F457218

General Info

Members Datasets Scaffolds Average Seq Length
510 329 1021 272

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2616644941|2616901465
Length 308
Sequence GACVALSSEDWTIERPCGSGLAVHGRVPWPGMKILISADMEGATGVTWPADVLPGTPQWERCRAMFTSDVNAAALGFYDGGADEVLVNEAHWSMRNLLLERLDDRVQMLTGRHKSLSMVEGIQHGDIDAIAFVGYHTGAGAEGVLAHTYLANSITGVWLNGARASEGLLNAHVVAEYGVPVVLVTGDDLTCVDAEGYAPRARKVAVKDYVSRYAAVCRTPARTAADIRAAAKEATALAVRHTPVEGGPFTVELEFDAEHLAQAATVVPGVVPSGERRVAYTSATMYEGIRTFKAVTTLVSSAVEEQYG

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
27 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
28 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
29 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
32 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
33 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
53 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
54 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
55 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
56 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
57 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
58 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
59 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
60 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
61 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
62 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
63 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
69 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
70 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
73 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
76 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
77 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
78 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
79 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
80 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
81 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
82 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
83 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
84 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
85 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
86 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
87 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
90 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
91 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
92 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
93 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
99 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
100 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
101 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
102 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
103 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
106 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
107 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
108 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
109 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
112 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
113 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
114 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
115 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
116 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
117 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
118 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
119 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
120 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
121 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
127 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
128 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
129 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
132 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
133 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
134 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
135 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
138 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
139 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
143 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
158 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
159 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
160 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
163 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
164 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
206 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
209 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
210 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
211 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
212 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
213 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
214 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
215 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
220 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
223 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
224 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
228 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
229 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
230 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
231 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
232 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
233 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
234 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
235 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
236 2643221548 Streptomyces sp. Root55 Isolate Unclassified
237 2643221578 Streptomyces sp. Root63 Isolate Unclassified
238 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
239 2643221647 Streptomyces sp. Root369 Isolate Unclassified
240 2643221670 Streptomyces sp. Root431 Isolate Unclassified
