F457158

General Info

Members Datasets Scaffolds Average Seq Length
510 269 1020 80

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_11335070|Ga0207668_113350702
Length 91
Sequence VKVTVLVRPKEGILDPQGEAIRQALTTLGYPASSVRAGRVFDVELDVGDAAEAERVGREAADRVLANGLIEGYEVVVXXXXAPSEHEVVAE

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
131 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
153 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
154 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
163 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
198 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
205 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
206 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
210 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
223 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
224 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
225 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
243 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
244 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
259 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
260 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
261 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
268 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.02
Metatranscriptomes 0.98
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.98
Nodule 0
Rhizoplane 9.41
Rhizosphere 88.82
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_11335070 3300025972 Bacteria 646
2 JGI25406J46586_10044822 3300003203 Bacteria 1528
3 Ga0070658_10173354 3300005327 Bacteria 1813
4 Ga0070658_10481252 3300005327 Bacteria 1071
5 Ga0070683_100125312 3300005329 Bacteria 2428
6 Ga0070683_100703806 3300005329 Bacteria 968
7 Ga0070683_101088163 3300005329 Bacteria 768
8 Ga0070683_101599910 3300005329 Bacteria 626
9 Ga0070680_100179852 3300005336 Bacteria 1781
10 Ga0070680_101886756 3300005336 Bacteria 518
11 Ga0070682_100012964 3300005337 Bacteria 4785
12 Ga0070682_100077352 3300005337 Bacteria 2144
13 Ga0070682_100661877 3300005337 Bacteria 833
14 Ga0068868_100407008 3300005338 Bacteria 1175
15 Ga0068868_100793502 3300005338 Bacteria 854
16 Ga0070660_100107766 3300005339 Bacteria 2214
17 Ga0070660_100143402 3300005339 Bacteria 1918
18 Ga0070660_100706031 3300005339 Bacteria 846
19 Ga0070660_101245286 3300005339 Bacteria 631
20 Ga0070689_101504536 3300005340 Bacteria 610
21 Ga0070691_10012584 3300005341 Bacteria 3875
22 Ga0070691_10947048 3300005341 Bacteria 534
23 Ga0070661_100869778 3300005344 Bacteria 743
24 Ga0070675_101700347 3300005354 Bacteria 582
25 Ga0070675_101771645 3300005354 Bacteria 570
26 Ga0070674_100061962 3300005356 Bacteria 2612
27 Ga0070674_100246346 3300005356 Bacteria 1402
28 Ga0070674_101685335 3300005356 Bacteria 573
29 Ga0070673_100433485 3300005364 Bacteria 1180
30 Ga0070667_100019130 3300005367 Bacteria 5679
31 Ga0070714_100144330 3300005435 Bacteria 2140
32 Ga0070714_100216149 3300005435 Bacteria 1760
33 Ga0070714_100560422 3300005435 Bacteria 1094
34 Ga0070714_100610667 3300005435 Bacteria 1048
35 Ga0070714_100756213 3300005435 Bacteria 940
36 Ga0070713_100923976 3300005436 Bacteria 840
37 Ga0070705_100502453 3300005440 Bacteria 921
38 Ga0070700_101204189 3300005441 Bacteria 632
39 Ga0070708_100391823 3300005445 Bacteria 1310
40 Ga0070663_101000641 3300005455 Bacteria 727
41 Ga0070681_10116980 3300005458 Bacteria 2602
42 Ga0070681_10185800 3300005458 Bacteria 1999
43 Ga0070685_10710265 3300005466 Bacteria 734
44 Ga0070706_100087694 3300005467 Bacteria 2885
45 Ga0070707_100366509 3300005468 Bacteria 1399
46 Ga0070707_101118979 3300005468 Bacteria 753
47 Ga0070707_101438342 3300005468 Bacteria 656
48 Ga0070699_100656282 3300005518 Bacteria 958
49 Ga0070679_100142836 3300005530 Bacteria 2372
50 Ga0070684_100146359 3300005535 Bacteria 2138
51 Ga0068853_100652565 3300005539 Bacteria 1002
52 Ga0070686_100252099 3300005544 Bacteria 1290
53 Ga0070696_101063735 3300005546 Bacteria 679
54 Ga0070696_101338849 3300005546 Bacteria 609
55 Ga0068855_100110370 3300005563 Bacteria 3158
56 Ga0068855_100121757 3300005563 Bacteria 2985
57 Ga0070664_100241802 3300005564 Bacteria 1621
58 Ga0070664_100290637 3300005564 Bacteria 1476
59 Ga0068857_100793515 3300005577 Bacteria 904
60 Ga0068856_100033478 3300005614 Bacteria 5031
61 Ga0068861_102602732 3300005719 Bacteria 510
62 Ga0068851_10162413 3300005834 Bacteria 1228
63 Ga0068858_102111402 3300005842 Bacteria 557
64 Ga0068860_102021881 3300005843 Bacteria 598
65 Ga0068862_100900156 3300005844 Bacteria 870
66 Ga0081455_10020247 3300005937 Bacteria 6271
67 Ga0081538_10012364 3300005981 Bacteria 6841
68 Ga0081539_10000294 3300005985 Bacteria 112974
69 Ga0070717_10001953 3300006028 Bacteria 14400
70 Ga0075365_10158997 3300006038 Bacteria 1573
71 Ga0075363_100813756 3300006048 Bacteria 569
72 Ga0075363_100895645 3300006048 Bacteria 543
