F457119

General Info

Members Datasets Scaffolds Average Seq Length
510 232 510 160

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10072489|Ga0111539_100724894
Length 192
Sequence MPTFEVSAHMTVRPGQLEEFKKQAMRLPTEGPMTTTSLETKVHDFLSQKRIAVAGVSRHNSDHPVGNLIYQRLKKTGHDVFPVNPHMQTFEGDRCYRDLQSIPGGVDGVVIITRPEVTERIVHDCSDAGVRRVWMHQSLGKGSSVSQKAVTYCHQHDISVIAGACPMMYGDGVDVGHTCMRWILKFTGGLPT

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
148 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
162 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
163 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
166 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
187 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
210 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
211 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
212 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
213 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
216 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
217 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
231 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
232 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.39
Nodule 0
Rhizoplane 4.9
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3088676 2162886007 Unclassified 1331
2 Ga0065704_10090590 3300005289 Viruses 2776
3 Ga0065704_10133022 3300005289 Unclassified 1605
4 Ga0065704_10205014 3300005289 Unclassified 1131
5 Ga0065704_10369352 3300005289 Bacteria 787
6 Ga0065704_10805525 3300005289 Unclassified 523
7 Ga0065712_10076400 3300005290 Bacteria 3663
8 Ga0065712_10077821 3300005290 Bacteria 3437
9 Ga0065712_10135983 3300005290 Unclassified 1497
10 Ga0065712_10206312 3300005290 Unclassified 1080
11 Ga0065712_10230908 3300005290 Unclassified 1011
12 Ga0065715_10035530 3300005293 Bacteria 1498
13 Ga0065715_10114683 3300005293 Unclassified 2442
14 Ga0065715_10192838 3300005293 Unclassified 1388
15 Ga0065715_11039474 3300005293 Unclassified 535
16 Ga0065707_10002467 3300005295 Bacteria 4561
17 Ga0065707_10090251 3300005295 Bacteria 4181
18 Ga0065707_10112338 3300005295 Bacteria 2364
19 Ga0065707_10119449 3300005295 Bacteria 2159
20 Ga0065707_10181474 3300005295 Unclassified 1416
21 Ga0070676_10124225 3300005328 Bacteria 1624
22 Ga0070676_10161421 3300005328 Bacteria 1443
23 Ga0070676_10182179 3300005328 Bacteria 1366
24 Ga0070683_100012348 3300005329 Bacteria 7421
25 Ga0070690_100038567 3300005330 Unclassified 3016
26 Ga0070690_100062898 3300005330 Archaea 2394
27 Ga0070690_100112222 3300005330 Unclassified 1820
28 Ga0070670_100009539 3300005331 Bacteria 8282
29 Ga0070670_100049097 3300005331 Unclassified 3630
30 Ga0070670_100082507 3300005331 Unclassified 2762
31 Ga0070670_100223008 3300005331 Bacteria 1640
32 Ga0068869_100024646 3300005334 Unclassified 4169
33 Ga0070666_10647351 3300005335 Unclassified 773
34 Ga0070680_100344312 3300005336 Unclassified 1267
35 Ga0070680_100715597 3300005336 Unclassified 862
36 Ga0070680_101172955 3300005336 Unclassified 664
37 Ga0070682_100247141 3300005337 Bacteria 1284
38 Ga0068868_100498629 3300005338 Bacteria 1066
39 Ga0068868_100977664 3300005338 Unclassified 773
40 Ga0070689_100020229 3300005340 Bacteria 4937
41 Ga0070689_100044284 3300005340 Unclassified 3423
42 Ga0070689_100074187 3300005340 Bacteria 2662
43 Ga0070689_100149752 3300005340 Unclassified 1881
44 Ga0070689_100854302 3300005340 Unclassified 803
45 Ga0070687_100006294 3300005343 Unclassified 4861
46 Ga0070687_100014411 3300005343 Bacteria 3550
47 Ga0070687_100194129 3300005343 Unclassified 1225
48 Ga0070661_100018541 3300005344 Bacteria 4949
49 Ga0070669_100005982 3300005353 Bacteria 8779
50 Ga0070669_100228836 3300005353 Bacteria 1473
51 Ga0070669_100308479 3300005353 Bacteria 1275
52 Ga0070675_100000986 3300005354 Bacteria 20361
53 Ga0070675_100002041 3300005354 Bacteria 14983
54 Ga0070675_100018445 3300005354 Bacteria 5554
55 Ga0070675_100106288 3300005354 Bacteria 2369
56 Ga0070675_100168866 3300005354 Unclassified 1885
57 Ga0070671_100007092 3300005355 Bacteria 8968
58 Ga0070671_100038808 3300005355 Bacteria 3952
59 Ga0070671_100731953 3300005355 Bacteria 859
60 Ga0070673_100003385 3300005364 Bacteria 9921
61 Ga0070673_100052842 3300005364 Bacteria 3189
62 Ga0070673_101378274 3300005364 Unclassified 663
63 Ga0070673_101422655 3300005364 Bacteria 653
64 Ga0070688_100292761 3300005365 Bacteria 1174
65 Ga0070688_100340371 3300005365 Unclassified 1095
66 Ga0070667_100329593 3300005367 Bacteria 1379
67 Ga0070709_10310538 3300005434 Unclassified 1154
68 Ga0070713_101658390 3300005436 Unclassified 621
69 Ga0070701_10005894 3300005438 Bacteria 5112