241 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
242 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
243 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
244 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
245 2643221714 Streptomyces sp. Root264 Isolate Unclassified
246 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
247 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
248 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
249 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
250 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
251 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
252 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
253 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
254 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
255 2808606448 Streptomyces sp. 193411 Isolate Unclassified
256 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
257 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
258 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
259 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
260 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
261 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
262 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
263 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
264 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
265 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
266 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
267 2862574272 Streptomyces sp. AcE210 Isolate Nodule
268 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
269 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
270 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
271 2867369537 Streptomyces sp. Z26 Isolate Unclassified
272 2867428634 Streptomyces sp. RP5T Isolate Unclassified
273 2867475112 Streptomyces sp. TM32 Isolate Unclassified
274 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
275 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
276 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
277 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
278 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
279 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
280 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
281 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
282 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
283 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
284 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
285 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
286 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
287 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
288 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
289 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
290 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
291 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
292 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
293 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
294 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
295 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
296 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
297 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
298 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
299 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
300 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
301 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
302 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
303 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
304 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
305 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
306 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
307 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
308 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
309 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
310 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
311 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
312 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
313 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
314 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
315 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
316 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
317 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
318 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
319 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
320 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
321 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
322 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
323 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
324 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
325 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
326 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
327 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
328 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
329 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.8
Metatranscriptomes 0.39
Isolates 19.8

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.67
Nodule 0.59
Rhizoplane 0.98
Rhizosphere 74.9
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10055387 3300001990 Bacteria 1199
2 rootH1_10019282 3300003316 Bacteria 5256
3 rootH2_10003416 3300003320 Bacteria 4248
4 rootH2_10039185 3300003320 Bacteria 7565
5 rootH2_10110106 3300003320 Bacteria 1628
6 rootL2_10020058 3300003322 Bacteria 4418
7 rootL2_10127436 3300003322 Bacteria 1315
8 rootH1_10096795 3300003316 Bacteria 3470
9 rootH1_10096795 3300003323 Bacteria 1992
10 JGI25160J50197_1016048 3300003354 Bacteria 2428
11 JGI25160J50197_1018351 3300003354 Bacteria 2185
12 Ga0006562J51391_1132762 3300003578 Bacteria 1980
13 Ga0006562J51391_1132763 3300003578 Bacteria 1770