73 Ga0070712_100069031 3300006175 Bacteria 2520
74 Ga0070712_100189346 3300006175 Bacteria 1609
75 Ga0070712_100263457 3300006175 Bacteria 1382
76 Ga0068871_100349769 3300006358 Bacteria 1307
77 Ga0075428_100793048 3300006844 Bacteria 1007
78 Ga0075433_10005822 3300006852 Bacteria 9706
79 Ga0075434_100149667 3300006871 Bacteria 2354
80 Ga0068865_100874371 3300006881 Bacteria 780
81 Ga0068865_101222071 3300006881 Bacteria 666
82 Ga0068865_101798393 3300006881 Unclassified 554
83 Ga0075436_100003253 3300006914 Bacteria 11125
84 Ga0075435_100159178 3300007076 Bacteria 1901
85 Ga0105240_10032909 3300009093 Bacteria 6704
86 Ga0111539_10099399 3300009094 Bacteria 3417
87 Ga0111539_10468441 3300009094 Bacteria 1467
88 Ga0111539_10985660 3300009094 Bacteria 980
89 Ga0111539_12321299 3300009094 Bacteria 622
90 Ga0111539_13324761 3300009094 Bacteria 518
91 Ga0105245_10027006 3300009098 Bacteria 5056
92 Ga0105245_11395516 3300009098 Bacteria 750
93 Ga0105247_11057532 3300009101 Bacteria 638
94 Ga0114129_10005445 3300009147 Bacteria 17985
95 Ga0105243_12276607 3300009148 Bacteria 579
96 Ga0105242_11132252 3300009176 Bacteria 798
97 Ga0105242_12175545 3300009176 Bacteria 599
98 Ga0105238_10799717 3300009551 Bacteria 959
99 Ga0105238_11485529 3300009551 Bacteria 706
100 Ga0105249_11439070 3300009553 Bacteria 761
101 Ga0105249_12626112 3300009553 Bacteria 576
102 Ga0099796_10248200 3300010159 Bacteria 738
103 Ga0105239_11399243 3300010375 Bacteria 807
104 Ga0105246_10759635 3300011119 Bacteria 856
105 Ga0157373_10656587 3300013100 Bacteria 766
106 Ga0157370_10244178 3300013104 Bacteria 1661
107 Ga0157369_10015605 3300013105 Bacteria 8560
108 Ga0157369_10514751 3300013105 Bacteria 1238
109 Ga0157374_10323045 3300013296 Bacteria 1530
110 Ga0157374_11589620 3300013296 Bacteria 678
111 Ga0157374_12199371 3300013296 Bacteria 579
112 Ga0157378_11060922 3300013297 Bacteria 846
113 Ga0157378_12108268 3300013297 Bacteria 614
114 Ga0163162_10567949 3300013306 Bacteria 1262
115 Ga0163162_11755615 3300013306 Bacteria 709
116 Ga0163162_12336900 3300013306 Bacteria 614
117 Ga0157372_10086341 3300013307 Bacteria 3559
118 Ga0157372_10578150 3300013307 Bacteria 1309
119 Ga0157375_10300499 3300013308 Bacteria 1769
120 Ga0163163_11150770 3300014325 Bacteria 839
121 Ga0157380_10029508 3300014326 Bacteria 4192
122 Ga0157380_12564880 3300014326 Bacteria 576
123 Ga0182008_10893944 3300014497 Bacteria 522
124 Ga0157377_10009930 3300014745 Bacteria 4693
125 Ga0157377_10928636 3300014745 Bacteria 653
126 Ga0157377_11594956 3300014745 Bacteria 522
127 Ga0197907_11293152 3300020069 Bacteria 1485
128 Ga0206354_10238170 3300020081 Bacteria 3386
129 Ga0206353_11841045 3300020082 Bacteria 1322
130 Ga0206353_11990372 3300020082 Bacteria 1060
131 Ga0224712_10224281 3300022467 Bacteria 861
132 Ga0207685_10520492 3300025905 Bacteria 628
133 Ga0207699_10006372 3300025906 Bacteria 5708
134 Ga0207684_10799236 3300025910 Bacteria 797
135 Ga0207695_10713047 3300025913 Bacteria 884
136 Ga0207693_10013209 3300025915 Bacteria 6663
137 Ga0207693_10318935 3300025915 Bacteria 1217
138 Ga0207693_10688747 3300025915 Bacteria 792
139 Ga0207660_10153314 3300025917 Bacteria 1772
140 Ga0207660_10733490 3300025917 Bacteria 806
141 Ga0207662_10765217 3300025918 Bacteria 679
142 Ga0207662_10793293 3300025918 Bacteria 667
143 Ga0207657_10147365 3300025919 Bacteria 1919
144 Ga0207657_10867828 3300025919 Bacteria 696
145 Ga0207652_11560252 3300025921 Bacteria 564
146 Ga0207646_10160758 3300025922 Bacteria 2027
147 Ga0207646_10924881 3300025922 Bacteria 773
148 Ga0207687_10024739 3300025927 Bacteria 4013
149 Ga0207687_11147258 3300025927 Bacteria 668
150 Ga0207700_11651283 3300025928 Bacteria 566
151 Ga0207664_10276116 3300025929 Bacteria 1473
152 Ga0207706_10613825 3300025933 Bacteria 933
153 Ga0207686_11728834 3300025934 Bacteria 517
154 Ga0207709_10124146 3300025935 Bacteria 1748
155 Ga0207670_10755189 3300025936 Bacteria 808
156 Ga0207669_10023160 3300025937 Bacteria 3312
157 Ga0207704_10475610 3300025938 Bacteria 1002
158 Ga0207704_10526400 3300025938 Bacteria 957
159 Ga0207689_10195243 3300025942 Bacteria 1670
160 Ga0207689_10636236 3300025942 Bacteria 898
161 Ga0207661_10894053 3300025944 Bacteria 818
162 Ga0207679_10811249 3300025945 Bacteria 853
163 Ga0207667_10190026 3300025949 Bacteria 2107
164 Ga0207667_10525853 3300025949 Bacteria 1198
165 Ga0207712_11407977 3300025961 Bacteria 624
166 Ga0207668_10774518 3300025972 Bacteria 848
167 Ga0207658_10012243 3300025986 Bacteria 5855
168 Ga0207658_10661887 3300025986 Bacteria 942
169 Ga0207677_10169835 3300026023 Bacteria 1704
170 Ga0207677_10646143 3300026023 Bacteria 933
171 Ga0207677_11486594 3300026023 Bacteria 625
172 Ga0207639_10113957 3300026041 Bacteria 2209
173 Ga0207678_11203560 3300026067 Bacteria 671
174 Ga0207678_11252142 3300026067 Bacteria 657
175 Ga0207708_10563688 3300026075 Bacteria 962
176 Ga0207708_11845402 3300026075 Unclassified 530
