 3300013307 Bacteria 1222
145 Ga0157375_10033593 3300013308 Bacteria 4876
146 Ga0157375_10178457 3300013308 Bacteria 2275
147 Ga0163163_10447996 3300014325 Bacteria 1351
148 Ga0182008_10043418 3300014497 Bacteria 2238
149 Ga0157376_10029134 3300014969 Bacteria 4397
150 Ga0157376_10756512 3300014969 Bacteria 981
151 Ga0182007_10015482 3300015262 Bacteria 2842
152 Ga0206356_10008561 3300020070 Bacteria 4422
153 Ga0206356_11855320 3300020070 Bacteria 2047
154 Ga0206351_10689138 3300020077 Bacteria 1151
155 Ga0206350_10399325 3300020080 Bacteria 957
156 Ga0206354_10944405 3300020081 Bacteria 2210
157 Ga0206353_10021877 3300020082 Bacteria 4976
158 Ga0206353_10230525 3300020082 Bacteria 5962
159 Ga0206353_11855484 3300020082 Bacteria 4759
160 Ga0224712_10036196 3300022467 Bacteria 1827
161 Ga0224712_10053359 3300022467 Bacteria 1583
162 Ga0224712_10066650 3300022467 Bacteria 1450
163 Ga0224712_10070975 3300022467 Bacteria 1414
164 Ga0207705_10015411 3300025909 Bacteria 5485
165 Ga0207705_10020815 3300025909 Bacteria 4681
166 Ga0207684_10078931 3300025910 Bacteria 2800
167 Ga0207684_10132593 3300025910 Bacteria 2139
168 Ga0207684_10564363 3300025910 Bacteria 973
169 Ga0207707_10011148 3300025912 Bacteria 7820
170 Ga0207707_10012057 3300025912 Bacteria 7517
171 Ga0207707_10028270 3300025912 Bacteria 4902
172 Ga0207707_10057286 3300025912 Bacteria 3392
173 Ga0207695_10133140 3300025913 Bacteria 2442
174 Ga0207660_10025139 3300025917 Bacteria 4040
175 Ga0207660_10185532 3300025917 Bacteria 1617
176 Ga0207660_10285940 3300025917 Bacteria 1310
177 Ga0207657_10003370 3300025919 Bacteria 17079
178 Ga0207657_10007470 3300025919 Bacteria 11201
179 Ga0207657_10018289 3300025919 Bacteria 6700
180 Ga0207657_10026178 3300025919 Bacteria 5365
181 Ga0207657_10073444 3300025919 Bacteria 2890
182 Ga0207657_10110515 3300025919 Bacteria 2270
183 Ga0207657_10250512 3300025919 Bacteria 1412
184 Ga0207649_10007027 3300025920 Bacteria 6115
185 Ga0207649_10058745 3300025920 Bacteria 2410
186 Ga0207652_10024144 3300025921 Bacteria 5042
187 Ga0207652_10029116 3300025921 Bacteria 4614
188 Ga0207652_10085073 3300025921 Bacteria 2771
189 Ga0207652_10133902 3300025921 Bacteria 2212
190 Ga0207652_10283547 3300025921 Bacteria 1494
191 Ga0207646_10131444 3300025922 Bacteria 2253
192 Ga0207694_10184637 3300025924 Bacteria 1692
193 Ga0207694_10307716 3300025924 Bacteria 1306
194 Ga0207687_10034126 3300025927 Bacteria 3454
195 Ga0207687_10070110 3300025927 Bacteria 2502
196 Ga0207687_10097150 3300025927 Bacteria 2160
197 Ga0207687_10228172 3300025927 Bacteria 1470
198 Ga0207687_10241584 3300025927 Bacteria 1431
199 Ga0207700_10179700 3300025928 Bacteria 1771
200 Ga0207664_10071202 3300025929 Bacteria 2800
201 Ga0207664_10072262 3300025929 Bacteria 2781
202 Ga0207664_10088005 3300025929 Bacteria 2540
203 Ga0207664_10236274 3300025929 Bacteria 1590
204 Ga0207690_10021267 3300025932 Bacteria 4021
205 Ga0207706_10001859 3300025933 Bacteria 20681
206 Ga0207706_10046617 3300025933 Bacteria 3838
207 Ga0207706_10108754 3300025933 Bacteria 2440
208 Ga0207706_10118479 3300025933 Bacteria 2328
209 Ga0207661_10009491 3300025944 Bacteria 6981
210 Ga0207661_10071527 3300025944 Bacteria 2835
211 Ga0207661_10075017 3300025944 Bacteria 2774
212 Ga0207661_10086375 3300025944 Bacteria 2603
213 Ga0207661_10332022 3300025944 Bacteria 1369
214 Ga0207679_10182923 3300025945 Bacteria 1735
215 Ga0207679_10326312 3300025945 Bacteria 1331
216 Ga0207679_10635879 3300025945 Bacteria 964
217 Ga0207667_10031916 3300025949 Bacteria 5681
218 Ga0207667_10047893 3300025949 Bacteria 4521
219 Ga0207667_10068117 3300025949 Bacteria 3707
220 Ga0207667_10090334 3300025949 Bacteria 3165
221 Ga0207667_10098057 3300025949 Bacteria 3024
222 Ga0207667_10382423 3300025949 Bacteria 1434
223 Ga0207712_10011303 3300025961 Bacteria 5683
224 Ga0207703_10291010 3300026035 Bacteria 1486