14 Ga0070658_10005114 3300005327 Bacteria 10677
15 Ga0070675_100361030 3300005354 Bacteria 1290
16 Ga0070659_100030535 3300005366 Bacteria 4170
17 Ga0070681_10037354 3300005458 Bacteria 4874
18 Ga0070685_10163873 3300005466 Bacteria 1419
19 Ga0070684_100155813 3300005535 Bacteria 2071
20 Ga0070665_100562191 3300005548 Bacteria 1153
21 Ga0068855_100580194 3300005563 Bacteria 1211
22 Ga0068857_100155336 3300005577 Bacteria 2074
23 Ga0068852_100281231 3300005616 Bacteria 1604
24 Ga0081455_10100549 3300005937 Bacteria 2323
25 Ga0075368_10098690 3300006042 Bacteria 1198
26 Ga0075367_10006902 3300006178 Bacteria 5783
27 Ga0075370_10005036 3300006353 Bacteria 6506
28 Ga0105243_10142888 3300009148 Bacteria 2044
29 Ga0105243_10391250 3300009148 Unclassified 1289
30 Ga0105028_107156 3300009993 Bacteria 1164
31 Ga0105239_10158807 3300010375 Bacteria 2526
32 Ga0157369_10034087 3300013105 Bacteria 5589
33 Ga0163162_10466516 3300013306 Bacteria 1394
34 Ga0157372_10424502 3300013307 Bacteria 1549
35 Ga0157375_10045850 3300013308 Bacteria 4257
36 Ga0157380_10187731 3300014326 Bacteria 1822
37 Ga0182008_10006275 3300014497 Bacteria 6675
38 Ga0182007_10002245 3300015262 Bacteria 9753
39 Ga0183367_1001 3300015688 Bacteria 1225545
40 Ga0163161_10046641 3300017792 Bacteria 3127
41 Ga0163161_10189350 3300017792 Bacteria 1581
42 Ga0213875_10002620 3300021388 Bacteria 10664
43 Ga0209758_1004873 3300025297 Bacteria 10804
44 Ga0207426_1000871 3300025302 Bacteria 31475
45 Ga0207647_10020194 3300025904 Bacteria 4471
46 Ga0207705_10006557 3300025909 Bacteria 8621
47 Ga0207646_10050999 3300025922 Bacteria 3703
48 Ga0207664_10274563 3300025929 Bacteria 1477
49 Ga0207690_10403591 3300025932 Bacteria 1090
50 Ga0207665_10205174 3300025939 Bacteria 1438
51 Ga0207661_10196648 3300025944 Bacteria 1770
52 Ga0207679_10152690 3300025945 Bacteria 1882
53 Ga0207667_10485530 3300025949 Bacteria 1254
54 Ga0207702_10224649 3300026078 Bacteria 1751
55 Ga0207674_10044174 3300026116 Bacteria 4591
56 Ga0209813_10038059 3300027866 Bacteria 1452
57 Ga0268266_10474852 3300028379 Bacteria 1191
58 Ga0307517_10000344 3300028786 Bacteria 80274
59 Ga0307517_10007152 3300028786 Bacteria 16365
60 Ga0307515_10000055 3300028794 Bacteria 264365
61 Ga0307515_10175537 3300028794 Bacteria 2115
62 Ga0307511_10000113 3300030521 Bacteria 72975
63 Ga0307512_10002717 3300030522 Bacteria 21689
64 Ga0307512_10024718 3300030522 Bacteria 5339
65 Ga0307512_10087176 3300030522 Bacteria 2200
66 Ga0316180_1057471 3300030736 Bacteria 1203
67 Ga0307513_10047250 3300031456 Bacteria 4683
68 Ga0307509_10006472 3300031507 Bacteria 15747
69 Ga0307509_10012745 3300031507 Bacteria 10017
70 Ga0307509_10150289 3300031507 Bacteria 2246
71 Ga0307508_10001803 3300031616 Bacteria 23737
72 Ga0307508_10002233 3300031616 Bacteria 20640
73 Ga0307508_10240687 3300031616 Bacteria 1407
74 Ga0307514_10053463 3300031649 Bacteria 3116
75 Ga0307514_10086112 3300031649 Bacteria 2307
76 Ga0307514_10106541 3300031649 Bacteria 1998
77 Ga0307516_10002534 3300031730 Bacteria 24324
78 Ga0307516_10016489 3300031730 Bacteria 7720
79 Ga0307516_10260134 3300031730 Bacteria 1426
80 Ga0307518_10010783 3300031838 Bacteria 6528
81 Ga0307518_10138402 3300031838 Bacteria 1701
82 Ga0307411_10260184 3300032005 Bacteria 1370
83 Ga0307507_10005356 3300033179 Bacteria 21193
84 Ga0307507_10006073 3300033179 Bacteria 18960
85 Ga0307507_10083673 3300033179 Bacteria 2788
86 Ga0307510_10004778 3300033180 Bacteria 16028
87 Ga0307510_10035384 3300033180 Bacteria 5579
88 Ga0307510_10055237 3300033180 Bacteria 4149
89 Ga0395900_0300692 3300037418 Bacteria 1591
90 Ga0395898_0003315 3300037466 Bacteria 18079
91 Ga0395898_0013128 3300037466 Bacteria 8538
92 Ga0436364_0765687 3300037853 Bacteria 14749
93 Ga0395901_0079876 3300038443 Bacteria 3415
94 Ga0439436_0003018 3300041404 Bacteria 5109
95 Ga0439436_0031192 3300041404 Bacteria 1547
96 Ga0439439_0010393 3300041406 Bacteria 2224
97 Ga0451837_0155089 3300041494 Bacteria 2651
98 Ga0451853_0064981 3300041512 Bacteria 6603
99 Ga0451853_2361327 3300041512 Bacteria 1870
100 Ga0439433_0001016 3300041999 Bacteria 5679
101 Ga0439448_0001284 3300042005 Bacteria 6417
102 Ga0439449_0020903 3300042007 Bacteria 2452
103 Ga0439449_0117158 3300042007 Bacteria 988
104 Ga0439457_000133 3300042014 Bacteria 18742
105 Ga0439457_002118 3300042014 Bacteria 5776
106 Ga0439462_0004382 3300042015 Bacteria 3440
107 Ga0450894_000310 3300042131 Bacteria 8735
108 Ga0450896_006794 3300042133 Bacteria 1572
109 Ga0450899_000316 3300042135 Bacteria 5309
110 Ga0450903_001028 3300042138 Bacteria 5332
111 Ga0450903_003136 3300042138 Bacteria 2880
112 Ga0450906_006639 3300042145 Bacteria 2321
113 Ga0439458_0002745 3300042157 Bacteria 4243
114 Ga0466969_0007453 3300044656 Bacteria 5814
115 Ga0466972_0005699 3300044658 Bacteria 6243
116 Ga0466972_0018746 3300044658 Bacteria 3459
117 Ga0466972_0043175 3300044658 Bacteria 2190
118 Ga0466972_0075974 3300044658 Bacteria 1600
119 Ga0466965_0014042 3300044683 Bacteria 3787
120 Ga0466965_0205859 3300044683 Bacteria 1045
121 Ga0466966_0003596 3300044684 Bacteria 10230
122 Ga0466966_0004237 3300044684 Bacteria 9467
123 Ga0466961_0007801 3300044693 Bacteria 6810
124 Ga0466961_0080172 3300044693 Bacteria 2066
125 Ga0466963_0001279 3300044694 Bacteria 13351
126 Ga0466963_0018084 3300044694 Bacteria 4400
127 Ga0466964_0000800 3300044706 Bacteria 10254
128 Ga0466971_0000384 3300044719 Bacteria 17009
129 Ga0466971_0025904 3300044719 Bacteria 2620
130 Ga0466968_0088797 3300044735 Bacteria 1367
131 Ga0466970_0001570 3300044765 Bacteria 11023
132 Ga0466970_0005580 3300044765 Bacteria 6254
133 Ga0466970_0113875 3300044765 Bacteria 1478
134 Ga0466957_0000083 3300044842 Bacteria 38311
135 Ga0466960_0013879 3300044901 Bacteria 3432
136 Ga0466960_0021134 3300044901 Bacteria 2894
137 Ga0466959_0003365 3300045049 Bacteria 10450
138 Ga0466958_0001876 3300045836 Bacteria 10278