70 Ga0070701_10007601 3300005438 Bacteria 4642
71 Ga0070701_10106543 3300005438 Unclassified 1560
72 Ga0070705_100048143 3300005440 Unclassified 2468
73 Ga0070705_100096623 3300005440 Bacteria 1855
74 Ga0070705_100108218 3300005440 Bacteria 1770
75 Ga0070705_100162700 3300005440 Bacteria 1494
76 Ga0070700_100008129 3300005441 Bacteria 5705
77 Ga0070700_100582763 3300005441 Unclassified 874
78 Ga0070694_100004550 3300005444 Bacteria 8338
79 Ga0070694_100014770 3300005444 Unclassified 4893
80 Ga0070694_100357140 3300005444 Unclassified 1134
81 Ga0070694_100775323 3300005444 Unclassified 785
82 Ga0070663_100640053 3300005455 Unclassified 898
83 Ga0070678_100064102 3300005456 Unclassified 2722
84 Ga0070678_100158896 3300005456 Unclassified 1829
85 Ga0070662_100088587 3300005457 Archaea 2320
86 Ga0070662_100310603 3300005457 Bacteria 1283
87 Ga0068867_100005805 3300005459 Bacteria 8757
88 Ga0070685_10162624 3300005466 Unclassified 1424
89 Ga0070707_100396057 3300005468 Bacteria 1341
90 Ga0070698_100009951 3300005471 Bacteria 10166
91 Ga0070698_100977811 3300005471 Unclassified 793
92 Ga0070699_100012987 3300005518 Bacteria 7176
93 Ga0070699_100027731 3300005518 Bacteria 4884
94 Ga0070679_100527877 3300005530 Unclassified 1124
95 Ga0070679_100890820 3300005530 Bacteria 833
96 Ga0070684_100000479 3300005535 Bacteria 27366
97 Ga0070684_100413088 3300005535 Bacteria 1245
98 Ga0068853_100491607 3300005539 Unclassified 1158
99 Ga0070672_100043908 3300005543 Unclassified 3450
100 Ga0070672_100160722 3300005543 Bacteria 1863
101 Ga0070672_100208728 3300005543 Bacteria 1635
102 Ga0070686_100015821 3300005544 Bacteria 4380
103 Ga0070686_100017736 3300005544 Unclassified 4166
104 Ga0070686_100017881 3300005544 Bacteria 4150
105 Ga0070695_100312809 3300005545 Bacteria 1165
106 Ga0070696_100146826 3300005546 Archaea 1728
107 Ga0070696_100163895 3300005546 Bacteria 1639
108 Ga0070693_100538853 3300005547 Unclassified 834
109 Ga0070665_100031212 3300005548 Bacteria 5363
110 Ga0070665_101147977 3300005548 Unclassified 788
111 Ga0070704_100001470 3300005549 Bacteria 12643
112 Ga0070704_100006326 3300005549 Bacteria 6976
113 Ga0070704_100015712 3300005549 Bacteria 4765
114 Ga0070704_100182418 3300005549 Bacteria 1680
115 Ga0068855_101007311 3300005563 Unclassified 875
116 Ga0070664_100000224 3300005564 Bacteria 40566
117 Ga0070664_100337048 3300005564 Bacteria 1369
118 Ga0070664_100509357 3300005564 Unclassified 1110
119 Ga0070664_100529458 3300005564 Bacteria 1088
120 Ga0068857_100004602 3300005577 Bacteria 11681
121 Ga0068857_100004763 3300005577 Bacteria 11490
122 Ga0068857_100044463 3300005577 Bacteria 3940
123 Ga0068854_100662665 3300005578 Unclassified 897
124 Ga0068856_100013428 3300005614 Bacteria 7930
125 Ga0070702_100045231 3300005615 Bacteria 2489
126 Ga0068859_100000433 3300005617 Bacteria 41951
127 Ga0068859_100000798 3300005617 Bacteria 31967
128 Ga0068859_100015181 3300005617 Bacteria 7731
129 Ga0068859_100062881 3300005617 Bacteria 3742
130 Ga0068859_100761657 3300005617 Unclassified 1057
131 Ga0068859_100848241 3300005617 Unclassified 1000
132 Ga0068859_101537039 3300005617 Unclassified 735
133 Ga0068859_102144960 3300005617 Unclassified 617
134 Ga0068864_100036386 3300005618 Bacteria 4196
135 Ga0068864_100042123 3300005618 Unclassified 3907
136 Ga0068864_100351717 3300005618 Unclassified 1390
137 Ga0068864_101368594 3300005618 Bacteria 709
138 Ga0068861_100000410 3300005719 Bacteria 24782
139 Ga0068861_101161007 3300005719 Unclassified 745
140 Ga0068870_10019235 3300005840 Unclassified 3310
141 Ga0068870_10043714 3300005840 Bacteria 2338
142 Ga0068870_10595939 3300005840 Unclassified 750
143 Ga0068870_10796930 3300005840 Unclassified 660
144 Ga0068863_100008826 3300005841 Bacteria 9845
145 Ga0068863_100024545 3300005841 Bacteria 5749
146 Ga0068863_100303900 3300005841 Bacteria 1548
147 Ga0068858_100009270 3300005842 Bacteria 9399
148 Ga0068858_100080818 3300005842 Bacteria 3021
149 Ga0068858_100095721 3300005842 Unclassified 2766
150 Ga0068858_100193047 3300005842 Unclassified 1924
151 Ga0068858_100482799 3300005842 Bacteria 1196
152 Ga0068860_100002194 3300005843 Bacteria 20537
153 Ga0068860_100160310 3300005843 Bacteria 2169
154 Ga0068860_101246694 3300005843 Unclassified 764
155 Ga0068862_100002592 3300005844 Bacteria 15960
156 Ga0081455_10061305 3300005937 Unclassified 3166
157 Ga0081455_10309608 3300005937 Bacteria 1129
158 Ga0075366_10505933 3300006195 Unclassified 747
159 Ga0097621_100087228 3300006237 Unclassified 2605
160 Ga0097621_100269936 3300006237 Unclassified 1494
161 Ga0068871_100353190 3300006358 Unclassified 1301