225 Ga0207639_10025421 3300026041 Bacteria 4293
226 Ga0207678_10095423 3300026067 Bacteria 2542
227 Ga0207702_10060671 3300026078 Bacteria 3224
228 Ga0207702_10099999 3300026078 Bacteria 2558
229 Ga0207641_10514331 3300026088 Bacteria 1164
230 Ga0207648_10326818 3300026089 Bacteria 1379
231 Ga0207674_10033971 3300026116 Bacteria 5334
232 Ga0207674_10106206 3300026116 Bacteria 2786
233 Ga0207674_10172976 3300026116 Bacteria 2113
234 Ga0207674_10220463 3300026116 Bacteria 1845
235 Ga0207675_100012292 3300026118 Bacteria 7999
236 Ga0207683_10137587 3300026121 Bacteria 2199
237 Ga0207698_10018563 3300026142 Bacteria 4742
238 Ga0207428_10127339 3300027907 Bacteria 1950
239 Ga0268266_10123308 3300028379 Bacteria 2308
240 Ga0373926_0028862 3300035083 Bacteria 1949
241 Ga0373944_0056312 3300035089 Bacteria 1251
242 Ga0373936_0029911 3300035113 Bacteria 2147
243 Ga0373945_0012101 3300035116 Bacteria 2861
244 Ga0373945_0032023 3300035116 Bacteria 1861
245 Ga0373943_0000090 3300035170 Bacteria 33196
246 Ga0373943_0009647 3300035170 Bacteria 4325
247 Ga0373943_0025373 3300035170 Bacteria 2770
248 Ga0373943_0109703 3300035170 Bacteria 1454
249 Ga0373935_0061305 3300035692 Bacteria 2408
250 Ga0373935_0078076 3300035692 Bacteria 2147
251 Ga0373947_0000266 3300035725 Bacteria 29609
252 Ga0373947_0000387 3300035725 Bacteria 24881
253 Ga0373947_0002409 3300035725 Bacteria 11298
254 Ga0373947_0007306 3300035725 Bacteria 6397
255 Ga0373937_0285886 3300036401 Bacteria 1558
256 Ga0373925_0001866 3300037068 Bacteria 17533
257 Ga0373925_0104705 3300037068 Bacteria 2179
258 Ga0395899_0006189 3300037312 Bacteria 9270
259 Ga0395899_0054588 3300037312 Bacteria 2956
260 Ga0395900_0006377 3300037418 Bacteria 12299
261 Ga0395900_0011480 3300037418 Bacteria 9068
262 Ga0395900_0018083 3300037418 Bacteria 7194
263 Ga0395900_0119424 3300037418 Bacteria 2706
264 Ga0395900_0152183 3300037418 Bacteria 2363
265 Ga0395898_0005043 3300037466 Bacteria 14316
266 Ga0395898_0007114 3300037466 Bacteria 11880
267 Ga0395898_0023779 3300037466 Bacteria 6187
268 Ga0395898_0035123 3300037466 Bacteria 4989
269 Ga0395898_0117053 3300037466 Bacteria 2553
270 Ga0395898_0117363 3300037466 Bacteria 2550
271 Ga0395898_0136030 3300037466 Bacteria 2353
272 Ga0395898_0143798 3300037466 Bacteria 2283
273 Ga0395898_0159074 3300037466 Bacteria 2160
274 Ga0395898_0301606 3300037466 Bacteria 1528
275 Ga0395905_0006497 3300037471 Bacteria 11762
276 Ga0395905_0010677 3300037471 Bacteria 8906
277 Ga0395905_0013723 3300037471 Bacteria 7756
278 Ga0395905_0087320 3300037471 Bacteria 2924
279 Ga0395901_0003190 3300038443 Bacteria 16503
280 Ga0395901_0011791 3300038443 Bacteria 8863
281 Ga0395901_0012870 3300038443 Bacteria 8484
282 Ga0395901_0030172 3300038443 Bacteria 5586
283 Ga0395901_0095874 3300038443 Bacteria 3109
284 Ga0395901_0103960 3300038443 Bacteria 2980
285 Ga0395901_0115559 3300038443 Bacteria 2818
286 Ga0395901_0167880 3300038443 Bacteria 2303
287 Ga0395901_0330018 3300038443 Bacteria 1577
288 Ga0451853_3379868 3300041512 Bacteria 2660
289 Ga0439448_0049524 3300042005 Bacteria 1373
290 Ga0466965_0167548 3300044683 Bacteria 1154
291 Ga0466966_0020929 3300044684 Bacteria 4300
292 Ga0466966_0137515 3300044684 Bacteria 1493
293 Ga0466966_0138528 3300044684 Bacteria 1488
294 Ga0466961_0067827 3300044693 Bacteria 2266
295 Ga0466961_0081392 3300044693 Bacteria 2049
296 Ga0466961_0252533 3300044693 Bacteria 1083
297 Ga0466963_0000247 3300044694 Bacteria 23573
298 Ga0466963_0000348 3300044694 Bacteria 20961
299 Ga0466963_0002559 3300044694 Bacteria 10196
300 Ga0466963_0006026 3300044694 Bacteria 7144
301 Ga0466963_0034819 3300044694 Bacteria 3278
302 Ga0466963_0069038 3300044694 Bacteria 2374
303 Ga0466963_0114421 3300044694 Bacteria 1853
304 Ga0466963_0200000 3300044694 Bacteria 1397
305 Ga0466963_0218601 3300044694 Bacteria 1334