139 Ga0466958_0389511 3300045836 Bacteria 899
140 Ga0466967_0010805 3300045976 Bacteria 6870
141 Ga0466967_0013100 3300045976 Bacteria 6387
142 Ga0466967_0024646 3300045976 Bacteria 4950
143 Ga0495617_009172 3300046452 Bacteria 3401
144 Ga0495592_0023641 3300046454 Bacteria 4674
145 Ga0495603_0001541 3300046455 Bacteria 13479
146 Ga0495603_0003017 3300046455 Bacteria 9975
147 Ga0495603_0004449 3300046455 Bacteria 8357
148 Ga0495603_0007992 3300046455 Bacteria 6385
149 Ga0495603_0076771 3300046455 Bacteria 1960
150 Ga0495629_0002806 3300046459 Bacteria 13288
151 Ga0495629_0004495 3300046459 Bacteria 10440
152 Ga0495629_0006376 3300046459 Bacteria 8754
153 Ga0495629_0014213 3300046459 Bacteria 5732
154 Ga0495629_0053694 3300046459 Bacteria 2818
155 Ga0495651_0008615 3300046462 Bacteria 7819
156 Ga0495651_0053640 3300046462 Bacteria 3103
157 Ga0495651_0089306 3300046462 Bacteria 2314
158 Ga0495605_0057164 3300046474 Bacteria 1879
159 Ga0495662_0001500 3300046476 Bacteria 11572
160 Ga0495664_0000284 3300046477 Bacteria 24203
161 Ga0495584_0017111 3300046491 Bacteria 3696
162 Ga0495585_0032460 3300046492 Bacteria 2958
163 Ga0495585_0162000 3300046492 Bacteria 1160
164 Ga0495594_0001644 3300046499 Bacteria 11637
165 Ga0495594_0012121 3300046499 Bacteria 4488
166 Ga0495594_0328009 3300046499 Bacteria 872
167 Ga0495607_0070871 3300046501 Bacteria 1946
168 Ga0495607_0129515 3300046501 Bacteria 1315
169 Ga0495606_0005814 3300046507 Bacteria 11636
170 Ga0495608_0102134 3300046511 Bacteria 1848
171 Ga0495608_0139400 3300046511 Bacteria 1549
172 Ga0495616_0010484 3300046513 Bacteria 5362
173 Ga0495618_0172391 3300046514 Bacteria 1376
174 Ga0495620_0001237 3300046515 Bacteria 15589
175 Ga0495628_0005626 3300046516 Bacteria 10971
176 Ga0495628_0109143 3300046516 Bacteria 2129
177 Ga0495630_0042533 3300046517 Bacteria 3393
178 Ga0495631_0017494 3300046518 Bacteria 3390
179 Ga0495632_0025793 3300046519 Bacteria 3105
180 Ga0495637_0034504 3300046520 Bacteria 2215
181 Ga0495643_0008345 3300046522 Bacteria 6571
182 Ga0495643_0020353 3300046522 Bacteria 3825
183 Ga0495648_0024801 3300046524 Bacteria 4073
184 Ga0495648_0089118 3300046524 Bacteria 1732
185 Ga0495666_0041552 3300046526 Bacteria 2226
186 Ga0495642_0059866 3300046528 Bacteria 1579
187 Ga0495642_0094522 3300046528 Bacteria 1268
188 Ga0495652_0027614 3300046529 Bacteria 5000
189 Ga0495652_0043423 3300046529 Bacteria 3871
190 Ga0495652_0108643 3300046529 Bacteria 2235
191 Ga0495640_0003623 3300046533 Bacteria 12402
192 Ga0495640_0153367 3300046533 Bacteria 1479
193 Ga0495587_0007472 3300046536 Bacteria 7076
194 Ga0495597_0017622 3300046542 Bacteria 3358
195 Ga0495645_0098556 3300046543 Bacteria 2080
196 Ga0495622_0016190 3300046557 Bacteria 3471
197 Ga0495633_0009737 3300046558 Bacteria 5282
198 Ga0495656_0170816 3300046615 Bacteria 1063
199 Ga0495668_0150258 3300046616 Bacteria 1275
200 Ga0495634_0007193 3300046642 Bacteria 8391
201 Ga0495634_0047043 3300046642 Bacteria 2908
202 Ga0495611_0092520 3300046648 Bacteria 1398
203 Ga0495625_0057801 3300046660 Bacteria 2757
204 Ga0495625_0130742 3300046660 Bacteria 1700
205 Ga0495635_0016405 3300046663 Bacteria 5172
206 Ga0495635_0084662 3300046663 Bacteria 2169
207 Ga0495635_0305685 3300046663 Bacteria 1066
208 Ga0495661_0166180 3300046665 Bacteria 1180
209 Ga0495588_0005568 3300046674 Bacteria 5614
210 Ga0495588_0054269 3300046674 Bacteria 2067
211 Ga0495657_0003915 3300046675 Bacteria 11963
212 Ga0495657_0020763 3300046675 Bacteria 4721
213 Ga0495657_0047003 3300046675 Bacteria 2920
214 Ga0495657_0048224 3300046675 Bacteria 2874
215 Ga0495623_0042411 3300046679 Bacteria 2898
216 Ga0495623_0098927 3300046679 Bacteria 1780
217 Ga0495646_0012680 3300046680 Bacteria 5355
218 Ga0495613_0000504 3300046689 Bacteria 32987
219 Ga0495613_0000948 3300046689 Bacteria 22175
220 Ga0495613_0012268 3300046689 Bacteria 6366
221 Ga0495613_0026197 3300046689 Bacteria 4344
222 Ga0495613_0358089 3300046689 Bacteria 1001
223 Ga0495624_0053300 3300046690 Bacteria 2554
224 Ga0495624_0096190 3300046690 Bacteria 1824
225 Ga0495624_0164960 3300046690 Bacteria 1352
226 Ga0495670_0034429 3300046691 Bacteria 2523
227 Ga0495670_0075436 3300046691 Bacteria 1712
228 Ga0495670_0090067 3300046691 Bacteria 1569
229 Ga0495649_0038397 3300046694 Bacteria 2627
230 Ga0495589_0014183 3300046794 Bacteria 4106
231 Ga0495589_0028507 3300046794 Bacteria 2817
232 Ga0495589_0038233 3300046794 Bacteria 2403
233 Ga0495589_0043553 3300046794 Bacteria 2233
234 Ga0495589_0057417 3300046794 Bacteria 1914
235 Ga0495600_0016924 3300046809 Bacteria 4633
236 Ga0495600_0045231 3300046809 Bacteria 2872
237 Ga0495600_0174047 3300046809 Bacteria 1388
238 Ga0495581_0005689 3300047315 Bacteria 7230
239 Ga0495581_0053050 3300047315 Bacteria 2342
240 Ga0495604_0000760 3300047317 Bacteria 27156
241 Ga0495604_0008648 3300047317 Bacteria 8048
242 Ga0495604_0035489 3300047317 Bacteria 3938
243 Ga0495636_0003531 3300047318 Bacteria 6060
244 Ga0495636_0086343 3300047318 Bacteria 1357
245 Ga0495636_0087545 3300047318 Bacteria 1348
246 Ga0495636_0088884 3300047318 Bacteria 1339
247 Ga0495674_0137369 3300047319 Bacteria 2056
248 Ga0495672_0172640 3300047320 Bacteria 1101
249 Ga0495676_0000578 3300047321 Bacteria 30172
250 Ga0495676_0009031 3300047321 Bacteria 9097
251 Ga0495676_0009944 3300047321 Bacteria 8641
252 Ga0495676_0011126 3300047321 Bacteria 8130
253 Ga0495676_0018181 3300047321 Bacteria 6201
254 Ga0495676_0022660 3300047321 Bacteria 5460
255 Ga0495676_0040526 3300047321 Bacteria 3842
256 Ga0495680_0056569 3300047322 Bacteria 3036
257 Ga0495687_001977 3300047443 Bacteria 17480
258 Ga0495687_003403 3300047443 Bacteria 11584
259 Ga0495687_022230 3300047443 Bacteria 3049
260 Ga0495687_095921 3300047443 Bacteria 1123
261 Ga0495675_0006761 3300047444 Bacteria 7034
262 Ga0495675_0013871 3300047444 Bacteria 5094
263 Ga0495675_0031654 3300047444 Bacteria 3377
264 Ga0495677_0159146 3300047445 Bacteria 871