162 Ga0068871_100436145 3300006358 Bacteria 1172
163 Ga0068871_102335418 3300006358 Unclassified 510
164 Ga0075428_100019283 3300006844 Bacteria 7548
165 Ga0075428_100339156 3300006844 Unclassified 1614
166 Ga0075428_100652730 3300006844 Bacteria 1122
167 Ga0075428_101173985 3300006844 Unclassified 810
168 Ga0075428_101598658 3300006844 Unclassified 682
169 Ga0075430_100548634 3300006846 Bacteria 953
170 Ga0075431_100381713 3300006847 Unclassified 1413
171 Ga0075431_100384006 3300006847 Bacteria 1408
172 Ga0075433_10045029 3300006852 Bacteria 3834
173 Ga0075433_10089891 3300006852 Bacteria 2714
174 Ga0075433_10182879 3300006852 Unclassified 1865
175 Ga0075433_10234302 3300006852 Bacteria 1630
176 Ga0075433_10694074 3300006852 Unclassified 892
177 Ga0075434_100013394 3300006871 Bacteria 7802
178 Ga0075434_100081445 3300006871 Bacteria 3234
179 Ga0075434_100249579 3300006871 Bacteria 1794
180 Ga0075434_100270957 3300006871 Bacteria 1717
181 Ga0075434_101418807 3300006871 Bacteria 704
182 Ga0075429_100003426 3300006880 Bacteria 13527
183 Ga0075429_100132596 3300006880 Unclassified 2180
184 Ga0075429_100328555 3300006880 Bacteria 1338
185 Ga0075429_100958904 3300006880 Unclassified 748
186 Ga0068865_100219105 3300006881 Bacteria 1487
187 Ga0068865_100469302 3300006881 Unclassified 1044
188 Ga0097620_100000433 3300006931 Bacteria 41951
189 Ga0097620_100000798 3300006931 Bacteria 31967
190 Ga0097620_100015182 3300006931 Bacteria 7731
191 Ga0097620_100062882 3300006931 Bacteria 3742
192 Ga0097620_100761678 3300006931 Unclassified 1057
193 Ga0097620_100848306 3300006931 Unclassified 1000
194 Ga0097620_101536910 3300006931 Unclassified 735
195 Ga0097620_102144989 3300006931 Unclassified 617
196 Ga0075435_100087233 3300007076 Bacteria 2571
197 Ga0075435_100095462 3300007076 Bacteria 2459
198 Ga0105240_10303304 3300009093 Bacteria 1826
199 Ga0111539_10027564 3300009094 Bacteria 6938
200 Ga0111539_10032854 3300009094 Bacteria 6301
201 Ga0111539_10040795 3300009094 Bacteria 5585
202 Ga0111539_10072489 3300009094 Bacteria 4061
203 Ga0111539_10194034 3300009094 Unclassified 2369
204 Ga0111539_10265851 3300009094 Bacteria 1997
205 Ga0111539_10470478 3300009094 Bacteria 1463
206 Ga0111539_10656559 3300009094 Unclassified 1221
207 Ga0105245_11110743 3300009098 Bacteria 837
208 Ga0114129_10004473 3300009147 Bacteria 19707
209 Ga0114129_10105684 3300009147 Bacteria 3890
210 Ga0114129_10336817 3300009147 Bacteria 2002
211 Ga0114129_10736005 3300009147 Bacteria 1264
212 Ga0114129_12287474 3300009147 Unclassified 649
213 Ga0105243_10020707 3300009148 Unclassified 4989
214 Ga0105243_10061887 3300009148 Unclassified 2995
215 Ga0105243_10465040 3300009148 Bacteria 1190
216 Ga0105243_11643903 3300009148 Unclassified 670
217 Ga0105241_10023260 3300009174 Bacteria 4595
218 Ga0105241_10234022 3300009174 Bacteria 1550
219 Ga0105242_10163510 3300009176 Bacteria 1950
220 Ga0105248_10212309 3300009177 Unclassified 2181
221 Ga0105248_10450946 3300009177 Unclassified 1449
222 Ga0105248_10787752 3300009177 Bacteria 1073
223 Ga0105237_10062111 3300009545 Bacteria 3735
224 Ga0105238_10158825 3300009551 Bacteria 2236
225 Ga0105249_10002389 3300009553 Bacteria 16296
226 Ga0105249_11045713 3300009553 Unclassified 886
227 Ga0105239_10006592 3300010375 Bacteria 13446
228 Ga0105246_10350923 3300011119 Unclassified 1209
229 Ga0157374_10124574 3300013296 Unclassified 2490
230 Ga0157374_10156025 3300013296 Unclassified 2221
231 Ga0157374_10680092 3300013296 Bacteria 1041
232 Ga0157374_11608174 3300013296 Unclassified 674
233 Ga0157378_10120473 3300013297 Unclassified 2418
234 Ga0157378_10124213 3300013297 Unclassified 2383
235 Ga0163162_10080403 3300013306 Unclassified 3327
236 Ga0163162_10774470 3300013306 Unclassified 1078
237 Ga0163162_11063583 3300013306 Unclassified 916
238 Ga0163162_11240843 3300013306 Unclassified 846
239 Ga0157375_10005046 3300013308 Bacteria 11463
240 Ga0157375_10082232 3300013308 Bacteria 3262
241 Ga0157375_10407230 3300013308 Bacteria 1526
242 Ga0157375_10652919 3300013308 Unclassified 1208
243 Ga0163163_10012751 3300014325 Bacteria 7668
244 Ga0163163_10031311 3300014325 Bacteria 5133
245 Ga0163163_10350949 3300014325 Bacteria 1531
246 Ga0157380_10009141 3300014326 Bacteria 7088
247 Ga0157380_10242903 3300014326 Bacteria 1625
248 Ga0157380_11442916 3300014326 Unclassified 740
249 Ga0182008_10008707 3300014497 Bacteria 5519
250 Ga0157377_10030046 3300014745 Bacteria 2940
251 Ga0157377_10055129 3300014745 Bacteria 2253
252 Ga0157379_10063954 3300014968 Unclassified 3289
253 Ga0157379_10745607 3300014968 Unclassified 922
254 Ga0157376_10284678 3300014969 Bacteria 1558