306 Ga0466964_0004470 3300044706 Bacteria 5165
307 Ga0466964_0029076 3300044706 Bacteria 2180
308 Ga0466964_0058419 3300044706 Bacteria 1599
309 Ga0466964_0158188 3300044706 Bacteria 1057
310 Ga0466971_0051289 3300044719 Bacteria 1857
311 Ga0466971_0108130 3300044719 Bacteria 1282
312 Ga0466971_0137941 3300044719 Bacteria 1135
313 Ga0466971_0182861 3300044719 Bacteria 986
314 Ga0466968_0070078 3300044735 Bacteria 1525
315 Ga0466970_0123659 3300044765 Bacteria 1418
316 Ga0466957_0003783 3300044842 Bacteria 8361
317 Ga0466957_0028551 3300044842 Bacteria 3323
318 Ga0466957_0033991 3300044842 Bacteria 3058
319 Ga0466957_0069985 3300044842 Bacteria 2168
320 Ga0466959_0001507 3300045049 Bacteria 14288
321 Ga0466958_0042403 3300045836 Bacteria 2740
322 Ga0466958_0126450 3300045836 Bacteria 1603
323 Ga0466958_0187524 3300045836 Bacteria 1314
324 Ga0466967_0003697 3300045976 Bacteria 10075
325 Ga0466967_0004393 3300045976 Bacteria 9495
326 Ga0466967_0008248 3300045976 Bacteria 7608
327 Ga0466967_0010670 3300045976 Bacteria 6907
328 Ga0466967_0019689 3300045976 Bacteria 5434
329 Ga0466967_0035669 3300045976 Bacteria 4236
330 Ga0466967_0036835 3300045976 Bacteria 4180
331 Ga0466967_0048310 3300045976 Bacteria 3715
332 Ga0466967_0074805 3300045976 Bacteria 3043
333 Ga0466967_0086246 3300045976 Bacteria 2844
334 Ga0466967_0114816 3300045976 Bacteria 2479
335 Ga0466967_0125867 3300045976 Bacteria 2373
336 Ga0466967_0170827 3300045976 Bacteria 2045
337 Ga0466967_0178699 3300045976 Bacteria 2000
338 Ga0466967_0208458 3300045976 Bacteria 1853
339 Ga0466967_0334832 3300045976 Bacteria 1462
340 Ga0466967_0638803 3300045976 Bacteria 1052
341 Ga0466967_0647702 3300045976 Bacteria 1044
342 Ga0495592_0121393 3300046454 Bacteria 1838
343 Ga0495603_0000339 3300046455 Bacteria 25130
344 Ga0495603_0032371 3300046455 Bacteria 3146
345 Ga0495603_0044212 3300046455 Bacteria 2658
346 Ga0495629_0002088 3300046459 Bacteria 15500
347 Ga0495641_0001321 3300046461 Bacteria 21234
348 Ga0495651_0024849 3300046462 Bacteria 4661
349 Ga0495653_0032140 3300046463 Bacteria 4170
350 Ga0495653_0067983 3300046463 Bacteria 2673
351 Ga0495580_0165135 3300046472 Bacteria 1531
352 Ga0495582_0136037 3300046473 Bacteria 1390
353 Ga0495584_0263761 3300046491 Bacteria 876
354 Ga0495594_0027397 3300046499 Bacteria 3071
355 Ga0495608_0083158 3300046511 Bacteria 2078
356 Ga0495628_0145727 3300046516 Bacteria 1805
357 Ga0495630_0018810 3300046517 Bacteria 5077
358 Ga0495666_0016257 3300046526 Bacteria 3706
359 Ga0495652_0114950 3300046529 Bacteria 2158
360 Ga0495665_0000215 3300046531 Bacteria 29257
361 Ga0495665_0069672 3300046531 Bacteria 1854
362 Ga0495665_0122282 3300046531 Bacteria 1363
363 Ga0495640_0196232 3300046533 Bacteria 1281
364 Ga0495586_0144872 3300046535 Bacteria 1335
365 Ga0495587_0076399 3300046536 Bacteria 1945
366 Ga0495587_0154819 3300046536 Bacteria 1306
367 Ga0495645_0026487 3300046543 Bacteria 4209
368 Ga0495667_0059502 3300046559 Bacteria 2507
369 Ga0495656_0008529 3300046615 Bacteria 3661
370 Ga0495634_0038744 3300046642 Bacteria 3248
371 Ga0495635_0037192 3300046663 Bacteria 3370
372 Ga0495661_0218380 3300046665 Bacteria 989
373 Ga0495588_0000863 3300046674 Bacteria 13378
374 Ga0495599_0070766 3300046678 Bacteria 2177
375 Ga0495599_0174961 3300046678 Bacteria 1324
376 Ga0495646_0079501 3300046680 Bacteria 1914
377 Ga0495658_0002471 3300046683 Bacteria 9310
378 Ga0495658_0074516 3300046683 Bacteria 1978
379 Ga0495658_0124774 3300046683 Bacteria 1561
380 Ga0495658_0248337 3300046683 Bacteria 1119
381 Ga0495613_0003963 3300046689 Bacteria 11089
382 Ga0495613_0163754 3300046689 Bacteria 1581
383 Ga0495624_0009874 3300046690 Bacteria 6602
384 Ga0495581_0009890 3300047315 Bacteria 5517
385 Ga0495674_0034205 3300047319 Bacteria 4596
386 Ga0495674_0318205 3300047319 Bacteria 1268
387 Ga0495676_0000942 3300047321 Bacteria 24422