265 Ga0495685_000156 3300047447 Bacteria 23176
266 Ga0495685_007009 3300047447 Bacteria 3710
267 Ga0495685_013950 3300047447 Bacteria 2726
268 Ga0495685_014710 3300047447 Bacteria 2661
269 Ga0495681_0001380 3300047470 Bacteria 18345
270 Ga0495681_0033780 3300047470 Bacteria 2556
271 Ga0495684_0136360 3300047471 Bacteria 1841
272 Ga0495686_0035436 3300047472 Bacteria 3208
273 Ga0495686_0043067 3300047472 Bacteria 2865
274 Ga0495593_0001483 3300047673 Bacteria 13792
275 Ga0495593_0044000 3300047673 Bacteria 2390
276 Ga0495593_0062414 3300047673 Bacteria 1947
277 Ga0495614_0000671 3300048089 Bacteria 14403
278 Ga0495614_0018460 3300048089 Bacteria 3020
279 Ga0495614_0044769 3300048089 Bacteria 1898
280 Ga0495626_0004827 3300048091 Bacteria 8126
281 Ga0496105_0493565 3300048908 Bacteria 962
282 Ga0496108_0130647 3300048911 Bacteria 2159
283 Ga0496112_0122734 3300048915 Bacteria 2568
284 Ga0496113_0304847 3300048916 Bacteria 1276
285 Ga0501031_0008973 3300049568 Bacteria 6504
286 Ga0501031_0014381 3300049568 Bacteria 5145
287 Ga0501031_0219795 3300049568 Bacteria 1237
288 Ga0501032_0008375 3300049569 Bacteria 7540
289 Ga0501032_0047803 3300049569 Bacteria 2889
290 Ga0501032_0057077 3300049569 Bacteria 2623
291 Ga0501033_0004660 3300049570 Bacteria 10971
292 Ga0501033_0010611 3300049570 Bacteria 7065
293 Ga0501033_0015276 3300049570 Bacteria 5824
294 Ga0501033_0189456 3300049570 Bacteria 1472
295 Ga0501033_0349080 3300049570 Bacteria 1037
296 Ga0501034_0002630 3300049571 Bacteria 21305
297 Ga0501034_0002924 3300049571 Bacteria 19803
298 Ga0501034_0056715 3300049571 Bacteria 3940
299 Ga0501034_0067690 3300049571 Bacteria 3583
300 Ga0501034_0093997 3300049571 Bacteria 2995
301 Ga0501034_0110179 3300049571 Bacteria 2744
302 Ga0501034_0645784 3300049571 Bacteria 960
303 Ga0501036_0001409 3300049572 Bacteria 18476
304 Ga0501036_0002517 3300049572 Bacteria 14382
305 Ga0501036_0037030 3300049572 Bacteria 4127
306 Ga0501036_0054530 3300049572 Bacteria 3386
307 Ga0501036_0270219 3300049572 Bacteria 1423
308 Ga0501036_0384271 3300049572 Bacteria 1171
309 Ga0501037_0005004 3300049573 Bacteria 9638
310 Ga0501037_0055074 3300049573 Bacteria 2908
311 Ga0501038_0005121 3300049574 Bacteria 12175
312 Ga0501038_0015698 3300049574 Bacteria 6883
313 Ga0501038_0041020 3300049574 Bacteria 4038
314 Ga0501038_0074043 3300049574 Bacteria 2882
315 Ga0501038_0079784 3300049574 Bacteria 2759
316 Ga0501038_0168432 3300049574 Bacteria 1775
317 Ga0501039_0007342 3300049575 Bacteria 8397
318 Ga0501039_0081983 3300049575 Bacteria 2511
319 Ga0501039_0250863 3300049575 Bacteria 1391
320 Ga0501039_0261811 3300049575 Bacteria 1359
321 Ga0501040_0021803 3300049576 Bacteria 4282
322 Ga0501041_0003982 3300049577 Bacteria 8523
323 Ga0501041_0102160 3300049577 Bacteria 1775
324 Ga0501042_0018777 3300049578 Bacteria 4792
325 Ga0501043_0002573 3300049579 Bacteria 15345
326 Ga0501043_0007604 3300049579 Bacteria 8592
327 Ga0501043_0037627 3300049579 Bacteria 3805
328 Ga0501043_0069787 3300049579 Bacteria 2760
329 Ga0501043_0124150 3300049579 Bacteria 2024
330 Ga0501046_0003381 3300049580 Bacteria 14644
331 Ga0501046_0024255 3300049580 Bacteria 4979
332 Ga0501046_0031993 3300049580 Bacteria 4261
333 Ga0501046_0172568 3300049580 Bacteria 1622
334 Ga0501046_0198387 3300049580 Bacteria 1494
335 Ga0501047_0000023 3300049581 Bacteria 240478
336 Ga0501047_0008930 3300049581 Bacteria 9462
337 Ga0501047_0015683 3300049581 Bacteria 7220
338 Ga0501047_0028865 3300049581 Bacteria 5351
339 Ga0501047_0106012 3300049581 Bacteria 2691
340 Ga0501047_0134629 3300049581 Bacteria 2351
341 Ga0501047_0288157 3300049581 Bacteria 1486
342 Ga0501048_0007758 3300049582 Bacteria 8135
343 Ga0501067_0002190 3300049583 Bacteria 10784
344 Ga0501068_0000329 3300049584 Bacteria 23730
345 Ga0501070_0003488 3300049586 Bacteria 13642
346 Ga0501070_0016471 3300049586 Bacteria 6211
347 Ga0501070_0085914 3300049586 Bacteria 2605
348 Ga0501070_0234860 3300049586 Bacteria 1502
349 Ga0501070_0293572 3300049586 Bacteria 1325
350 Ga0501070_0303640 3300049586 Bacteria 1300
351 Ga0501071_0002483 3300049587 Bacteria 11208
352 Ga0501072_0194973 3300049588 Bacteria 1615
353 Ga0501074_0006625 3300049590 Bacteria 8374
354 Ga0501076_0103640 3300049592 Bacteria 2295
355 Ga0501077_0016723 3300049593 Bacteria 4625
356 Ga0501080_0134890 3300049742 Bacteria 2285
357 Ga0501083_0006991 3300049744 Bacteria 8009
358 Ga0501282_003984 3300049778 Bacteria 1583
359 Ga0501035_0001543 3300049822 Bacteria 23441
360 Ga0501035_0003531 3300049822 Bacteria 14945
361 Ga0501035_0004228 3300049822 Bacteria 13638
362 Ga0501035_0018874 3300049822 Bacteria 6354
363 Ga0501035_0052470 3300049822 Bacteria 3649
364 Ga0501035_0066511 3300049822 Bacteria 3198
365 Ga0501035_0076092 3300049822 Bacteria 2968
366 Ga0501035_0081870 3300049822 Bacteria 2848
367 Ga0501035_0284299 3300049822 Bacteria 1397
368 Ga0501044_0000295 3300049823 Bacteria 63284
369 Ga0501044_0001055 3300049823 Bacteria 33142
370 Ga0501044_0002011 3300049823 Bacteria 23446
371 Ga0501044_0008841 3300049823 Bacteria 11016
372 Ga0501044_0027540 3300049823 Bacteria 6005
373 Ga0501044_0075384 3300049823 Bacteria 3425
374 Ga0501044_0164609 3300049823 Bacteria 2192
375 Ga0501045_0242537 3300049824 Bacteria 1341
376 nmdc:mga03n38_163637_c1 3300050490 Bacteria 1128
377 nmdc:mga06z11_275_c1 3300050494 Bacteria 20098
378 nmdc:mga04h51_45484_c1 3300050495 Bacteria 1452
379 nmdc:mga07m45_188439_c1 3300050496 Bacteria 1199
380 nmdc:mga07m45_25040_c1 3300050496 Bacteria 3271
381 Ga0495612_0009765 3300053078 Bacteria 3888
382 Ga0495655_0003712 3300053083 Bacteria 2546
383 Ga0495619_0022306 3300053085 Bacteria 4050
384 Ga0500578_0003964 3300053086 Bacteria 10727
385 Ga0500644_0002212 3300053088 Bacteria 4912
386 Ga0500566_0095242 3300053094 Bacteria 1640
387 Ga0500640_003057 3300053095 Bacteria 5720
388 Ga0500654_042701 3300053099 Bacteria 2550
389 Ga0500560_021262 3300053107 Bacteria 1852