255 Ga0157376_10462285 3300014969 Unclassified 1240
256 Ga0207642_10180907 3300025899 Unclassified 1149
257 Ga0207680_10361278 3300025903 Unclassified 1021
258 Ga0207680_10468029 3300025903 Bacteria 896
259 Ga0207699_10252557 3300025906 Unclassified 1216
260 Ga0207645_10129073 3300025907 Bacteria 1645
261 Ga0207643_10021930 3300025908 Unclassified 3514
262 Ga0207643_10818658 3300025908 Unclassified 603
263 Ga0207654_10007936 3300025911 Bacteria 5353
264 Ga0207671_10046960 3300025914 Bacteria 3195
265 Ga0207660_10265018 3300025917 Unclassified 1360
266 Ga0207662_10015989 3300025918 Unclassified 4229
267 Ga0207662_10145980 3300025918 Unclassified 1502
268 Ga0207649_10011382 3300025920 Bacteria 4906
269 Ga0207652_10815989 3300025921 Bacteria 828
270 Ga0207646_10678010 3300025922 Unclassified 922
271 Ga0207681_10006926 3300025923 Bacteria 6955
272 Ga0207681_10170655 3300025923 Bacteria 1648
273 Ga0207681_10205691 3300025923 Bacteria 1514
274 Ga0207650_10035621 3300025925 Bacteria 3616
275 Ga0207650_10071451 3300025925 Unclassified 2611
276 Ga0207650_10122474 3300025925 Unclassified 2027
277 Ga0207650_10130150 3300025925 Unclassified 1968
278 Ga0207650_10314577 3300025925 Bacteria 1281
279 Ga0207650_10892687 3300025925 Unclassified 755
280 Ga0207659_10000770 3300025926 Bacteria 18992
281 Ga0207659_10002736 3300025926 Bacteria 10521
282 Ga0207659_10012559 3300025926 Bacteria 5393
283 Ga0207659_10031252 3300025926 Unclassified 3643
284 Ga0207659_10316852 3300025926 Bacteria 1285
285 Ga0207659_11180668 3300025926 Unclassified 658
286 Ga0207644_10015899 3300025931 Bacteria 5060
287 Ga0207706_10025310 3300025933 Bacteria 5319
288 Ga0207706_10142367 3300025933 Bacteria 2109
289 Ga0207706_10350575 3300025933 Bacteria 1284
290 Ga0207686_10558823 3300025934 Unclassified 896
291 Ga0207709_10159481 3300025935 Unclassified 1571
292 Ga0207709_10220619 3300025935 Unclassified 1367
293 Ga0207670_10010541 3300025936 Bacteria 5331
294 Ga0207670_10060926 3300025936 Bacteria 2573
295 Ga0207670_10098152 3300025936 Unclassified 2087
296 Ga0207670_10357511 3300025936 Bacteria 1158
297 Ga0207670_10564760 3300025936 Bacteria 931
298 Ga0207670_10684772 3300025936 Unclassified 848
299 Ga0207691_10027473 3300025940 Bacteria 5334
300 Ga0207691_10134701 3300025940 Bacteria 2180
301 Ga0207711_10064517 3300025941 Unclassified 3164
302 Ga0207711_10118958 3300025941 Unclassified 2357
303 Ga0207689_10089597 3300025942 Unclassified 2527
304 Ga0207689_10485344 3300025942 Bacteria 1035
305 Ga0207679_10006534 3300025945 Bacteria 7370
306 Ga0207679_10177531 3300025945 Unclassified 1759
307 Ga0207679_10497131 3300025945 Bacteria 1088
308 Ga0207679_11308111 3300025945 Unclassified 665
309 Ga0207667_10739093 3300025949 Unclassified 984
310 Ga0207667_11117062 3300025949 Unclassified 771
311 Ga0207651_10063719 3300025960 Bacteria 2576
312 Ga0207651_10066444 3300025960 Archaea 2534
313 Ga0207651_10181689 3300025960 Bacteria 1669
314 Ga0207651_10223885 3300025960 Bacteria 1523
315 Ga0207651_10347290 3300025960 Unclassified 1248
316 Ga0207651_10684851 3300025960 Unclassified 902
317 Ga0207651_10874895 3300025960 Unclassified 799
318 Ga0207712_10004314 3300025961 Bacteria 8979
319 Ga0207640_10343865 3300025981 Unclassified 1196
320 Ga0207658_10129666 3300025986 Unclassified 2024
321 Ga0207677_10403326 3300026023 Unclassified 1160
322 Ga0207677_10469562 3300026023 Bacteria 1082
323 Ga0207703_10019674 3300026035 Bacteria 5277
324 Ga0207703_10074719 3300026035 Unclassified 2807
325 Ga0207703_10090141 3300026035 Unclassified 2576
326 Ga0207703_10181006 3300026035 Bacteria 1860
327 Ga0207703_10603746 3300026035 Unclassified 1038
328 Ga0207678_10641558 3300026067 Unclassified 933
329 Ga0207708_10012999 3300026075 Bacteria 6210
330 Ga0207708_10171814 3300026075 Bacteria 1717
331 Ga0207708_10964025 3300026075 Unclassified 740
332 Ga0207702_10060059 3300026078 Unclassified 3240
333 Ga0207641_10005559 3300026088 Bacteria 10744
334 Ga0207641_10013677 3300026088 Bacteria 6659
335 Ga0207641_10256554 3300026088 Bacteria 1635
336 Ga0207641_10983816 3300026088 Unclassified 840
337 Ga0207648_10000835 3300026089 Bacteria 34699
338 Ga0207676_10005398 3300026095 Bacteria 9048
339 Ga0207676_10067593 3300026095 Bacteria 2855
340 Ga0207676_10234101 3300026095 Unclassified 1644
341 Ga0207676_11333095 3300026095 Unclassified 713
342 Ga0207674_10008418 3300026116 Bacteria 11914
343 Ga0207674_10051361 3300026116 Unclassified 4208
344 Ga0207674_10074590 3300026116 Bacteria 3404
345 Ga0207674_10190424 3300026116 Bacteria 2001
346 Ga0207675_100001637 3300026118 Bacteria 22454
347 Ga0207675_100308191 3300026118 Unclassified 1543