177 Ga0207702_10261720 3300026078 Bacteria 1629
178 Ga0207702_11546892 3300026078 Bacteria 657
179 Ga0207702_11947287 3300026078 Bacteria 579
180 Ga0207648_10197114 3300026089 Bacteria 1786
181 Ga0207648_10427536 3300026089 Bacteria 1203
182 Ga0207674_10895404 3300026116 Bacteria 855
183 Ga0207675_101050588 3300026118 Bacteria 834
184 Ga0207683_11505098 3300026121 Bacteria 621
185 Ga0207698_11070032 3300026142 Bacteria 819
186 Ga0268266_11640658 3300028379 Bacteria 618
187 Ga0268265_10774404 3300028380 Bacteria 933
188 Ga0265319_1057414 3300028563 Bacteria 1270
189 Ga0265318_10151388 3300028577 Bacteria 851
190 Ga0265336_10098472 3300028666 Bacteria 871
191 Ga0265320_10139293 3300031240 Bacteria 1099
192 Ga0265320_10209828 3300031240 Bacteria 868
193 Ga0307408_100032805 3300031548 Bacteria 3623
194 Ga0307405_10007193 3300031731 Bacteria 5544
195 Ga0307410_10105512 3300031852 Bacteria 2028
196 Ga0307410_11115657 3300031852 Bacteria 684
197 Ga0307406_10047440 3300031901 Bacteria 2707
198 Ga0307406_11198030 3300031901 Bacteria 659
199 Ga0307407_10127832 3300031903 Bacteria 1621
200 Ga0307412_10142513 3300031911 Bacteria 1757
201 Ga0307409_100277006 3300031995 Bacteria 1548
202 Ga0307409_100377250 3300031995 Bacteria 1347
203 Ga0307416_100000355 3300032002 Bacteria 23746
204 Ga0307415_100007659 3300032126 Bacteria 5925
205 Ga0373926_0134687 3300035083 Bacteria 937
206 Ga0373944_0095428 3300035089 Bacteria 999
207 Ga0373944_0253718 3300035089 Bacteria 650
208 Ga0373936_0002192 3300035113 Bacteria 7284
209 Ga0373941_0103243 3300035115 Bacteria 995
210 Ga0373945_0004179 3300035116 Bacteria 4583
211 Ga0373943_0009987 3300035170 Bacteria 4255
212 Ga0373943_0011298 3300035170 Bacteria 4017
213 Ga0373946_0012440 3300035171 Bacteria 3186
214 Ga0373946_0058063 3300035171 Bacteria 1638
215 Ga0373935_0007897 3300035692 Bacteria 6384
216 Ga0373935_0409058 3300035692 Bacteria 975
217 Ga0373927_0068874 3300035695 Bacteria 2290
218 Ga0373947_0000066 3300035725 Bacteria 52968
219 Ga0373947_0133577 3300035725 Bacteria 1586
220 Ga0373925_0259673 3300037068 Bacteria 1395
221 Ga0395899_0021814 3300037312 Bacteria 4858
222 Ga0395899_0026349 3300037312 Bacteria 4387
223 Ga0395899_0034926 3300037312 Bacteria 3775
224 Ga0395899_0143443 3300037312 Bacteria 1698
225 Ga0395899_0219928 3300037312 Bacteria 1316
226 Ga0395899_0552280 3300037312 Bacteria 740
227 Ga0395899_0666336 3300037312 Bacteria 656
228 Ga0395899_0687906 3300037312 Bacteria 643
229 Ga0395899_0991187 3300037312 Bacteria 507
230 Ga0395900_0001593 3300037418 Bacteria 26785
231 Ga0395900_0004660 3300037418 Bacteria 14468
232 Ga0395900_0013642 3300037418 Bacteria 8295
233 Ga0395900_0057669 3300037418 Bacteria 3998
234 Ga0395900_0067779 3300037418 Bacteria 3666
235 Ga0395900_0178108 3300037418 Bacteria 2162
236 Ga0395900_0416739 3300037418 Bacteria 1304
237 Ga0395900_0609934 3300037418 Bacteria 1031
238 Ga0395900_1146633 3300037418 Bacteria 694
239 Ga0395900_1419495 3300037418 Bacteria 607
240 Ga0395900_1504808 3300037418 Bacteria 585
241 Ga0395900_1598900 3300037418 Bacteria 563
242 Ga0395900_1653345 3300037418 Bacteria 551
243 Ga0395900_1732069 3300037418 Bacteria 536
244 Ga0395898_0007815 3300037466 Bacteria 11354
245 Ga0395898_0012044 3300037466 Bacteria 8952
246 Ga0395898_0040425 3300037466 Bacteria 4611
247 Ga0395898_0080808 3300037466 Bacteria 3135
248 Ga0395898_0098669 3300037466 Bacteria 2805
249 Ga0395898_0156180 3300037466 Bacteria 2182
250 Ga0395898_0163572 3300037466 Bacteria 2129
251 Ga0395898_0173349 3300037466 Bacteria 2062
252 Ga0395898_0341168 3300037466 Bacteria 1429
253 Ga0395898_0701952 3300037466 Bacteria 953
254 Ga0395898_1180925 3300037466 Bacteria 697
255 Ga0395898_1278970 3300037466 Bacteria 663
256 Ga0395898_1535776 3300037466 Bacteria 591
257 Ga0395898_1574539 3300037466 Bacteria 582
258 Ga0395905_0004275 3300037471 Bacteria 14898
259 Ga0395905_0020528 3300037471 Bacteria 6257
260 Ga0395905_0111255 3300037471 Bacteria 2572
261 Ga0395905_0158064 3300037471 Bacteria 2131
262 Ga0395905_0181113 3300037471 Bacteria 1978
263 Ga0395905_0200353 3300037471 Bacteria 1872
264 Ga0395905_0255489 3300037471 Bacteria 1637
265 Ga0395905_0257879 3300037471 Bacteria 1628
266 Ga0395905_0958749 3300037471 Bacteria 758
267 Ga0395905_1058769 3300037471 Bacteria 714
268 Ga0395905_1562081 3300037471 Bacteria 564
269 Ga0395901_0000904 3300038443 Bacteria 32610
270 Ga0395901_0006455 3300038443 Bacteria 11885
271 Ga0395901_0015337 3300038443 Bacteria 7798
272 Ga0395901_0026319 3300038443 Bacteria 5973
273 Ga0395901_0062143 3300038443 Bacteria 3887
274 Ga0395901_0199408 3300038443 Bacteria 2098
275 Ga0395901_0259055 3300038443 Bacteria 1810
276 Ga0395901_0363267 3300038443 Bacteria 1492
277 Ga0395901_0378060 3300038443 Bacteria 1458
278 Ga0395901_0476244 3300038443 Bacteria 1274
279 Ga0395901_0596189 3300038443 Bacteria 1114
280 Ga0395901_0650367 3300038443 Bacteria 1057