388 Ga0495676_0043333 3300047321 Bacteria 3685
389 Ga0495676_0062632 3300047321 Bacteria 2903
390 Ga0495680_0005597 3300047322 Bacteria 11781
391 Ga0495680_0013355 3300047322 Bacteria 7170
392 Ga0495684_0010019 3300047471 Bacteria 7327
393 Ga0495684_0196794 3300047471 Bacteria 1487
394 Ga0495593_0001317 3300047673 Bacteria 14550
395 Ga0495614_0004961 3300048089 Bacteria 6006
396 Ga0496100_0008880 3300048903 Bacteria 5623
397 Ga0496100_0134639 3300048903 Bacteria 1744
398 Ga0496100_0179828 3300048903 Bacteria 1529
399 Ga0496101_0008544 3300048904 Bacteria 6691
400 Ga0496101_0088087 3300048904 Bacteria 2305
401 Ga0496101_0108128 3300048904 Bacteria 2090
402 Ga0496101_0458117 3300048904 Bacteria 1006
403 Ga0496102_0001674 3300048905 Bacteria 19466
404 Ga0496102_0123628 3300048905 Bacteria 2418
405 Ga0496102_0176394 3300048905 Bacteria 2012
406 Ga0496102_0225291 3300048905 Bacteria 1768
407 Ga0496102_0639632 3300048905 Bacteria 987
408 Ga0496103_0036541 3300048906 Bacteria 3008
409 Ga0496103_0153514 3300048906 Bacteria 1475
410 Ga0496104_0002528 3300048907 Bacteria 15757
411 Ga0496104_0007540 3300048907 Bacteria 9621
412 Ga0496104_0017150 3300048907 Bacteria 6588
413 Ga0496104_0017255 3300048907 Bacteria 6570
414 Ga0496104_0164457 3300048907 Bacteria 2128
415 Ga0496104_0187414 3300048907 Bacteria 1980
416 Ga0496104_0666473 3300048907 Bacteria 949
417 Ga0496105_0000143 3300048908 Bacteria 47026
418 Ga0496105_0001400 3300048908 Bacteria 16942
419 Ga0496105_0057634 3300048908 Bacteria 3207
420 Ga0496105_0105208 3300048908 Bacteria 2330
421 Ga0496105_0137787 3300048908 Bacteria 2010
422 Ga0496105_0146187 3300048908 Bacteria 1944
423 Ga0496105_0437340 3300048908 Bacteria 1034
424 Ga0496106_0040919 3300048909 Bacteria 3472
425 Ga0496107_0062899 3300048910 Bacteria 2689
426 Ga0496107_0087280 3300048910 Bacteria 2277
427 Ga0496107_0109338 3300048910 Unclassified 2031
428 Ga0496108_0000358 3300048911 Bacteria 38553
429 Ga0496108_0025607 3300048911 Bacteria 4863
430 Ga0496108_0048175 3300048911 Bacteria 3562
431 Ga0496108_0098178 3300048911 Bacteria 2496
432 Ga0496108_0369129 3300048911 Bacteria 1253
433 Ga0496109_0000728 3300048912 Bacteria 27411
434 Ga0496109_0001613 3300048912 Bacteria 18839
435 Ga0496109_0030011 3300048912 Bacteria 4872
436 Ga0496109_0054479 3300048912 Bacteria 3648
437 Ga0496109_0071425 3300048912 Bacteria 3187
438 Ga0496109_0276853 3300048912 Bacteria 1581
439 Ga0496109_0395492 3300048912 Bacteria 1306
440 Ga0496109_0411625 3300048912 Unclassified 1277
441 Ga0496109_0552133 3300048912 Bacteria 1087
442 Ga0496110_0024457 3300048913 Bacteria 5147
443 Ga0496110_0077471 3300048913 Bacteria 2958
444 Ga0496110_0163982 3300048913 Bacteria 2015
445 Ga0496110_0268524 3300048913 Bacteria 1553
446 Ga0496110_0522573 3300048913 Bacteria 1080
447 Ga0496110_0557767 3300048913 Bacteria 1041
448 Ga0496111_0000280 3300048914 Bacteria 24699
449 Ga0496111_0053865 3300048914 Bacteria 2907
450 Ga0496111_0075877 3300048914 Bacteria 2450
451 Ga0496111_0208495 3300048914 Bacteria 1452
452 Ga0496111_0298955 3300048914 Bacteria 1193
453 Ga0496112_0000247 3300048915 Bacteria 34526
454 Ga0496112_0026222 3300048915 Bacteria 5605
455 Ga0496112_0035238 3300048915 Bacteria 4873
456 Ga0496112_0051598 3300048915 Bacteria 4034
457 Ga0496112_0070130 3300048915 Bacteria 3463
458 Ga0496112_0159091 3300048915 Bacteria 2225
459 Ga0496112_0271354 3300048915 Bacteria 1645
460 Ga0496113_0000870 3300048916 Bacteria 15818
461 Ga0496113_0044401 3300048916 Bacteria 3292
462 Ga0496113_0070677 3300048916 Bacteria 2654
463 Ga0496113_0340430 3300048916 Bacteria 1203
464 Ga0496114_0003987 3300048917 Bacteria 11399
465 Ga0496114_0072910 3300048917 Bacteria 2889
466 Ga0496114_0097844 3300048917 Bacteria 2500
467 Ga0496114_0144586 3300048917 Bacteria 2061
468 Ga0496114_0169796 3300048917 Bacteria 1900