348 Ga0207683_10196133 3300026121 Unclassified 1835
349 Ga0207683_10250202 3300026121 Bacteria 1617
350 Ga0207683_10557739 3300026121 Bacteria 1059
351 Ga0207683_10692983 3300026121 Unclassified 944
352 Ga0207698_11263048 3300026142 Unclassified 753
353 Ga0209966_1029147 3300027695 Bacteria 1111
354 Ga0207428_10007529 3300027907 Bacteria 9921
355 Ga0207428_10017908 3300027907 Bacteria 6071
356 Ga0207428_10434271 3300027907 Bacteria 958
357 Ga0207428_10438167 3300027907 Unclassified 954
358 Ga0268266_10702925 3300028379 Bacteria 974
359 Ga0268265_10001817 3300028380 Bacteria 17054
360 Ga0268265_10150559 3300028380 Unclassified 1962
361 Ga0268265_11326346 3300028380 Unclassified 720
362 Ga0268264_10013880 3300028381 Bacteria 6624
363 Ga0268264_10797462 3300028381 Unclassified 943
364 Ga0265325_10032343 3300031241 Bacteria 2793
365 Ga0307416_100480102 3300032002 Unclassified 1303
366 Ga0307415_100820644 3300032126 Unclassified 851
367 Ga0373958_0103095 3300034819 Unclassified 672
368 Ga0373940_0127299 3300035088 Unclassified 795
369 Ga0373939_0034695 3300035114 Unclassified 1482
370 Ga0373939_0037632 3300035114 Unclassified 1438
371 Ga0373941_0121447 3300035115 Unclassified 932
372 Ga0373942_0115007 3300035207 Unclassified 835
373 Ga0373961_0107574 3300035241 Unclassified 910
374 Ga0373962_0266805 3300035242 Unclassified 599
375 Ga0373931_0109025 3300035691 Bacteria 1568
376 Ga0373931_0471889 3300035691 Unclassified 805
377 Ga0373931_1115098 3300035691 Unclassified 538
378 Ga0373935_0828832 3300035692 Unclassified 684
379 Ga0373927_0054818 3300035695 Bacteria 2579
380 Ga0373925_0866208 3300037068 Bacteria 745
381 Ga0439436_0043417 3300041404 Unclassified 1283
382 Ga0439436_0180364 3300041404 Unclassified 601
383 Ga0439453_0009502 3300041408 Bacteria 1586
384 Ga0439461_0040446 3300041410 Unclassified 1005
385 Ga0439433_0051680 3300041999 Unclassified 970
386 Ga0450898_107680 3300042134 Bacteria 587
387 Ga0439435_0037185 3300042436 Bacteria 1348
388 Ga0451577_0226523 3300042876 Bacteria 1690
389 Ga0451577_0619416 3300042876 Bacteria 982
390 Ga0453683_0351423 3300044673 Unclassified 947
391 Ga0451576_0005215 3300045051 Bacteria 16411
392 Ga0451576_0044829 3300045051 Unclassified 4659
393 Ga0451576_0070771 3300045051 Bacteria 3630
394 Ga0451576_0146163 3300045051 Unclassified 2465
395 Ga0451576_0295705 3300045051 Bacteria 1693
396 Ga0451576_0620729 3300045051 Unclassified 1136
397 Ga0451576_0933430 3300045051 Bacteria 910
398 Ga0451576_1659755 3300045051 Unclassified 662
399 Ga0495580_0143259 3300046472 Unclassified 1657
400 Ga0495580_0156359 3300046472 Bacteria 1579
401 Ga0495580_0238096 3300046472 Bacteria 1248
402 Ga0495582_0126677 3300046473 Bacteria 1441
403 Ga0495582_0312448 3300046473 Unclassified 904
404 Ga0495584_0311074 3300046491 Bacteria 800
405 Ga0495584_0325433 3300046491 Unclassified 781
406 Ga0495594_0006593 3300046499 Bacteria 5973
407 Ga0495594_0534863 3300046499 Unclassified 665
408 Ga0495630_0787489 3300046517 Unclassified 726
409 Ga0495663_0018268 3300046525 Unclassified 1996
410 Ga0495666_0240945 3300046526 Unclassified 825
411 Ga0495598_0104831 3300046537 Bacteria 940
412 Ga0495621_0003475 3300046539 Bacteria 4348
413 Ga0495621_0067042 3300046539 Unclassified 1314
414 Ga0495621_0161414 3300046539 Unclassified 886
415 Ga0495621_0219504 3300046539 Unclassified 769
416 Ga0495633_0180091 3300046558 Bacteria 973
417 Ga0495668_0257533 3300046616 Bacteria 955
418 Ga0495635_0025402 3300046663 Bacteria 4126
419 Ga0495659_0014502 3300046664 Bacteria 2580
420 Ga0495659_0110240 3300046664 Bacteria 1074
421 Ga0495659_0172628 3300046664 Bacteria 877
422 Ga0495658_0115588 3300046683 Bacteria 1617
423 Ga0495669_0010253 3300046684 Bacteria 3959
424 Ga0495613_0008197 3300046689 Bacteria 7762
425 Ga0495581_0300358 3300047315 Unclassified 938
426 Ga0495636_0046342 3300047318 Bacteria 1813
427 Ga0495636_0126588 3300047318 Bacteria 1134
428 Ga0495684_0316687 3300047471 Bacteria 1116
429 Ga0495614_0141589 3300048089 Unclassified 1069
430 Ga0495615_0003580 3300048090 Unclassified 2618
431 Ga0496100_1208252 3300048903 Unclassified 596
432 Ga0496101_0337195 3300048904 Unclassified 1184
433 Ga0496102_0780644 3300048905 Unclassified 878
434 Ga0496104_0070351 3300048907 Bacteria 3326
435 Ga0496105_0018911 3300048908 Bacteria 5549
436 Ga0496105_0535813 3300048908 Unclassified 916
437 Ga0496106_0124214 3300048909 Bacteria 2020
438 Ga0496106_0260457 3300048909 Bacteria 1388
439 Ga0496106_0827424 3300048909 Unclassified 734
440 Ga0496107_0740275 3300048910 Unclassified 722
441 Ga0496108_0010091 3300048911 Bacteria 7663
442 Ga0496108_0423589 3300048911 Bacteria 1163