281 Ga0395901_0846422 3300038443 Bacteria 900
282 Ga0395901_0963272 3300038443 Bacteria 831
283 Ga0395901_1020966 3300038443 Bacteria 802
284 Ga0395901_1084293 3300038443 Bacteria 772
285 Ga0395901_1146903 3300038443 Bacteria 745
286 Ga0451807_0380437 3300041486 Bacteria 809
287 Ga0451849_1229132 3300041505 Bacteria 551
288 Ga0451853_1014321 3300041512 Bacteria 542
289 Ga0451853_3735016 3300041512 Bacteria 528
290 Ga0450907_061858 3300042146 Bacteria 646
291 Ga0439434_0027014 3300042435 Bacteria 1734
292 Ga0466966_0446551 3300044684 Bacteria 777
293 Ga0466963_0044907 3300044694 Bacteria 2908
294 Ga0466963_0126622 3300044694 Bacteria 1761
295 Ga0466964_0085526 3300044706 Bacteria 1362
296 Ga0466957_0102435 3300044842 Bacteria 1806
297 Ga0466959_1207414 3300045049 Bacteria 503
298 Ga0451576_1966485 3300045051 Bacteria 603
299 Ga0466958_0003345 3300045836 Bacteria 8310
300 Ga0466967_0008183 3300045976 Bacteria 7636
301 Ga0466967_0025487 3300045976 Bacteria 4878
302 Ga0466967_0100044 3300045976 Bacteria 2649
303 Ga0466967_0311842 3300045976 Bacteria 1515
304 Ga0466967_0493756 3300045976 Bacteria 1200
305 Ga0466967_0601207 3300045976 Bacteria 1085
306 Ga0466967_1938221 3300045976 Bacteria 586
307 Ga0495592_0725980 3300046454 Bacteria 596
308 Ga0495603_0133662 3300046455 Bacteria 1444
309 Ga0495603_0595270 3300046455 Bacteria 633
310 Ga0495629_0000194 3300046459 Bacteria 54501
311 Ga0495629_0043544 3300046459 Bacteria 3151
312 Ga0495629_0049631 3300046459 Bacteria 2941
313 Ga0495629_0127150 3300046459 Bacteria 1776
314 Ga0495641_0027758 3300046461 Bacteria 2747
315 Ga0495641_0083789 3300046461 Bacteria 1428
316 Ga0495651_0031197 3300046462 Bacteria 4157
317 Ga0495651_0198354 3300046462 Bacteria 1407
318 Ga0495651_0384480 3300046462 Bacteria 920
319 Ga0495651_0610236 3300046462 Bacteria 687
320 Ga0495653_0031364 3300046463 Bacteria 4224
321 Ga0495582_0000317 3300046473 Bacteria 26470
322 Ga0495582_0475744 3300046473 Bacteria 722
323 Ga0495639_0000738 3300046475 Bacteria 14941
324 Ga0495662_0003759 3300046476 Bacteria 7654
325 Ga0495594_0037504 3300046499 Bacteria 2644
326 Ga0495596_0331391 3300046500 Bacteria 592
327 Ga0495608_0064754 3300046511 Bacteria 2396
328 Ga0495608_0238459 3300046511 Bacteria 1137
329 Ga0495618_0292136 3300046514 Bacteria 1014
330 Ga0495618_0402617 3300046514 Bacteria 837
331 Ga0495628_0108189 3300046516 Bacteria 2140
332 Ga0495630_0065049 3300046517 Bacteria 2740
333 Ga0495630_0143468 3300046517 Bacteria 1815
334 Ga0495630_0460661 3300046517 Bacteria 974
335 Ga0495644_0042107 3300046523 Bacteria 1720
336 Ga0495644_0241390 3300046523 Bacteria 701
337 Ga0495666_0111556 3300046526 Bacteria 1284
338 Ga0495652_0202921 3300046529 Bacteria 1503
339 Ga0495665_0002372 3300046531 Bacteria 10166
340 Ga0495640_0059774 3300046533 Bacteria 2594
341 Ga0495640_0384725 3300046533 Bacteria 863
342 Ga0495640_0691964 3300046533 Bacteria 612
343 Ga0495586_0339071 3300046535 Bacteria 863
344 Ga0495587_0290119 3300046536 Bacteria 916
345 Ga0495645_0303701 3300046543 Bacteria 1042
346 Ga0495667_0017836 3300046559 Bacteria 4796
347 Ga0495667_0063255 3300046559 Bacteria 2422
348 Ga0495667_0381400 3300046559 Bacteria 889
349 Ga0495656_0264089 3300046615 Bacteria 873
350 Ga0495656_0657395 3300046615 Bacteria 563
351 Ga0495634_0074750 3300046642 Bacteria 2226
352 Ga0495634_0100245 3300046642 Bacteria 1872
353 Ga0495635_0023266 3300046663 Bacteria 4319
354 Ga0495635_0054524 3300046663 Bacteria 2754
355 Ga0495635_0070871 3300046663 Bacteria 2389
356 Ga0495635_0198824 3300046663 Bacteria 1360
357 Ga0495659_0320899 3300046664 Bacteria 657
358 Ga0495588_0296558 3300046674 Bacteria 851
359 Ga0495657_0129366 3300046675 Bacteria 1583
360 Ga0495657_0151629 3300046675 Bacteria 1439
361 Ga0495646_0105605 3300046680 Bacteria 1609
362 Ga0495646_0278355 3300046680 Bacteria 890
363 Ga0495647_0370644 3300046681 Bacteria 654
364 Ga0495658_0000224 3300046683 Bacteria 32518
365 Ga0495658_0251488 3300046683 Bacteria 1112
366 Ga0495658_0808193 3300046683 Bacteria 600
367 Ga0495613_0001177 3300046689 Bacteria 19969
368 Ga0495624_0319704 3300046690 Bacteria 935
369 Ga0495624_0672079 3300046690 Bacteria 615
370 Ga0495670_0222142 3300046691 Bacteria 1004
371 Ga0495589_0434331 3300046794 Bacteria 601
372 Ga0495600_0007311 3300046809 Bacteria 6748
373 Ga0495600_0456790 3300046809 Bacteria 789
374 Ga0495581_0010896 3300047315 Bacteria 5257
375 Ga0495581_0364370 3300047315 Bacteria 844
376 Ga0495604_0320287 3300047317 Bacteria 1036
377 Ga0495674_0010061 3300047319 Bacteria 8966
378 Ga0495674_0030216 3300047319 Bacteria 4928
379 Ga0495674_0234851 3300047319 Bacteria 1512
380 Ga0495674_0253942 3300047319 Bacteria 1446
381 Ga0495676_0019416 3300047321 Bacteria 5978
382 Ga0495676_0039191 3300047321 Bacteria 3927
383 Ga0495676_0413016 3300047321 Bacteria 894
384 Ga0495676_0832314 3300047321 Bacteria 593
385 Ga0495676_0835856 3300047321 Bacteria 592