390 Ga0500569_000311 3300053109 Bacteria 7785
391 Ga0500614_023119 3300053123 Bacteria 1458
392 Ga0500628_005299 3300053129 Bacteria 2147
393 Ga0500652_000296 3300053131 Bacteria 18120
394 Ga0500658_0000785 3300053134 Bacteria 13139
395 Ga0500559_0140025 3300053136 Bacteria 1133
396 Ga0500561_0000135 3300053137 Bacteria 14079
397 Ga0500573_0018541 3300053140 Bacteria 3968
398 Ga0500579_024461 3300053143 Bacteria 3901
399 Ga0500600_0003554 3300053149 Bacteria 9029
400 Ga0500600_0038358 3300053149 Bacteria 2775
401 Ga0500616_0016412 3300053153 Bacteria 4215
402 Ga0500633_0000188 3300053160 Bacteria 8639
403 Ga0500634_0000152 3300053161 Bacteria 23380
404 Ga0500587_000340 3300053739 Bacteria 5287
405 Ga0501084_0001039 3300054114 Bacteria 21593
406 Ga0501082_0008286 3300060353 Bacteria 8965
407 Ga0501082_0044633 3300060353 Bacteria 3823
408 Ga0466962_0000664 3300061719 Bacteria 15252
409 Ga0466962_0098618 3300061719 Bacteria 1402
410 Ga0530510_0034445 3300061734 Bacteria 3648
411 2616901465 2616644941 Bacteria 8510691
412 2547410303 2547132111 Bacteria 8013147
413 2554260734 2554235005 Bacteria 6457341
414 2585298160 2582581312 Bacteria 7308206
415 2585304657 2582581313 Bacteria 10042643
416 2585314713 2582581314 Bacteria 11452267
417 2616698271 2616644814 Bacteria 11555299
418 2643762081 2643221548 Bacteria 8053412
419 2643901972 2643221578 Bacteria 9213798
420 2643946223 2643221587 Bacteria 7586415
421 2644261956 2643221647 Bacteria 10741251
422 2644387993 2643221670 Bacteria 6497041
423 2644408116 2643221673 Bacteria 9196637
424 2644433012 2643221677 Bacteria 7584031
425 2644438879 2643221678 Bacteria 9540101
426 2644459140 2643221682 Bacteria 6743283
427 2644631305 2643221714 Bacteria 9015452
428 2768645637 2767802112 Bacteria 6465194
429 2784591646 2784132148 Bacteria 8627943
430 2785340089 2784746763 Bacteria 9783172
431 2785372650 2784746768 Bacteria 10036182
432 2786675333 2786546132 Bacteria 10419719
433 2793982592 2791355406 Bacteria 11364898
434 2804848921 2802429296 Bacteria 7227771
435 2808845006 2808606359 Bacteria 9866990
436 2808914602 2808606375 Bacteria 9466072
437 2809235277 2808606448 Bacteria 8656184
438 2811843519 2808606982 Bacteria 7791042
439 2812354684 2811994879 Bacteria 9313447
440 2812477654 2811994917 Bacteria 7761064
441 2819698809 2818991463 Bacteria 7948711
442 2837272979 2837268691 Bacteria 7850704
443 2852636303 2852635781 Bacteria 8251373
444 2862184013 2862178590 Bacteria 8583590
445 2862283397 2862281513 Bacteria 9621493
446 2862296021 2862290372 Bacteria 7471434
447 2862388234 2862382967 Bacteria 10317375
448 2862507780 2862507626 Bacteria 9425308
449 2862576423 2862574272 Bacteria 10567477
450 2862708944 2862705112 Bacteria 6563286
451 2863409878 2863404153 Bacteria 9672205
452 2867352784 2867346516 Bacteria 7608576
453 2867374669 2867369537 Bacteria 6501581
454 2867432027 2867428634 Bacteria 9590268
455 2867481014 2867475112 Bacteria 6909112
456 2873152884 2873151551 Bacteria 8625867
457 2875397717 2875391855 Bacteria 7600475
458 2877678065 2877676314 Bacteria 9512378
459 2912716285 2912715099 Bacteria 9460473
460 2912729170 2912723979 Bacteria 8557534
461 2912763916 2912757875 Bacteria 7940295
462 2918507536 2918501144 Bacteria 8668083
463 2919471198 2919468124 Bacteria 9133025
464 2935395389 2935390628 Bacteria 7043367
465 2946046806 2946045630 Bacteria 8527308
466 2946070979 2946064051 Bacteria 8957905
467 2946078910 2946072368 Bacteria 8999607
468 2947225737 2947224130 Bacteria 9938529
469 2954009915 2954002825 Bacteria 9173742
470 2954382850 2954380949 Bacteria 10050426
471 2954680040 2954673503 Bacteria 9685905
472 2954684110 2954682443 Bacteria 9862841
473 2954693671 2954691527 Bacteria 10720516
474 2954708766 2954701450 Bacteria 10834262
475 2954713317 2954711539 Bacteria 10867210
476 2954723277 2954721474 Bacteria 10456478
477 2954738551 2954731030 Bacteria 10243860
478 2954742183 2954740390 Bacteria 10229294
479 2954757409 2954749733 Bacteria 10366972
480 2954761162 2954759201 Bacteria 9358192
481 2966599813 2966598605 Bacteria 7676064
482 2990049066 2990044586 Bacteria 6603797
483 2990061802 2990059506 Bacteria 9321252
484 2990090583 2990088156 Bacteria 6657676
485 2995464290 2995463766 Bacteria 8577691
486 2997457388 2997451912 Bacteria 8492419
487 2997603512 2997600082 Bacteria 9896405
488 3006323115 3006321560 Bacteria 8247479
489 3006394154 3006393351 Bacteria 6615579
490 3006427133 3006425503 Bacteria 6491253
491 3006491492 3006486233 Bacteria 8157040
492 3006494227 3006493962 Bacteria 8825450
493 8008489865 8008485437 Bacteria 7198341
494 8008563971 8008558824 Bacteria 10610750
495 8008576093 8008574985 Bacteria 7815457
496 8023626188 8023623736 Bacteria 8593882
497 8025417533 8025413630 Bacteria 7014048
498 8025478691 8025478263 Bacteria 8209203
499 8025529403 8025524527 Bacteria 7197316
500 8025533073 8025530807 Bacteria 8495698
501 8033685077 8033684223 Bacteria 6906479
502 8047895301 8047893842 Bacteria 11723082
503 8048130595 8048127548 Bacteria 11053136
504 8048363652 8048356638 Bacteria 11044339
505 8048372327 8048369669 Bacteria 11666822
506 8048381261 8048379754 Bacteria 11877923
507 8048407062 8048406513 Bacteria 8936924
508 8054161907 8054160619 Bacteria 7783213
509 8056065882 8056060235 Bacteria 7259403
510 8056667276 8056667051 Bacteria 6953971
511 8056837036 8056829672 Bacteria 9045328
512 JGI24737J22298_10055387
513 rootH1_10019282
514 rootH2_10003416
515 rootH2_10039185
516 rootH2_10110106
517 rootL2_10020058
518 rootL2_10127436
519 rootH1_10096795
520 JGI25160J50197_1016048
521 JGI25160J50197_1018351
522 Ga0006562J51391_1132762
523 Ga0006562J51391_1132763
524 Ga0070658_10005114
525 Ga0070675_100361030
526 Ga0070659_100030535
527 Ga0070681_10037354
528 Ga0070685_10163873
529 Ga0070684_100155813
530 Ga0070665_100562191
531 Ga0068855_100580194
532 Ga0068857_100155336
533 Ga0068852_100281231
534 Ga0081455_10100549
535 Ga0075368_10098690