443 Ga0496108_0790263 3300048911 Unclassified 819
444 Ga0496109_0001912 3300048912 Bacteria 17308
445 Ga0496109_0280632 3300048912 Bacteria 1570
446 Ga0496109_1485880 3300048912 Unclassified 613
447 Ga0496110_0001931 3300048913 Bacteria 15354
448 Ga0496110_0049047 3300048913 Bacteria 3703
449 Ga0496111_0006720 3300048914 Bacteria 7487
450 Ga0496111_0335506 3300048914 Bacteria 1119
451 Ga0496112_0001225 3300048915 Bacteria 19326
452 Ga0496112_1417732 3300048915 Unclassified 609
453 Ga0496113_0474947 3300048916 Unclassified 1005
454 Ga0496114_1211674 3300048917 Unclassified 641
455 Ga0496115_0102871 3300048918 Unclassified 2343
456 Ga0501040_0097927 3300049576 Bacteria 2044
457 Ga0501041_0285976 3300049577 Bacteria 1038
458 Ga0501046_0655589 3300049580 Unclassified 742
459 Ga0501071_0221702 3300049587 Unclassified 1423
460 Ga0501072_0167572 3300049588 Bacteria 1753
461 Ga0501072_0180189 3300049588 Bacteria 1685
462 Ga0501076_0161214 3300049592 Bacteria 1827
463 Ga0501076_0823293 3300049592 Bacteria 766
464 Ga0501076_0940321 3300049592 Unclassified 712
465 Ga0501217_148994 3300049661 Unclassified 698
466 Ga0501228_013915 3300049666 Unclassified 844
467 Ga0501249_047856 3300049679 Unclassified 978
468 Ga0501255_013500 3300049684 Bacteria 971
469 Ga0501256_010495 3300049685 Bacteria 885
470 Ga0501081_0092720 3300049743 Unclassified 2126
471 Ga0501081_0518242 3300049743 Unclassified 889
472 Ga0501265_056374 3300049762 Unclassified 631
473 Ga0501271_033103 3300049768 Bacteria 647
474 Ga0501276_007796 3300049773 Unclassified 862
475 Ga0501045_0796043 3300049824 Unclassified 696
476 nmdc:mga07m45_652593_c1 3300050496 Bacteria 606
477 nmdc:mga05p37_109336_c1 3300050507 Bacteria 3401
478 nmdc:mga05p37_1845264_c1 3300050507 Bacteria 581
479 nmdc:mga05p37_48_c1 3300050507 Bacteria 104863
480 nmdc:mga05p37_578625_c1 3300050507 Bacteria 1272
481 nmdc:mga09592_312380_c1 3300050508 Bacteria 1362
482 nmdc:mga09592_335156_c1 3300050508 Bacteria 1310
483 nmdc:mga09592_649796_c1 3300050508 Bacteria 900
484 nmdc:mga06r32_317197_c1 3300050510 Unclassified 1544
485 nmdc:mga06r32_660488_c1 3300050510 Bacteria 1013
486 nmdc:mga08y16_14177_c1 3300050511 Bacteria 8388
487 nmdc:mga08y16_324229_c1 3300050511 Bacteria 1585
488 nmdc:mga08y16_41946_c1 3300050511 Unclassified 4792
489 nmdc:mga08y16_447573_c1 3300050511 Bacteria 1317
490 nmdc:mga08y16_509981_c1 3300050511 Bacteria 1221
491 nmdc:mga08y16_815807_c1 3300050511 Bacteria 925
492 nmdc:mga08y16_825751_c1 3300050511 Bacteria 918
493 nmdc:mga08y16_9646_c1 3300050511 Bacteria 10137
494 nmdc:mga0n895_235974_c1 3300050512 Bacteria 1856
495 nmdc:mga0n895_342004_c1 3300050512 Bacteria 1515
496 nmdc:mga0n895_5270_c1 3300050512 Bacteria 10271
497 nmdc:mga0n895_581688_c1 3300050512 Unclassified 1123
498 nmdc:mga0n895_59800_c1 3300050512 Bacteria 3760
499 nmdc:mga0n895_758334_c1 3300050512 Unclassified 963
500 nmdc:mga0rr50_17008_c1 3300050513 Bacteria 4844
501 nmdc:mga0rr50_203056_c1 3300050513 Bacteria 1629
502 nmdc:mga0a205_17976_c1 3300050515 Bacteria 6639
503 nmdc:mga0a205_24686_c1 3300050515 Bacteria 5719
504 nmdc:mga0a205_270454_c1 3300050515 Bacteria 1576
505 Ga0495601_0035163 3300053077 Bacteria 3126
506 Ga0495619_0472777 3300053085 Bacteria 863
507 Ga0590071_000079 3300059421 Bacteria 26516
508 Ga0590074_000280 3300059423 Bacteria 6888
509 Ga0590075_000048 3300059424 Bacteria 31197
510 Ga0590077_000030 3300059426 Bacteria 33448

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013296 Ga0157374_11608174 Ga0157374_116081742 140
2 3300041404 Ga0439436_0180364 Ga0439436_0180364_34_492 151
3 3300005841 Ga0068863_100024545 Ga0068863_1000245454 155
4 3300013296 Ga0157374_10680092 Ga0157374_106800922 155
5 3300025931 Ga0207644_10015899 Ga0207644_100158993 155
6 3300026088 Ga0207641_10013677 Ga0207641_100136777 155
7 3300050512 nmdc:mga0n895_235974_c1 nmdc:mga0n895_235974_c1_1208_1675 155
8 3300005330 Ga0070690_100038567 Ga0070690_1000385673 156
9 3300005438 Ga0070701_10007601 Ga0070701_100076015 156
10 3300005444 Ga0070694_100357140 Ga0070694_1003571402 156
11 3300005544 Ga0070686_100017736 Ga0070686_1000177363 156
12 3300005615 Ga0070702_100045231 Ga0070702_1000452313 156
13 3300013297 Ga0157378_10124213 Ga0157378_101242134 156
14 3300045051 Ga0451576_0005215 Ga0451576_0005215_14726_15196 156
15 3300005334 Ga0068869_100024646 Ga0068869_1000246463 157
16 3300005440 Ga0070705_100162700 Ga0070705_1001627003 157
17 3300005549 Ga0070704_100006326 Ga0070704_1000063267 157
18 3300006881 Ga0068865_100469302 Ga0068865_1004693022 157
19 3300025942 Ga0207689_10089597 Ga0207689_100895974 157
20 3300046539 Ga0495621_0067042 Ga0495621_0067042_201_674 157