386 Ga0495680_0003158 3300047322 Bacteria 16404
387 Ga0495680_0006155 3300047322 Bacteria 11193
388 Ga0495680_0025843 3300047322 Bacteria 4854
389 Ga0495675_0052940 3300047444 Bacteria 2577
390 Ga0495675_0494326 3300047444 Bacteria 703
391 Ga0495684_0030332 3300047471 Bacteria 4152
392 Ga0495684_0068237 3300047471 Bacteria 2704
393 Ga0495686_0000003 3300047472 Bacteria 899502
394 Ga0495593_0015026 3300047673 Bacteria 4397
395 Ga0495602_0230943 3300048088 Bacteria 1390
396 Ga0495614_0002669 3300048089 Bacteria 7928
397 Ga0496100_0177913 3300048903 Bacteria 1537
398 Ga0496100_0223196 3300048903 Bacteria 1384
399 Ga0496100_0994045 3300048903 Bacteria 660
400 Ga0496101_0031419 3300048904 Bacteria 3733
401 Ga0496101_0250987 3300048904 Bacteria 1378
402 Ga0496101_0331661 3300048904 Bacteria 1194
403 Ga0496101_0504490 3300048904 Bacteria 956
404 Ga0496102_0161978 3300048905 Bacteria 2104
405 Ga0496102_0410183 3300048905 Bacteria 1273
406 Ga0496103_0193751 3300048906 Bacteria 1307
407 Ga0496103_0577723 3300048906 Bacteria 717
408 Ga0496104_0175049 3300048907 Bacteria 2056
409 Ga0496104_0190712 3300048907 Bacteria 1961
410 Ga0496104_0216263 3300048907 Bacteria 1828
411 Ga0496105_0435837 3300048908 Bacteria 1036
412 Ga0496105_0507570 3300048908 Bacteria 946
413 Ga0496106_0617360 3300048909 Bacteria 868
414 Ga0496107_0385269 3300048910 Bacteria 1043
415 Ga0496108_0034195 3300048911 Bacteria 4222
416 Ga0496108_0053820 3300048911 Bacteria 3376
417 Ga0496108_0827570 3300048911 Bacteria 798
418 Ga0496108_1285622 3300048911 Bacteria 616
419 Ga0496109_0003132 3300048912 Bacteria 13798
420 Ga0496109_0007538 3300048912 Bacteria 9221
421 Ga0496109_0359350 3300048912 Bacteria 1376
422 Ga0496109_0417132 3300048912 Bacteria 1268
423 Ga0496109_0516935 3300048912 Bacteria 1127
424 Ga0496109_1725860 3300048912 Bacteria 560
425 Ga0496110_0011353 3300048913 Bacteria 7288
426 Ga0496110_0052819 3300048913 Bacteria 3571
427 Ga0496110_0466459 3300048913 Bacteria 1151
428 Ga0496110_0604570 3300048913 Bacteria 995
429 Ga0496111_0114459 3300048914 Bacteria 1988
430 Ga0496111_0738893 3300048914 Bacteria 714
431 Ga0496111_0935103 3300048914 Bacteria 623
432 Ga0496112_0099982 3300048915 Bacteria 2870
433 Ga0496113_0111294 3300048916 Bacteria 2132
434 Ga0496113_0753117 3300048916 Bacteria 775
435 Ga0496114_0066499 3300048917 Bacteria 3022
436 Ga0496114_0170696 3300048917 Bacteria 1895
437 Ga0496114_0233691 3300048917 Bacteria 1616
438 Ga0496114_0305381 3300048917 Bacteria 1405
439 Ga0496114_0748133 3300048917 Bacteria 855
440 Ga0496115_0036622 3300048918 Bacteria 3886
441 Ga0496115_0892423 3300048918 Bacteria 686
442 Ga0496115_1002639 3300048918 Bacteria 638
443 Ga0496115_1064646 3300048918 Bacteria 615
444 Ga0496126_0053682 3300048929 Bacteria 3655
445 Ga0501031_0500280 3300049568 Bacteria 784
446 Ga0501032_0736598 3300049569 Bacteria 624
447 Ga0501036_0093241 3300049572 Bacteria 2544
448 Ga0501036_0236328 3300049572 Bacteria 1533
449 Ga0501036_0343432 3300049572 Bacteria 1247
450 Ga0501036_1204629 3300049572 Bacteria 617
451 Ga0501039_0260551 3300049575 Bacteria 1363
452 Ga0501040_0238236 3300049576 Bacteria 1296
453 Ga0501040_0316621 3300049576 Bacteria 1116
454 Ga0501040_0322557 3300049576 Bacteria 1105
455 Ga0501041_0531490 3300049577 Bacteria 749
456 Ga0501042_0179556 3300049578 Bacteria 1527
457 Ga0501043_0944839 3300049579 Bacteria 616
458 Ga0501046_0523636 3300049580 Bacteria 847
459 Ga0501048_0847439 3300049582 Bacteria 657
460 Ga0501067_0068225 3300049583 Bacteria 1969
461 Ga0501067_0078565 3300049583 Bacteria 1829
462 Ga0501068_0250454 3300049584 Bacteria 1129
463 Ga0501071_0081575 3300049587 Bacteria 2367
464 Ga0501072_0275477 3300049588 Bacteria 1338
465 Ga0501072_0576132 3300049588 Bacteria 888
466 Ga0501072_0850621 3300049588 Bacteria 713
467 Ga0501073_1116313 3300049589 Bacteria 542
468 Ga0501074_0136063 3300049590 Bacteria 1758
469 Ga0501075_0912145 3300049591 Bacteria 668
470 Ga0501075_1511675 3300049591 Bacteria 508
471 Ga0501076_0041331 3300049592 Bacteria 3627
472 Ga0501076_0320048 3300049592 Bacteria 1272
473 Ga0501076_0815548 3300049592 Bacteria 770
474 Ga0501077_0103227 3300049593 Bacteria 1807
475 Ga0501079_0151139 3300049741 Bacteria 1810
476 Ga0501079_0644506 3300049741 Bacteria 834
477 Ga0501080_0384199 3300049742 Bacteria 1265
478 Ga0501080_1008197 3300049742 Bacteria 722
479 Ga0501081_0078364 3300049743 Bacteria 2310
480 Ga0501081_0313857 3300049743 Bacteria 1151
481 Ga0501081_1203915 3300049743 Bacteria 574
482 Ga0501083_0814156 3300049744 Bacteria 608
483 Ga0501045_0609229 3300049824 Bacteria 808
484 nmdc:mga03n38_891353_c1 3300050490 Bacteria 522
485 nmdc:mga0yw44_146252_c1 3300050492 Bacteria 1539
486 nmdc:mga05p37_45608_c1 3300050507 Bacteria 5390
487 nmdc:mga08y16_105502_c1 3300050511 Bacteria 2933
488 nmdc:mga08y16_436237_c1 3300050511 Unclassified 1337
489 nmdc:mga0n895_1871461_c1 3300050512 Bacteria 560