536 Ga0075367_10006902
537 Ga0075370_10005036
538 Ga0105243_10142888
539 Ga0105243_10391250
540 Ga0105028_107156
541 Ga0105239_10158807
542 Ga0157369_10034087
543 Ga0163162_10466516
544 Ga0157372_10424502
545 Ga0157375_10045850
546 Ga0157380_10187731
547 Ga0182008_10006275
548 Ga0182007_10002245
549 Ga0183367_1001
550 Ga0163161_10046641
551 Ga0163161_10189350
552 Ga0213875_10002620
553 Ga0209758_1004873
554 Ga0207426_1000871
555 Ga0207647_10020194
556 Ga0207705_10006557
557 Ga0207646_10050999
558 Ga0207664_10274563
559 Ga0207690_10403591
560 Ga0207665_10205174
561 Ga0207661_10196648
562 Ga0207679_10152690
563 Ga0207667_10485530
564 Ga0207702_10224649
565 Ga0207674_10044174
566 Ga0209813_10038059
567 Ga0268266_10474852
568 Ga0307517_10000344
569 Ga0307517_10007152
570 Ga0307515_10000055
571 Ga0307515_10175537
572 Ga0307511_10000113
573 Ga0307512_10002717
574 Ga0307512_10024718
575 Ga0307512_10087176
576 Ga0316180_1057471
577 Ga0307513_10047250
578 Ga0307509_10006472
579 Ga0307509_10012745
580 Ga0307509_10150289
581 Ga0307508_10001803
582 Ga0307508_10002233
583 Ga0307508_10240687
584 Ga0307514_10053463
585 Ga0307514_10086112
586 Ga0307514_10106541
587 Ga0307516_10002534
588 Ga0307516_10016489
589 Ga0307516_10260134
590 Ga0307518_10010783
591 Ga0307518_10138402
592 Ga0307411_10260184
593 Ga0307507_10005356
594 Ga0307507_10006073
595 Ga0307507_10083673
596 Ga0307510_10004778
597 Ga0307510_10035384
598 Ga0307510_10055237
599 Ga0395900_0300692
600 Ga0395898_0003315
601 Ga0395898_0013128
602 Ga0436364_0765687
603 Ga0395901_0079876
604 Ga0439436_0003018
605 Ga0439436_0031192
606 Ga0439439_0010393
607 Ga0451837_0155089
608 Ga0451853_0064981
609 Ga0451853_2361327
610 Ga0439433_0001016
611 Ga0439448_0001284
612 Ga0439449_0020903
613 Ga0439449_0117158
614 Ga0439457_000133
615 Ga0439457_002118
616 Ga0439462_0004382
617 Ga0450894_000310
618 Ga0450896_006794
619 Ga0450899_000316
620 Ga0450903_001028
621 Ga0450903_003136
622 Ga0450906_006639
623 Ga0439458_0002745
624 Ga0466969_0007453
625 Ga0466972_0005699
626 Ga0466972_0018746
627 Ga0466972_0043175
628 Ga0466972_0075974
629 Ga0466965_0014042
630 Ga0466965_0205859
631 Ga0466966_0003596
632 Ga0466966_0004237
633 Ga0466961_0007801
634 Ga0466961_0080172
635 Ga0466963_0001279
636 Ga0466963_0018084
637 Ga0466964_0000800
638 Ga0466971_0000384
639 Ga0466971_0025904
640 Ga0466968_0088797
641 Ga0466970_0001570
642 Ga0466970_0005580
643 Ga0466970_0113875
644 Ga0466957_0000083
645 Ga0466960_0013879
646 Ga0466960_0021134
647 Ga0466959_0003365
648 Ga0466958_0001876
649 Ga0466958_0389511
650 Ga0466967_0010805
651 Ga0466967_0013100
652 Ga0466967_0024646
653 Ga0495617_009172
654 Ga0495592_0023641
655 Ga0495603_0001541
656 Ga0495603_0003017
657 Ga0495603_0004449
658 Ga0495603_0007992
659 Ga0495603_0076771
660 Ga0495629_0002806
661 Ga0495629_0004495
662 Ga0495629_0006376
663 Ga0495629_0014213
664 Ga0495629_0053694
665 Ga0495651_0008615
666 Ga0495651_0053640
667 Ga0495651_0089306
668 Ga0495605_0057164
669 Ga0495662_0001500
670 Ga0495664_0000284
671 Ga0495584_0017111
672 Ga0495585_0032460
673 Ga0495585_0162000
674 Ga0495594_0001644
675 Ga0495594_0012121
676 Ga0495594_0328009
677 Ga0495607_0070871
678 Ga0495607_0129515
679 Ga0495606_0005814
680 Ga0495608_0102134
681 Ga0495608_0139400
682 Ga0495616_0010484
683 Ga0495618_0172391
684 Ga0495620_0001237
685 Ga0495628_0005626
686 Ga0495628_0109143
687 Ga0495630_0042533
688 Ga0495631_0017494
689 Ga0495632_0025793
690 Ga0495637_0034504
691 Ga0495643_0008345
692 Ga0495643_0020353
693 Ga0495648_0024801
694 Ga0495648_0089118
695 Ga0495666_0041552
696 Ga0495642_0059866
697 Ga0495642_0094522
698 Ga0495652_0027614
699 Ga0495652_0043423
700 Ga0495652_0108643
701 Ga0495640_0003623
702 Ga0495640_0153367
703 Ga0495587_0007472
704 Ga0495597_0017622
705 Ga0495645_0098556
706 Ga0495622_0016190
707 Ga0495633_0009737
708 Ga0495656_0170816
709 Ga0495668_0150258
710 Ga0495634_0007193
711 Ga0495634_0047043
712 Ga0495611_0092520
713 Ga0495625_0057801
714 Ga0495625_0130742
715 Ga0495635_0016405
716 Ga0495635_0084662
717 Ga0495635_0305685
718 Ga0495661_0166180
719 Ga0495588_0005568
720 Ga0495588_0054269
721 Ga0495657_0003915
722 Ga0495657_0020763
723 Ga0495657_0047003
724 Ga0495657_0048224
725 Ga0495623_0042411
726 Ga0495623_0098927
727 Ga0495646_0012680
728 Ga0495613_0000504
729 Ga0495613_0000948
730 Ga0495613_0012268
731 Ga0495613_0026197
732 Ga0495613_0358089
733 Ga0495624_0053300
734 Ga0495624_0096190
735 Ga0495624_0164960
736 Ga0495670_0034429
737 Ga0495670_0075436
738 Ga0495670_0090067
739 Ga0495649_0038397
740 Ga0495589_0014183
741 Ga0495589_0028507
742 Ga0495589_0038233
743 Ga0495589_0043553
744 Ga0495589_0057417
745 Ga0495600_0016924
746 Ga0495600_0045231
747 Ga0495600_0174047
748 Ga0495581_0005689
749 Ga0495581_0053050
750 Ga0495604_0000760
751 Ga0495604_0008648
752 Ga0495604_0035489
753 Ga0495636_0003531
754 Ga0495636_0086343
755 Ga0495636_0087545
756 Ga0495636_0088884
757 Ga0495674_0137369
758 Ga0495672_0172640
759 Ga0495676_0000578
760 Ga0495676_0009031
761 Ga0495676_0009944
762 Ga0495676_0011126
763 Ga0495676_0018181
764 Ga0495676_0022660
765 Ga0495676_0040526
766 Ga0495680_0056569
767 Ga0495687_001977
768 Ga0495687_003403
769 Ga0495687_022230
770 Ga0495687_095921
771 Ga0495675_0006761
772 Ga0495675_0013871
773 Ga0495675_0031654
774 Ga0495677_0159146
775 Ga0495685_000156
776 Ga0495685_007009
777 Ga0495685_013950
778 Ga0495685_014710
779 Ga0495681_0001380
780 Ga0495681_0033780
781 Ga0495684_0136360
782 Ga0495686_0035436
783 Ga0495686_0043067
784 Ga0495593_0001483
785 Ga0495593_0044000
786 Ga0495593_0062414
787 Ga0495614_0000671
788 Ga0495614_0018460
789 Ga0495614_0044769
790 Ga0495626_0004827
791 Ga0496105_0493565
792 Ga0496108_0130647
793 Ga0496112_0122734
794 Ga0496113_0304847
795 Ga0501031_0008973
796 Ga0501031_0014381
797 Ga0501031_0219795
798 Ga0501032_0008375
799 Ga0501032_0047803
800 Ga0501032_0057077
801 Ga0501033_0004660
802 Ga0501033_0010611