21 3300049592 Ga0501076_0823293 Ga0501076_0823293_46_678 157
22 3300005547 Ga0070693_100538853 Ga0070693_1005388532 158
23 3300009094 Ga0111539_10656559 Ga0111539_106565592 158
24 3300009148 Ga0105243_10061887 Ga0105243_100618873 158
25 3300009148 Ga0105243_11643903 Ga0105243_116439031 158
26 3300025935 Ga0207709_10220619 Ga0207709_102206192 158
27 3300026075 Ga0207708_10171814 Ga0207708_101718142 158
28 3300045051 Ga0451576_0620729 Ga0451576_0620729_184_660 158
29 3300049592 Ga0501076_0161214 Ga0501076_0161214_1213_1692 158
30 3300005617 Ga0068859_102144960 Ga0068859_1021449601 159
31 3300005937 Ga0081455_10061305 Ga0081455_100613055 159
32 3300006195 Ga0075366_10505933 Ga0075366_105059332 159
33 3300006844 Ga0075428_100652730 Ga0075428_1006527303 159
34 3300006852 Ga0075433_10089891 Ga0075433_100898913 159
35 3300006931 Ga0097620_102144989 Ga0097620_1021449891 159
36 3300009098 Ga0105245_11110743 Ga0105245_111107431 159
37 3300009176 Ga0105242_10163510 Ga0105242_101635104 159
38 3300014326 Ga0157380_11442916 Ga0157380_114429162 159
39 3300014497 Ga0182008_10008707 Ga0182008_100087078 159
40 3300025899 Ga0207642_10180907 Ga0207642_101809072 159
41 3300025934 Ga0207686_10558823 Ga0207686_105588231 159
42 3300026023 Ga0207677_10469562 Ga0207677_104695622 159
43 3300031241 Ga0265325_10032343 Ga0265325_100323433 159
44 3300035088 Ga0373940_0127299 Ga0373940_0127299_133_612 159
45 3300035691 Ga0373931_0109025 Ga0373931_0109025_1069_1548 159
46 3300041404 Ga0439436_0043417 Ga0439436_0043417_647_1129 159
47 3300041410 Ga0439461_0040446 Ga0439461_0040446_59_541 159
48 3300041999 Ga0439433_0051680 Ga0439433_0051680_376_858 159
49 3300046539 Ga0495621_0219504 Ga0495621_0219504_238_717 159
50 3300050507 nmdc:mga05p37_109336_c1 nmdc:mga05p37_109336_c1_1877_2356 159
51 3300050511 nmdc:mga08y16_324229_c1 nmdc:mga08y16_324229_c1_713_1192 159
52 3300050512 nmdc:mga0n895_59800_c1 nmdc:mga0n895_59800_c1_3128_3607 159
53 3300050513 nmdc:mga0rr50_203056_c1 nmdc:mga0rr50_203056_c1_488_967 159
54 3300050515 nmdc:mga0a205_17976_c1 nmdc:mga0a205_17976_c1_4985_5464 159
55 2162886007 SwRhRL2b_contig_3088676 SwRhRL2b_0820.00002100 160
56 3300005289 Ga0065704_10090590 Ga0065704_100905904 160
57 3300005289 Ga0065704_10133022 Ga0065704_101330222 160
58 3300005289 Ga0065704_10205014 Ga0065704_102050141 160
59 3300005289 Ga0065704_10369352 Ga0065704_103693522 160
60 3300005289 Ga0065704_10805525 Ga0065704_108055251 160
61 3300005290 Ga0065712_10076400 Ga0065712_100764003 160
62 3300005290 Ga0065712_10077821 Ga0065712_100778212 160
63 3300005290 Ga0065712_10135983 Ga0065712_101359832 160
64 3300005290 Ga0065712_10206312 Ga0065712_102063122 160
65 3300005290 Ga0065712_10230908 Ga0065712_102309081 160
66 3300005293 Ga0065715_10035530 Ga0065715_100355302 160
67 3300005293 Ga0065715_10114683 Ga0065715_101146833 160
68 3300005293 Ga0065715_10192838 Ga0065715_101928383 160
69 3300005293 Ga0065715_11039474 Ga0065715_110394741 160
70 3300005295 Ga0065707_10002467 Ga0065707_100024672 160
71 3300005295 Ga0065707_10090251 Ga0065707_100902514 160
72 3300005295 Ga0065707_10112338 Ga0065707_101123384 160
73 3300005295 Ga0065707_10119449 Ga0065707_101194493 160
74 3300005295 Ga0065707_10181474 Ga0065707_101814743 160
75 3300005328 Ga0070676_10124225 Ga0070676_101242253 160
76 3300005328 Ga0070676_10161421 Ga0070676_101614212 160
77 3300005328 Ga0070676_10182179 Ga0070676_101821791 160
78 3300005329 Ga0070683_100012348 Ga0070683_1000123486 160
79 3300005330 Ga0070690_100062898 Ga0070690_1000628983 160
80 3300005330 Ga0070690_100112222 Ga0070690_1001122224 160
81 3300005331 Ga0070670_100009539 Ga0070670_1000095398 160
82 3300005331 Ga0070670_100049097 Ga0070670_1000490976 160
83 3300005331 Ga0070670_100082507 Ga0070670_1000825075 160
84 3300005331 Ga0070670_100223008 Ga0070670_1002230082 160
85 3300005335 Ga0070666_10647351 Ga0070666_106473511 160
86 3300005336 Ga0070680_100344312 Ga0070680_1003443122 160
87 3300005336 Ga0070680_100715597 Ga0070680_1007155971 160
88 3300005336 Ga0070680_101172955 Ga0070680_1011729551 160
89 3300005337 Ga0070682_100247141 Ga0070682_1002471411 160
90 3300005338 Ga0068868_100498629 Ga0068868_1004986292 160
91 3300005338 Ga0068868_100977664 Ga0068868_1009776641 160
92 3300005340 Ga0070689_100020229 Ga0070689_1000202292 160
93 3300005340 Ga0070689_100044284 Ga0070689_1000442845 160
94 3300005340 Ga0070689_100074187 Ga0070689_1000741873 160
95 3300005340 Ga0070689_100149752 Ga0070689_1001497524 160
96 3300005340 Ga0070689_100854302 Ga0070689_1008543021 160
97 3300005343 Ga0070687_100006294 Ga0070687_1000062943 160
98 3300005343 Ga0070687_100014411 Ga0070687_1000144113 160