490 nmdc:mga0n895_1871481_c1 3300050512 Bacteria 560
491 nmdc:mga0rr50_153447_c1 3300050513 Bacteria 1864
492 nmdc:mga0a205_848587_c1 3300050515 Bacteria 761
493 Ga0495601_0472141 3300053077 Bacteria 811
494 Ga0495612_0227285 3300053078 Bacteria 827
495 Ga0495655_0082750 3300053083 Bacteria 921
496 Ga0495595_0007381 3300053084 Bacteria 4501
497 Ga0495595_0066670 3300053084 Bacteria 1695
498 Ga0495619_0018625 3300053085 Bacteria 4406
499 Ga0495619_0252291 3300053085 Bacteria 1222
500 Ga0495619_0500823 3300053085 Bacteria 835
501 Ga0495619_0656003 3300053085 Bacteria 715
502 Ga0495619_1075080 3300053085 Bacteria 536
503 Ga0501084_0752243 3300054114 Bacteria 821
504 Ga0590075_142311 3300059424 Bacteria 631
505 Ga0590077_026069 3300059426 Bacteria 1262
506 Ga0501082_0126232 3300060353 Bacteria 2219
507 Ga0501082_0702513 3300060353 Bacteria 885
508 Ga0466962_0069210 3300061719 Bacteria 1686
509 Ga0530510_0218389 3300061734 Bacteria 1417
510 Ga0530510_0728302 3300061734 Bacteria 756
511 Ga0207668_11335070
512 JGI25406J46586_10044822
513 Ga0070658_10173354
514 Ga0070658_10481252
515 Ga0070683_100125312
516 Ga0070683_100703806
517 Ga0070683_101088163
518 Ga0070683_101599910
519 Ga0070680_100179852
520 Ga0070680_101886756
521 Ga0070682_100012964
522 Ga0070682_100077352
523 Ga0070682_100661877
524 Ga0068868_100407008
525 Ga0068868_100793502
526 Ga0070660_100107766
527 Ga0070660_100143402
528 Ga0070660_100706031
529 Ga0070660_101245286
530 Ga0070689_101504536
531 Ga0070691_10012584
532 Ga0070691_10947048
533 Ga0070661_100869778
534 Ga0070675_101700347
535 Ga0070675_101771645
536 Ga0070674_100061962
537 Ga0070674_100246346
538 Ga0070674_101685335
539 Ga0070673_100433485
540 Ga0070667_100019130
541 Ga0070714_100144330
542 Ga0070714_100216149
543 Ga0070714_100560422
544 Ga0070714_100610667
545 Ga0070714_100756213
546 Ga0070713_100923976
547 Ga0070705_100502453
548 Ga0070700_101204189
549 Ga0070708_100391823
550 Ga0070663_101000641
551 Ga0070681_10116980
552 Ga0070681_10185800
553 Ga0070685_10710265
554 Ga0070706_100087694
555 Ga0070707_100366509
556 Ga0070707_101118979
557 Ga0070707_101438342
558 Ga0070699_100656282
559 Ga0070679_100142836
560 Ga0070684_100146359
561 Ga0068853_100652565
562 Ga0070686_100252099
563 Ga0070696_101063735
564 Ga0070696_101338849
565 Ga0068855_100110370
566 Ga0068855_100121757
567 Ga0070664_100241802
568 Ga0070664_100290637
569 Ga0068857_100793515
570 Ga0068856_100033478
571 Ga0068861_102602732
572 Ga0068851_10162413
573 Ga0068858_102111402
574 Ga0068860_102021881
575 Ga0068862_100900156
576 Ga0081455_10020247
577 Ga0081538_10012364
578 Ga0081539_10000294
579 Ga0070717_10001953
580 Ga0075365_10158997
581 Ga0075363_100813756
582 Ga0075363_100895645
583 Ga0070712_100069031
584 Ga0070712_100189346
585 Ga0070712_100263457
586 Ga0068871_100349769
587 Ga0075428_100793048
588 Ga0075433_10005822
589 Ga0075434_100149667
590 Ga0068865_100874371
591 Ga0068865_101222071
592 Ga0068865_101798393
593 Ga0075436_100003253
594 Ga0075435_100159178
595 Ga0105240_10032909
596 Ga0111539_10099399
597 Ga0111539_10468441
598 Ga0111539_10985660
599 Ga0111539_12321299
600 Ga0111539_13324761
601 Ga0105245_10027006
602 Ga0105245_11395516
603 Ga0105247_11057532
604 Ga0114129_10005445
605 Ga0105243_12276607
606 Ga0105242_11132252
607 Ga0105242_12175545
608 Ga0105238_10799717
609 Ga0105238_11485529
610 Ga0105249_11439070
611 Ga0105249_12626112
612 Ga0099796_10248200
613 Ga0105239_11399243
614 Ga0105246_10759635
615 Ga0157373_10656587
616 Ga0157370_10244178
617 Ga0157369_10015605
618 Ga0157369_10514751
619 Ga0157374_10323045
620 Ga0157374_11589620
621 Ga0157374_12199371
622 Ga0157378_11060922
623 Ga0157378_12108268
624 Ga0163162_10567949
625 Ga0163162_11755615
626 Ga0163162_12336900
627 Ga0157372_10086341
628 Ga0157372_10578150
629 Ga0157375_10300499
630 Ga0163163_11150770
631 Ga0157380_10029508
632 Ga0157380_12564880
633 Ga0182008_10893944
634 Ga0157377_10009930
635 Ga0157377_10928636
636 Ga0157377_11594956
637 Ga0197907_11293152
638 Ga0206354_10238170
639 Ga0206353_11841045
640 Ga0206353_11990372
641 Ga0224712_10224281
642 Ga0207685_10520492
643 Ga0207699_10006372
644 Ga0207684_10799236
645 Ga0207695_10713047
646 Ga0207693_10013209
647 Ga0207693_10318935
648 Ga0207693_10688747
649 Ga0207660_10153314
650 Ga0207660_10733490
651 Ga0207662_10765217
652 Ga0207662_10793293
653 Ga0207657_10147365
654 Ga0207657_10867828
655 Ga0207652_11560252
656 Ga0207646_10160758
657 Ga0207646_10924881
658 Ga0207687_10024739
659 Ga0207687_11147258
660 Ga0207700_11651283
661 Ga0207664_10276116
662 Ga0207706_10613825
663 Ga0207686_11728834
664 Ga0207709_10124146
665 Ga0207670_10755189
666 Ga0207669_10023160
667 Ga0207704_10475610
668 Ga0207704_10526400
669 Ga0207689_10195243
670 Ga0207689_10636236
671 Ga0207661_10894053
672 Ga0207679_10811249
673 Ga0207667_10190026
674 Ga0207667_10525853
675 Ga0207712_11407977
676 Ga0207668_10774518
677 Ga0207658_10012243