469 Ga0496115_0005222 3300048918 Bacteria 9440
470 Ga0496115_0013067 3300048918 Bacteria 6270
471 Ga0496115_0071737 3300048918 Bacteria 2809
472 Ga0496115_0253291 3300048918 Bacteria 1449
473 Ga0501036_0216846 3300049572 Bacteria 1607
474 Ga0501041_0040969 3300049577 Bacteria 2813
475 Ga0501042_0139145 3300049578 Bacteria 1750
476 Ga0501067_0014472 3300049583 Bacteria 4367
477 Ga0501067_0116387 3300049583 Bacteria 1487
478 Ga0501068_0017240 3300049584 Bacteria 4175
479 Ga0501069_0000038 3300049585 Bacteria 82519
480 Ga0501069_0003795 3300049585 Bacteria 7773
481 Ga0501069_0015500 3300049585 Bacteria 4086
482 Ga0501070_0000008 3300049586 Bacteria 199963
483 Ga0501071_0057177 3300049587 Bacteria 2818
484 Ga0501071_0063805 3300049587 Bacteria 2672
485 Ga0501072_0013287 3300049588 Bacteria 6304
486 Ga0501072_0048944 3300049588 Bacteria 3327
487 Ga0501072_0078000 3300049588 Bacteria 2623
488 Ga0501077_0338095 3300049593 Bacteria 960
489 Ga0501079_0204948 3300049741 Bacteria 1540
490 Ga0501080_0002411 3300049742 Bacteria 16315
491 nmdc:mga0yw44_59223_c1 3300050492 Bacteria 2342
492 nmdc:mga05p37_209898_c1 3300050507 Bacteria 2354
493 nmdc:mga05p37_736_c1 3300050507 Bacteria 36292
494 nmdc:mga09592_8565_c1 3300050508 Bacteria 8319
495 nmdc:mga0qj67_14786_c1 3300050509 Bacteria 5901
496 nmdc:mga06r32_696_c1 3300050510 Bacteria 29344
497 nmdc:mga0n895_11224_c1 3300050512 Bacteria 7980
498 nmdc:mga0n895_429936_c1 3300050512 Bacteria 1334
499 nmdc:mga0rr50_93295_c1 3300050513 Bacteria 2348
500 nmdc:mga0a205_102762_c1 3300050515 Bacteria 2756
501 nmdc:mga0a205_277173_c1 3300050515 Bacteria 1553
502 Ga0495601_0059411 3300053077 Bacteria 2424
503 Ga0495612_0042470 3300053078 Bacteria 1856
504 Ga0495595_0006454 3300053084 Bacteria 4785
505 Ga0495595_0175656 3300053084 Bacteria 1061
506 Ga0495619_0038770 3300053085 Bacteria 3108
507 Ga0495619_0238198 3300053085 Bacteria 1261
508 Ga0501082_0465383 3300060353 Bacteria 1105
509 Ga0530510_0010159 3300061734 Bacteria 6598
510 Ga0530510_0016282 3300061734 Bacteria 5259
511 Ga0530510_0030674 3300061734 Bacteria 3863
512 Ga0070660_100175305
513 JGI25406J46586_10032409
514 Ga0070658_10009214
515 Ga0070658_10010471
516 Ga0070658_10011680
517 Ga0070658_10192794
518 Ga0070683_100007973
519 Ga0070683_100015753
520 Ga0070683_100058978
521 Ga0070683_100078128
522 Ga0070683_100187125
523 Ga0068869_100104537
524 Ga0070680_100004037
525 Ga0070680_100052035
526 Ga0070680_100190346
527 Ga0070680_100200736
528 Ga0070680_100258450
529 Ga0068868_100302949
530 Ga0070660_100006213
531 Ga0070660_100009678
532 Ga0070660_100037061
533 Ga0070660_100164414
534 Ga0070689_100290007
535 Ga0070661_100007123
536 Ga0070661_100040274
537 Ga0070661_100044722
538 Ga0070692_10055349
539 Ga0070659_100026115
540 Ga0070659_100133304
541 Ga0070659_100166617
542 Ga0070659_100488263
543 Ga0070714_100009829
544 Ga0070714_100090285
545 Ga0070714_100139898
546 Ga0070714_100402729
547 Ga0070714_100506462
548 Ga0070701_10033753
549 Ga0070711_100204721
550 Ga0070711_100257315
551 Ga0070694_100183099
552 Ga0070708_100000335
553 Ga0070708_100090887
554 Ga0070662_100088293
555 Ga0070681_10008977
556 Ga0070681_10030842
557 Ga0070681_10077995
558 Ga0070681_10130955
559 Ga0070681_10135694
560 Ga0070681_10171421
561 Ga0070681_10289025
562 Ga0068867_100279836
563 Ga0070706_100110468
564 Ga0070706_100117277
565 Ga0070707_100240752
566 Ga0070707_100251095
567 Ga0070698_100035380
568 Ga0070699_100177874
569 Ga0070679_100015432
570 Ga0070679_100034720
571 Ga0070679_100067414
572 Ga0070679_100152583
573 Ga0070679_100171097
574 Ga0070679_100262697
575 Ga0070684_100032617
576 Ga0070684_100066014
577 Ga0070684_100085362
578 Ga0070684_100105914
579 Ga0070684_100135381
580 Ga0070697_100107214
581 Ga0068853_100034382
582 Ga0068853_100096670
583 Ga0070672_100116712
584 Ga0070696_100266600
585 Ga0070693_100145075
586 Ga0070665_100032824