803 Ga0501033_0015276
804 Ga0501033_0189456
805 Ga0501033_0349080
806 Ga0501034_0002630
807 Ga0501034_0002924
808 Ga0501034_0056715
809 Ga0501034_0067690
810 Ga0501034_0093997
811 Ga0501034_0110179
812 Ga0501034_0645784
813 Ga0501036_0001409
814 Ga0501036_0002517
815 Ga0501036_0037030
816 Ga0501036_0054530
817 Ga0501036_0270219
818 Ga0501036_0384271
819 Ga0501037_0005004
820 Ga0501037_0055074
821 Ga0501038_0005121
822 Ga0501038_0015698
823 Ga0501038_0041020
824 Ga0501038_0074043
825 Ga0501038_0079784
826 Ga0501038_0168432
827 Ga0501039_0007342
828 Ga0501039_0081983
829 Ga0501039_0250863
830 Ga0501039_0261811
831 Ga0501040_0021803
832 Ga0501041_0003982
833 Ga0501041_0102160
834 Ga0501042_0018777
835 Ga0501043_0002573
836 Ga0501043_0007604
837 Ga0501043_0037627
838 Ga0501043_0069787
839 Ga0501043_0124150
840 Ga0501046_0003381
841 Ga0501046_0024255
842 Ga0501046_0031993
843 Ga0501046_0172568
844 Ga0501046_0198387
845 Ga0501047_0000023
846 Ga0501047_0008930
847 Ga0501047_0015683
848 Ga0501047_0028865
849 Ga0501047_0106012
850 Ga0501047_0134629
851 Ga0501047_0288157
852 Ga0501048_0007758
853 Ga0501067_0002190
854 Ga0501068_0000329
855 Ga0501070_0003488
856 Ga0501070_0016471
857 Ga0501070_0085914
858 Ga0501070_0234860
859 Ga0501070_0293572
860 Ga0501070_0303640
861 Ga0501071_0002483
862 Ga0501072_0194973
863 Ga0501074_0006625
864 Ga0501076_0103640
865 Ga0501077_0016723
866 Ga0501080_0134890
867 Ga0501083_0006991
868 Ga0501282_003984
869 Ga0501035_0001543
870 Ga0501035_0003531
871 Ga0501035_0004228
872 Ga0501035_0018874
873 Ga0501035_0052470
874 Ga0501035_0066511
875 Ga0501035_0076092
876 Ga0501035_0081870
877 Ga0501035_0284299
878 Ga0501044_0000295
879 Ga0501044_0001055
880 Ga0501044_0002011
881 Ga0501044_0008841
882 Ga0501044_0027540
883 Ga0501044_0075384
884 Ga0501044_0164609
885 Ga0501045_0242537
886 nmdc:mga03n38_163637_c1
887 nmdc:mga06z11_275_c1
888 nmdc:mga04h51_45484_c1
889 nmdc:mga07m45_188439_c1
890 nmdc:mga07m45_25040_c1
891 Ga0495612_0009765
892 Ga0495655_0003712
893 Ga0495619_0022306
894 Ga0500578_0003964
895 Ga0500644_0002212
896 Ga0500566_0095242
897 Ga0500640_003057
898 Ga0500654_042701
899 Ga0500560_021262
900 Ga0500569_000311
901 Ga0500614_023119
902 Ga0500628_005299
903 Ga0500652_000296
904 Ga0500658_0000785
905 Ga0500559_0140025
906 Ga0500561_0000135
907 Ga0500573_0018541
908 Ga0500579_024461
909 Ga0500600_0003554
910 Ga0500600_0038358
911 Ga0500616_0016412
912 Ga0500633_0000188
913 Ga0500634_0000152
914 Ga0500587_000340
915 Ga0501084_0001039
916 Ga0501082_0008286
917 Ga0501082_0044633
918 Ga0466962_0000664
919 Ga0466962_0098618
920 Ga0530510_0034445
921 2616901465
922 2547410303
923 2554260734
924 2585298160
925 2585304657
926 2585314713
927 2616698271
928 2643762081
929 2643901972
930 2643946223
931 2644261956
932 2644387993
933 2644408116
934 2644433012
935 2644438879
936 2644459140
937 2644631305
938 2768645637
939 2784591646
940 2785340089
941 2785372650
942 2786675333
943 2793982592
944 2804848921
945 2808845006
946 2808914602
947 2809235277
948 2811843519
949 2812354684
950 2812477654
951 2819698809
952 2837272979
953 2852636303
954 2862184013
955 2862283397
956 2862296021
957 2862388234
958 2862507780
959 2862576423
960 2862708944
961 2863409878
962 2867352784
963 2867374669
964 2867432027
965 2867481014
966 2873152884
967 2875397717
968 2877678065
969 2912716285
970 2912729170
971 2912763916
972 2918507536
973 2919471198
974 2935395389
975 2946046806
976 2946070979
977 2946078910
978 2947225737
979 2954009915
980 2954382850
981 2954680040
982 2954684110
983 2954693671
984 2954708766
985 2954713317
986 2954723277
987 2954738551
988 2954742183
989 2954757409
990 2954761162
991 2966599813
992 2990049066
993 2990061802
994 2990090583
995 2995464290
996 2997457388
997 2997603512
998 3006323115
999 3006394154
1000 3006427133
1001 3006491492
1002 3006494227
1003 8008489865
1004 8008563971
1005 8008576093
1006 8023626188
1007 8025417533
1008 8025478691
1009 8025529403
1010 8025533073
1011 8033685077
1012 8047895301
1013 8048130595
1014 8048363652
1015 8048372327
1016 8048381261
1017 8048407062
1018 8054161907
1019 8056065882
1020 8056667276
1021 8056837036

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04951

Peptidase_M55

D-aminopeptidase

32

294

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hi9-assembly1.cif.gz_A zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease. 0.9153 1 268
1hi9-assembly1.cif.gz_A zn-dependent d-aminopeptidase dppa from bacillus subtilis, a self-compartmentalizing protease. 0.8929 1 268
7o0h-assembly1.cif.gz_B structure of the foamy viral protease-reverse transcriptase drh in complex with ds dna. 0.7835 228 271
7o24-assembly1.cif.gz_A structure of the foamy viral protease-reverse transcriptase in complex with dsdna. 0.7606 228 271
2php-assembly1.cif.gz_A crystal structure of the c-terminal domain of protein mj0236 (y236_metja) 0.7106 238 272
ID Description Score Start End Superfamily
1hi9E01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dipeptide transport protein 0.9237 1 209 3.40.50.10780
1hi9E01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dipeptide transport protein 0.9011 1 209 3.40.50.10780
af_K7LRX0_162_289_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.8623 246 271 3.30.1370.10
1hi9A02 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2;Dipeptide transport protein 0.852 211 268 3.30.1360.130
af_Q4CUW3_2_88_3.30.1370.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1;K Homology domain, type 1 0.7183 221 276 3.30.1370.10
ID Description Score Start End GO Terms
AF-A0A2V2QST2-F1-model_v4 deleted 0.9901 131 277
AF-A0A6B1JU08-F1-model_v4 deleted 0.9874 1 226
AF-A0A6B3D3J0-F1-model_v4 M55 family metallopeptidase 0.9868 113 261
AF-A0A401VX73-F1-model_v4 Peptide ABC transporter substrate-binding protein 0.9863 1 277 GO:0046872
AF-A0A1Z1WME1-F1-model_v4 Peptide ABC transporter substrate-binding protein 0.9862 87 277

Map