678 Ga0207658_10661887
679 Ga0207677_10169835
680 Ga0207677_10646143
681 Ga0207677_11486594
682 Ga0207639_10113957
683 Ga0207678_11203560
684 Ga0207678_11252142
685 Ga0207708_10563688
686 Ga0207708_11845402
687 Ga0207702_10261720
688 Ga0207702_11546892
689 Ga0207702_11947287
690 Ga0207648_10197114
691 Ga0207648_10427536
692 Ga0207674_10895404
693 Ga0207675_101050588
694 Ga0207683_11505098
695 Ga0207698_11070032
696 Ga0268266_11640658
697 Ga0268265_10774404
698 Ga0265319_1057414
699 Ga0265318_10151388
700 Ga0265336_10098472
701 Ga0265320_10139293
702 Ga0265320_10209828
703 Ga0307408_100032805
704 Ga0307405_10007193
705 Ga0307410_10105512
706 Ga0307410_11115657
707 Ga0307406_10047440
708 Ga0307406_11198030
709 Ga0307407_10127832
710 Ga0307412_10142513
711 Ga0307409_100277006
712 Ga0307409_100377250
713 Ga0307416_100000355
714 Ga0307415_100007659
715 Ga0373926_0134687
716 Ga0373944_0095428
717 Ga0373944_0253718
718 Ga0373936_0002192
719 Ga0373941_0103243
720 Ga0373945_0004179
721 Ga0373943_0009987
722 Ga0373943_0011298
723 Ga0373946_0012440
724 Ga0373946_0058063
725 Ga0373935_0007897
726 Ga0373935_0409058
727 Ga0373927_0068874
728 Ga0373947_0000066
729 Ga0373947_0133577
730 Ga0373925_0259673
731 Ga0395899_0021814
732 Ga0395899_0026349
733 Ga0395899_0034926
734 Ga0395899_0143443
735 Ga0395899_0219928
736 Ga0395899_0552280
737 Ga0395899_0666336
738 Ga0395899_0687906
739 Ga0395899_0991187
740 Ga0395900_0001593
741 Ga0395900_0004660
742 Ga0395900_0013642
743 Ga0395900_0057669
744 Ga0395900_0067779
745 Ga0395900_0178108
746 Ga0395900_0416739
747 Ga0395900_0609934
748 Ga0395900_1146633
749 Ga0395900_1419495
750 Ga0395900_1504808
751 Ga0395900_1598900
752 Ga0395900_1653345
753 Ga0395900_1732069
754 Ga0395898_0007815
755 Ga0395898_0012044
756 Ga0395898_0040425
757 Ga0395898_0080808
758 Ga0395898_0098669
759 Ga0395898_0156180
760 Ga0395898_0163572
761 Ga0395898_0173349
762 Ga0395898_0341168
763 Ga0395898_0701952
764 Ga0395898_1180925
765 Ga0395898_1278970
766 Ga0395898_1535776
767 Ga0395898_1574539
768 Ga0395905_0004275
769 Ga0395905_0020528
770 Ga0395905_0111255
771 Ga0395905_0158064
772 Ga0395905_0181113
773 Ga0395905_0200353
774 Ga0395905_0255489
775 Ga0395905_0257879
776 Ga0395905_0958749
777 Ga0395905_1058769
778 Ga0395905_1562081
779 Ga0395901_0000904
780 Ga0395901_0006455
781 Ga0395901_0015337
782 Ga0395901_0026319
783 Ga0395901_0062143
784 Ga0395901_0199408
785 Ga0395901_0259055
786 Ga0395901_0363267
787 Ga0395901_0378060
788 Ga0395901_0476244
789 Ga0395901_0596189
790 Ga0395901_0650367
791 Ga0395901_0846422
792 Ga0395901_0963272
793 Ga0395901_1020966
794 Ga0395901_1084293
795 Ga0395901_1146903
796 Ga0451807_0380437
797 Ga0451849_1229132
798 Ga0451853_1014321
799 Ga0451853_3735016
800 Ga0450907_061858
801 Ga0439434_0027014
802 Ga0466966_0446551
803 Ga0466963_0044907
804 Ga0466963_0126622
805 Ga0466964_0085526
806 Ga0466957_0102435
807 Ga0466959_1207414
808 Ga0451576_1966485
809 Ga0466958_0003345
810 Ga0466967_0008183
811 Ga0466967_0025487
812 Ga0466967_0100044
813 Ga0466967_0311842
814 Ga0466967_0493756
815 Ga0466967_0601207
816 Ga0466967_1938221
817 Ga0495592_0725980
818 Ga0495603_0133662
819 Ga0495603_0595270
820 Ga0495629_0000194
821 Ga0495629_0043544
822 Ga0495629_0049631
823 Ga0495629_0127150
824 Ga0495641_0027758
825 Ga0495641_0083789
826 Ga0495651_0031197
827 Ga0495651_0198354
828 Ga0495651_0384480
829 Ga0495651_0610236
830 Ga0495653_0031364
831 Ga0495582_0000317
832 Ga0495582_0475744
833 Ga0495639_0000738
834 Ga0495662_0003759
835 Ga0495594_0037504
836 Ga0495596_0331391
837 Ga0495608_0064754
838 Ga0495608_0238459
839 Ga0495618_0292136
840 Ga0495618_0402617
841 Ga0495628_0108189
842 Ga0495630_0065049
843 Ga0495630_0143468
844 Ga0495630_0460661
845 Ga0495644_0042107
846 Ga0495644_0241390
847 Ga0495666_0111556
848 Ga0495652_0202921
849 Ga0495665_0002372
850 Ga0495640_0059774
851 Ga0495640_0384725
852 Ga0495640_0691964
853 Ga0495586_0339071
854 Ga0495587_0290119
855 Ga0495645_0303701
856 Ga0495667_0017836
857 Ga0495667_0063255
858 Ga0495667_0381400
859 Ga0495656_0264089
860 Ga0495656_0657395
861 Ga0495634_0074750
862 Ga0495634_0100245
863 Ga0495635_0023266
864 Ga0495635_0054524
865 Ga0495635_0070871
866 Ga0495635_0198824
867 Ga0495659_0320899
868 Ga0495588_0296558
869 Ga0495657_0129366
870 Ga0495657_0151629
871 Ga0495646_0105605
872 Ga0495646_0278355
873 Ga0495647_0370644
874 Ga0495658_0000224
875 Ga0495658_0251488
876 Ga0495658_0808193
877 Ga0495613_0001177
878 Ga0495624_0319704
879 Ga0495624_0672079
880 Ga0495670_0222142
881 Ga0495589_0434331
882 Ga0495600_0007311
883 Ga0495600_0456790
884 Ga0495581_0010896
885 Ga0495581_0364370
886 Ga0495604_0320287
887 Ga0495674_0010061
888 Ga0495674_0030216
889 Ga0495674_0234851
890 Ga0495674_0253942
891 Ga0495676_0019416
892 Ga0495676_0039191
893 Ga0495676_0413016
894 Ga0495676_0832314
895 Ga0495676_0835856
896 Ga0495680_0003158
897 Ga0495680_0006155
898 Ga0495680_0025843