587 Ga0068855_100014350
588 Ga0068855_100045858
589 Ga0068855_100264978
590 Ga0068855_100412947
591 Ga0068855_100582224
592 Ga0070664_100281786
593 Ga0068857_100025995
594 Ga0068857_100142474
595 Ga0068857_100209137
596 Ga0068856_100074113
597 Ga0068856_100148263
598 Ga0070702_100065965
599 Ga0068861_100057636
600 Ga0068861_100106101
601 Ga0081540_1001919
602 Ga0081539_10002145
603 Ga0070717_10150791
604 Ga0097621_100293769
605 Ga0075428_100000551
606 Ga0075428_100219839
607 Ga0075430_100012249
608 Ga0075431_100002303
609 Ga0075433_10103829
610 Ga0075433_10387211
611 Ga0075434_100009214
612 Ga0075429_100000530
613 Ga0105240_10041735
614 Ga0105240_10486496
615 Ga0105240_10788778
616 Ga0105245_10007153
617 Ga0105245_10045306
618 Ga0105245_10079658
619 Ga0105245_10092174
620 Ga0105245_10231970
621 Ga0105245_10261572
622 Ga0114129_10010017
623 Ga0114129_10463133
624 Ga0105243_10056524
625 Ga0105242_10118648
626 Ga0105242_10205735
627 Ga0105242_10254483
628 Ga0105248_10093127
629 Ga0105248_10094835
630 Ga0105237_10013298
631 Ga0105238_10103742
632 Ga0105238_10139399
633 Ga0105238_10365878
634 Ga0105249_10005501
635 Ga0105239_10123451
636 Ga0105239_10130606
637 Ga0105239_10153627
638 Ga0105239_10178359
639 Ga0105239_10178452
640 Ga0105239_10190398
641 Ga0157370_10015349
642 Ga0157370_10079404
643 Ga0157370_10498837
644 Ga0157369_10027188
645 Ga0157369_10086241
646 Ga0157369_10623816
647 Ga0157374_10096625
648 Ga0157378_10035689
649 Ga0157378_10198348
650 Ga0157378_10409671
651 Ga0157372_10018459
652 Ga0157372_10064366
653 Ga0157372_10114529
654 Ga0157372_10220505
655 Ga0157372_10655915
656 Ga0157375_10033593
657 Ga0157375_10178457
658 Ga0163163_10447996
659 Ga0182008_10043418
660 Ga0157376_10029134
661 Ga0157376_10756512
662 Ga0182007_10015482
663 Ga0206356_10008561
664 Ga0206356_11855320
665 Ga0206351_10689138
666 Ga0206350_10399325
667 Ga0206354_10944405
668 Ga0206353_10021877
669 Ga0206353_10230525
670 Ga0206353_11855484
671 Ga0224712_10036196
672 Ga0224712_10053359
673 Ga0224712_10066650
674 Ga0224712_10070975
675 Ga0207705_10015411
676 Ga0207705_10020815
677 Ga0207684_10078931
678 Ga0207684_10132593
679 Ga0207684_10564363
680 Ga0207707_10011148
681 Ga0207707_10012057
682 Ga0207707_10028270
683 Ga0207707_10057286
684 Ga0207695_10133140
685 Ga0207660_10025139
686 Ga0207660_10185532
687 Ga0207660_10285940
688 Ga0207657_10003370
689 Ga0207657_10007470
690 Ga0207657_10018289
691 Ga0207657_10026178
692 Ga0207657_10073444
693 Ga0207657_10110515
694 Ga0207657_10250512
695 Ga0207649_10007027
696 Ga0207649_10058745
697 Ga0207652_10024144
698 Ga0207652_10029116
699 Ga0207652_10085073
700 Ga0207652_10133902
701 Ga0207652_10283547
702 Ga0207646_10131444
703 Ga0207694_10184637
704 Ga0207694_10307716
705 Ga0207687_10034126
706 Ga0207687_10070110
707 Ga0207687_10097150
708 Ga0207687_10228172
709 Ga0207687_10241584
710 Ga0207700_10179700
711 Ga0207664_10071202
712 Ga0207664_10072262
713 Ga0207664_10088005
714 Ga0207664_10236274
715 Ga0207690_10021267
716 Ga0207706_10001859
717 Ga0207706_10046617
718 Ga0207706_10108754
719 Ga0207706_10118479
720 Ga0207661_10009491
721 Ga0207661_10071527
722 Ga0207661_10075017
723 Ga0207661_10086375
724 Ga0207661_10332022
725 Ga0207679_10182923
726 Ga0207679_10326312
727 Ga0207679_10635879
728 Ga0207667_10031916
729 Ga0207667_10047893
730 Ga0207667_10068117
731 Ga0207667_10090334
732 Ga0207667_10098057
733 Ga0207667_10382423
734 Ga0207712_10011303
735 Ga0207703_10291010
736 Ga0207639_10025421
737 Ga0207678_10095423
738 Ga0207702_10060671
739 Ga0207702_10099999
740 Ga0207641_10514331
741 Ga0207648_10326818
742 Ga0207674_10033971
743 Ga0207674_10106206
744 Ga0207674_10172976
745 Ga0207674_10220463
746 Ga0207675_100012292
747 Ga0207683_10137587
748 Ga0207698_10018563
749 Ga0207428_10127339
750 Ga0268266_10123308
751 Ga0373926_0028862
752 Ga0373944_0056312