899 Ga0495675_0052940
900 Ga0495675_0494326
901 Ga0495684_0030332
902 Ga0495684_0068237
903 Ga0495686_0000003
904 Ga0495593_0015026
905 Ga0495602_0230943
906 Ga0495614_0002669
907 Ga0496100_0177913
908 Ga0496100_0223196
909 Ga0496100_0994045
910 Ga0496101_0031419
911 Ga0496101_0250987
912 Ga0496101_0331661
913 Ga0496101_0504490
914 Ga0496102_0161978
915 Ga0496102_0410183
916 Ga0496103_0193751
917 Ga0496103_0577723
918 Ga0496104_0175049
919 Ga0496104_0190712
920 Ga0496104_0216263
921 Ga0496105_0435837
922 Ga0496105_0507570
923 Ga0496106_0617360
924 Ga0496107_0385269
925 Ga0496108_0034195
926 Ga0496108_0053820
927 Ga0496108_0827570
928 Ga0496108_1285622
929 Ga0496109_0003132
930 Ga0496109_0007538
931 Ga0496109_0359350
932 Ga0496109_0417132
933 Ga0496109_0516935
934 Ga0496109_1725860
935 Ga0496110_0011353
936 Ga0496110_0052819
937 Ga0496110_0466459
938 Ga0496110_0604570
939 Ga0496111_0114459
940 Ga0496111_0738893
941 Ga0496111_0935103
942 Ga0496112_0099982
943 Ga0496113_0111294
944 Ga0496113_0753117
945 Ga0496114_0066499
946 Ga0496114_0170696
947 Ga0496114_0233691
948 Ga0496114_0305381
949 Ga0496114_0748133
950 Ga0496115_0036622
951 Ga0496115_0892423
952 Ga0496115_1002639
953 Ga0496115_1064646
954 Ga0496126_0053682
955 Ga0501031_0500280
956 Ga0501032_0736598
957 Ga0501036_0093241
958 Ga0501036_0236328
959 Ga0501036_0343432
960 Ga0501036_1204629
961 Ga0501039_0260551
962 Ga0501040_0238236
963 Ga0501040_0316621
964 Ga0501040_0322557
965 Ga0501041_0531490
966 Ga0501042_0179556
967 Ga0501043_0944839
968 Ga0501046_0523636
969 Ga0501048_0847439
970 Ga0501067_0068225
971 Ga0501067_0078565
972 Ga0501068_0250454
973 Ga0501071_0081575
974 Ga0501072_0275477
975 Ga0501072_0576132
976 Ga0501072_0850621
977 Ga0501073_1116313
978 Ga0501074_0136063
979 Ga0501075_0912145
980 Ga0501075_1511675
981 Ga0501076_0041331
982 Ga0501076_0320048
983 Ga0501076_0815548
984 Ga0501077_0103227
985 Ga0501079_0151139
986 Ga0501079_0644506
987 Ga0501080_0384199
988 Ga0501080_1008197
989 Ga0501081_0078364
990 Ga0501081_0313857
991 Ga0501081_1203915
992 Ga0501083_0814156
993 Ga0501045_0609229
994 nmdc:mga03n38_891353_c1
995 nmdc:mga0yw44_146252_c1
996 nmdc:mga05p37_45608_c1
997 nmdc:mga08y16_105502_c1
998 nmdc:mga08y16_436237_c1
999 nmdc:mga0n895_1871461_c1
1000 nmdc:mga0n895_1871481_c1
1001 nmdc:mga0rr50_153447_c1
1002 nmdc:mga0a205_848587_c1
1003 Ga0495601_0472141
1004 Ga0495612_0227285
1005 Ga0495655_0082750
1006 Ga0495595_0007381
1007 Ga0495595_0066670
1008 Ga0495619_0018625
1009 Ga0495619_0252291
1010 Ga0495619_0500823
1011 Ga0495619_0656003
1012 Ga0495619_1075080
1013 Ga0501084_0752243
1014 Ga0590075_142311
1015 Ga0590077_026069
1016 Ga0501082_0126232
1017 Ga0501082_0702513
1018 Ga0466962_0069210
1019 Ga0530510_0218389
1020 Ga0530510_0728302

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02700

PurS

Phosphoribosylformylglycinamidine (FGAM) synthase

2

77

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vq3-assembly1.cif.gz_C crystal structure of phosphoribosylformylglycinamidine synthase, purs subunit (ec 6.3.5.3) (tm1244) from thermotoga maritima at 1.90 a resolution 0.8859 2 76
3d54-assembly1.cif.gz_J structure of purlqs from thermotoga maritima 0.8606 2 76
2zw2-assembly1.cif.gz_B crystal structure of formylglycinamide ribonucleotide amidotransferase iii from sulfolobus tokodaii (stpurs) 0.8551 2 81
2zw2-assembly1.cif.gz_B crystal structure of formylglycinamide ribonucleotide amidotransferase iii from sulfolobus tokodaii (stpurs) 0.8364 2 81
2dgb-assembly1.cif.gz_D structure of thermus thermophilus purs in the p21 form 0.8208 2 79
ID Description Score Start End Superfamily
af_Q2FZJ2_1_81_3.30.1280.10 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.8673 2 79 3.30.1280.10
3d54J00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.8606 2 76 3.30.1280.10
2zw2B00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.8551 2 81 3.30.1280.10
2zw2B00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.8364 2 81 3.30.1280.10
2yx5A00 Alpha Beta;2-Layer Sandwich;Mth169; Chain: A ,;Phosphoribosylformylglycinamidine synthase subunit PurS 0.8178 2 81 3.30.1280.10
ID Description Score Start End GO Terms
AF-A0A7V9P6Z0-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS 0.9407 1 64 GO:0004642
GO:0005524
GO:0005737
GO:0009152
AF-A0A7W1JHW0-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.9393 1 79 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A7V9M9G2-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.9358 1 78 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A1E4BC96-F1-model_v4 Phosphoribosylformylglycinamidine synthase subunit PurS (FGAM synthase) (EC 6.3.5.3) (Formylglycinamide ribonucleotide amidotransferase subunit III) (FGAR amidotransferase III) (FGAR-AT III) (Phosphoribosylformylglycinamidine synthase subunit III) 0.932 2 75 GO:0004642
GO:0005524
GO:0005737
GO:0006189
AF-A0A6N8ZFD8-F1-model_v4 deleted 0.9312 4 81

Map