753 Ga0373936_0029911
754 Ga0373945_0012101
755 Ga0373945_0032023
756 Ga0373943_0000090
757 Ga0373943_0009647
758 Ga0373943_0025373
759 Ga0373943_0109703
760 Ga0373935_0061305
761 Ga0373935_0078076
762 Ga0373947_0000266
763 Ga0373947_0000387
764 Ga0373947_0002409
765 Ga0373947_0007306
766 Ga0373937_0285886
767 Ga0373925_0001866
768 Ga0373925_0104705
769 Ga0395899_0006189
770 Ga0395899_0054588
771 Ga0395900_0006377
772 Ga0395900_0011480
773 Ga0395900_0018083
774 Ga0395900_0119424
775 Ga0395900_0152183
776 Ga0395898_0005043
777 Ga0395898_0007114
778 Ga0395898_0023779
779 Ga0395898_0035123
780 Ga0395898_0117053
781 Ga0395898_0117363
782 Ga0395898_0136030
783 Ga0395898_0143798
784 Ga0395898_0159074
785 Ga0395898_0301606
786 Ga0395905_0006497
787 Ga0395905_0010677
788 Ga0395905_0013723
789 Ga0395905_0087320
790 Ga0395901_0003190
791 Ga0395901_0011791
792 Ga0395901_0012870
793 Ga0395901_0030172
794 Ga0395901_0095874
795 Ga0395901_0103960
796 Ga0395901_0115559
797 Ga0395901_0167880
798 Ga0395901_0330018
799 Ga0451853_3379868
800 Ga0439448_0049524
801 Ga0466965_0167548
802 Ga0466966_0020929
803 Ga0466966_0137515
804 Ga0466966_0138528
805 Ga0466961_0067827
806 Ga0466961_0081392
807 Ga0466961_0252533
808 Ga0466963_0000247
809 Ga0466963_0000348
810 Ga0466963_0002559
811 Ga0466963_0006026
812 Ga0466963_0034819
813 Ga0466963_0069038
814 Ga0466963_0114421
815 Ga0466963_0200000
816 Ga0466963_0218601
817 Ga0466964_0004470
818 Ga0466964_0029076
819 Ga0466964_0058419
820 Ga0466964_0158188
821 Ga0466971_0051289
822 Ga0466971_0108130
823 Ga0466971_0137941
824 Ga0466971_0182861
825 Ga0466968_0070078
826 Ga0466970_0123659
827 Ga0466957_0003783
828 Ga0466957_0028551
829 Ga0466957_0033991
830 Ga0466957_0069985
831 Ga0466959_0001507
832 Ga0466958_0042403
833 Ga0466958_0126450
834 Ga0466958_0187524
835 Ga0466967_0003697
836 Ga0466967_0004393
837 Ga0466967_0008248
838 Ga0466967_0010670
839 Ga0466967_0019689
840 Ga0466967_0035669
841 Ga0466967_0036835
842 Ga0466967_0048310
843 Ga0466967_0074805
844 Ga0466967_0086246
845 Ga0466967_0114816
846 Ga0466967_0125867
847 Ga0466967_0170827
848 Ga0466967_0178699
849 Ga0466967_0208458
850 Ga0466967_0334832
851 Ga0466967_0638803
852 Ga0466967_0647702
853 Ga0495592_0121393
854 Ga0495603_0000339
855 Ga0495603_0032371
856 Ga0495603_0044212
857 Ga0495629_0002088
858 Ga0495641_0001321
859 Ga0495651_0024849
860 Ga0495653_0032140
861 Ga0495653_0067983
862 Ga0495580_0165135
863 Ga0495582_0136037
864 Ga0495584_0263761
865 Ga0495594_0027397
866 Ga0495608_0083158
867 Ga0495628_0145727
868 Ga0495630_0018810
869 Ga0495666_0016257
870 Ga0495652_0114950
871 Ga0495665_0000215
872 Ga0495665_0069672
873 Ga0495665_0122282
874 Ga0495640_0196232
875 Ga0495586_0144872
876 Ga0495587_0076399
877 Ga0495587_0154819
878 Ga0495645_0026487
879 Ga0495667_0059502
880 Ga0495656_0008529
881 Ga0495634_0038744
882 Ga0495635_0037192
883 Ga0495661_0218380
884 Ga0495588_0000863
885 Ga0495599_0070766
886 Ga0495599_0174961
887 Ga0495646_0079501
888 Ga0495658_0002471
889 Ga0495658_0074516
890 Ga0495658_0124774
891 Ga0495658_0248337
892 Ga0495613_0003963
893 Ga0495613_0163754
894 Ga0495624_0009874
895 Ga0495581_0009890
896 Ga0495674_0034205
897 Ga0495674_0318205
898 Ga0495676_0000942
899 Ga0495676_0043333
900 Ga0495676_0062632
901 Ga0495680_0005597
902 Ga0495680_0013355
903 Ga0495684_0010019
904 Ga0495684_0196794
905 Ga0495593_0001317
906 Ga0495614_0004961
907 Ga0496100_0008880
908 Ga0496100_0134639
909 Ga0496100_0179828
910 Ga0496101_0008544
911 Ga0496101_0088087
912 Ga0496101_0108128
913 Ga0496101_0458117
914 Ga0496102_0001674
915 Ga0496102_0123628
916 Ga0496102_0176394
917 Ga0496102_0225291
918 Ga0496102_0639632
919 Ga0496103_0036541
920 Ga0496103_0153514
921 Ga0496104_0002528
922 Ga0496104_0007540
923 Ga0496104_0017150
924 Ga0496104_0017255
925 Ga0496104_0164457
926 Ga0496104_0187414
927 Ga0496104_0666473
928 Ga0496105_0000143
929 Ga0496105_0001400
930 Ga0496105_0057634
931 Ga0496105_0105208
932 Ga0496105_0137787
933 Ga0496105_0146187
934 Ga0496105_0437340
935 Ga0496106_0040919
936 Ga0496107_0062899
937 Ga0496107_0087280
938 Ga0496107_0109338
939 Ga0496108_0000358
940 Ga0496108_0025607
941 Ga0496108_0048175
942 Ga0496108_0098178
943 Ga0496108_0369129
944 Ga0496109_0000728
945 Ga0496109_0001613
946 Ga0496109_0030011
947 Ga0496109_0054479
948 Ga0496109_0071425
949 Ga0496109_0276853
950 Ga0496109_0395492
951 Ga0496109_0411625
952 Ga0496109_0552133
953 Ga0496110_0024457
954 Ga0496110_0077471
955 Ga0496110_0163982
956 Ga0496110_0268524
957 Ga0496110_0522573
958 Ga0496110_0557767
959 Ga0496111_0000280
960 Ga0496111_0053865
961 Ga0496111_0075877
962 Ga0496111_0208495
963 Ga0496111_0298955
964 Ga0496112_0000247
965 Ga0496112_0026222
966 Ga0496112_0035238
967 Ga0496112_0051598
968 Ga0496112_0070130
969 Ga0496112_0159091
970 Ga0496112_0271354
971 Ga0496113_0000870
972 Ga0496113_0044401
973 Ga0496113_0070677
974 Ga0496113_0340430
975 Ga0496114_0003987
976 Ga0496114_0072910
977 Ga0496114_0097844
978 Ga0496114_0144586
979 Ga0496114_0169796
980 Ga0496115_0005222
981 Ga0496115_0013067
982 Ga0496115_0071737
983 Ga0496115_0253291
984 Ga0501036_0216846
985 Ga0501041_0040969
986 Ga0501042_0139145
987 Ga0501067_0014472
988 Ga0501067_0116387
989 Ga0501068_0017240
990 Ga0501069_0000038
991 Ga0501069_0003795
992 Ga0501069_0015500
993 Ga0501070_0000008
994 Ga0501071_0057177
995 Ga0501071_0063805
996 Ga0501072_0013287
997 Ga0501072_0048944
998 Ga0501072_0078000
999 Ga0501077_0338095
1000 Ga0501079_0204948
1001 Ga0501080_0002411
1002 nmdc:mga0yw44_59223_c1
1003 nmdc:mga05p37_209898_c1
1004 nmdc:mga05p37_736_c1
1005 nmdc:mga09592_8565_c1
1006 nmdc:mga0qj67_14786_c1
1007 nmdc:mga06r32_696_c1
1008 nmdc:mga0n895_11224_c1
1009 nmdc:mga0n895_429936_c1
1010 nmdc:mga0rr50_93295_c1
1011 nmdc:mga0a205_102762_c1
1012 nmdc:mga0a205_277173_c1
1013 Ga0495601_0059411
1014 Ga0495612_0042470
1015 Ga0495595_0006454
1016 Ga0495595_0175656
1017 Ga0495619_0038770
1018 Ga0495619_0238198
1019 Ga0501082_0465383
1020 Ga0530510_0010159
1021 Ga0530510_0016282
1022 Ga0530510_0030674

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04228

Zn_peptidase

Putative neutral zinc metallopeptidase

25

318

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dag-assembly1.cif.gz_A vibrio cholera aldehyde-alcohol dehrogenase 0.315 148 279
4z8x-assembly1.cif.gz_A truncated ftsh from a. aeolicus 0.2822 140 285
6fs2-assembly2.cif.gz_B mcl1 in complex with indole acid ligand 0.2458 89 284
6mhc-assembly1.cif.gz_A glutathione s-transferase omega 1 bound to covalent inhibitor 37 0.2356 148 285
5cdf-assembly1.cif.gz_E structure at 2.3 a of the alpha/beta monomer of the f-atpase from paracoccus denitrificans 0.2339 200 282
ID Description Score Start End Superfamily
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8434 4 285 3.40.390.10
af_P9WL85_4_287_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.8349 4 285 3.40.390.10
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7397 1 285 3.40.390.10
af_P64429_1_283_3.40.390.10 Alpha Beta;3-Layer(aba) Sandwich;Collagenase (Catalytic Domain);Collagenase (Catalytic Domain) 0.7372 1 285 3.40.390.10
af_A0A0R0G7E0_1084_1251_1.10.357.90 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Telomerase reverse transcriptase (TERT), thumb domain 0.4757 160 276 1.10.357.90
ID Description Score Start End GO Terms
AF-A0A653IKK1-F1-model_v4 deleted 0.9675 70 289
AF-A0A0K8Q5Y0-F1-model_v4 Uncharacterized protein Mb2605 0.9655 76 287 GO:0016020
AF-A0A251XGV7-F1-model_v4 Putative neutral zinc metallopeptidase 0.9638 89 289 GO:0016020
AF-A0A1B9EWV7-F1-model_v4 Putative neutral zinc metallopeptidase 0.9619 121 285 GO:0016020
AF-A0A535JW09-F1-model_v4 Flagellar biosynthesis protein FlgM 0.9604 110 286 GO:0016020

Map