99 3300005343 Ga0070687_100194129 Ga0070687_1001941293 160
100 3300005344 Ga0070661_100018541 Ga0070661_1000185412 160
101 3300005353 Ga0070669_100005982 Ga0070669_1000059826 160
102 3300005353 Ga0070669_100228836 Ga0070669_1002288362 160
103 3300005353 Ga0070669_100308479 Ga0070669_1003084792 160
104 3300005354 Ga0070675_100000986 Ga0070675_10000098611 160
105 3300005354 Ga0070675_100002041 Ga0070675_10000204110 160
106 3300005354 Ga0070675_100018445 Ga0070675_1000184454 160
107 3300005354 Ga0070675_100106288 Ga0070675_1001062883 160
108 3300005354 Ga0070675_100168866 Ga0070675_1001688662 160
109 3300005355 Ga0070671_100007092 Ga0070671_10000709212 160
110 3300005355 Ga0070671_100038808 Ga0070671_1000388082 160
111 3300005355 Ga0070671_100731953 Ga0070671_1007319531 160
112 3300005364 Ga0070673_100003385 Ga0070673_1000033853 160
113 3300005364 Ga0070673_100052842 Ga0070673_1000528423 160
114 3300005364 Ga0070673_101378274 Ga0070673_1013782741 160
115 3300005364 Ga0070673_101422655 Ga0070673_1014226551 160
116 3300005365 Ga0070688_100292761 Ga0070688_1002927613 160
117 3300005365 Ga0070688_100340371 Ga0070688_1003403712 160
118 3300005367 Ga0070667_100329593 Ga0070667_1003295932 160
119 3300005434 Ga0070709_10310538 Ga0070709_103105382 160
120 3300005436 Ga0070713_101658390 Ga0070713_1016583901 160
121 3300005438 Ga0070701_10005894 Ga0070701_100058945 160
122 3300005438 Ga0070701_10106543 Ga0070701_101065432 160
123 3300005440 Ga0070705_100048143 Ga0070705_1000481434 160
124 3300005440 Ga0070705_100096623 Ga0070705_1000966234 160
125 3300005440 Ga0070705_100108218 Ga0070705_1001082183 160
126 3300005441 Ga0070700_100008129 Ga0070700_1000081294 160
127 3300005441 Ga0070700_100582763 Ga0070700_1005827632 160
128 3300005444 Ga0070694_100004550 Ga0070694_1000045504 160
129 3300005444 Ga0070694_100014770 Ga0070694_1000147703 160
130 3300005444 Ga0070694_100775323 Ga0070694_1007753231 160
131 3300005455 Ga0070663_100640053 Ga0070663_1006400532 160
132 3300005456 Ga0070678_100064102 Ga0070678_1000641023 160
133 3300005456 Ga0070678_100158896 Ga0070678_1001588962 160
134 3300005457 Ga0070662_100088587 Ga0070662_1000885872 160
135 3300005457 Ga0070662_100310603 Ga0070662_1003106031 160
136 3300005459 Ga0068867_100005805 Ga0068867_1000058056 160
137 3300005466 Ga0070685_10162624 Ga0070685_101626241 160
138 3300005468 Ga0070707_100396057 Ga0070707_1003960572 160
139 3300005471 Ga0070698_100009951 Ga0070698_1000099515 160
140 3300005471 Ga0070698_100977811 Ga0070698_1009778111 160
141 3300005518 Ga0070699_100012987 Ga0070699_1000129879 160
142 3300005518 Ga0070699_100027731 Ga0070699_1000277312 160
143 3300005530 Ga0070679_100527877 Ga0070679_1005278772 160
144 3300005530 Ga0070679_100890820 Ga0070679_1008908202 160
145 3300005535 Ga0070684_100000479 Ga0070684_10000047919 160
146 3300005535 Ga0070684_100413088 Ga0070684_1004130882 160
147 3300005539 Ga0068853_100491607 Ga0068853_1004916072 160
148 3300005543 Ga0070672_100043908 Ga0070672_1000439084 160
149 3300005543 Ga0070672_100160722 Ga0070672_1001607223 160
150 3300005543 Ga0070672_100208728 Ga0070672_1002087282 160
151 3300005544 Ga0070686_100015821 Ga0070686_1000158216 160
152 3300005544 Ga0070686_100017881 Ga0070686_1000178811 160
153 3300005545 Ga0070695_100312809 Ga0070695_1003128092 160
154 3300005546 Ga0070696_100146826 Ga0070696_1001468262 160
155 3300005546 Ga0070696_100163895 Ga0070696_1001638953 160
156 3300005548 Ga0070665_100031212 Ga0070665_1000312124 160
157 3300005548 Ga0070665_101147977 Ga0070665_1011479772 160
158 3300005549 Ga0070704_100001470 Ga0070704_1000014706 160
159 3300005549 Ga0070704_100015712 Ga0070704_1000157122 160
160 3300005549 Ga0070704_100182418 Ga0070704_1001824182 160
161 3300005563 Ga0068855_101007311 Ga0068855_1010073112 160
162 3300005564 Ga0070664_100000224 Ga0070664_10000022424 160
163 3300005564 Ga0070664_100337048 Ga0070664_1003370481 160
164 3300005564 Ga0070664_100509357 Ga0070664_1005093572 160
165 3300005564 Ga0070664_100529458 Ga0070664_1005294582 160
166 3300005577 Ga0068857_100004602 Ga0068857_1000046024 160
167 3300005577 Ga0068857_100004763 Ga0068857_1000047636 160
168 3300005577 Ga0068857_100044463 Ga0068857_1000444633 160
169 3300005578 Ga0068854_100662665 Ga0068854_1006626652 160
170 3300005614 Ga0068856_100013428 Ga0068856_1000134286 160
171 3300005617 Ga0068859_100000433 Ga0068859_1000004337 160
172 3300005617 Ga0068859_100000798 Ga0068859_1000007986 160
173 3300005617 Ga0068859_100015181 Ga0068859_1000151815 160
174 3300005617 Ga0068859_100062881 Ga0068859_1000628814 160
175 3300005617 Ga0068859_100761657 Ga0068859_1007616572 160
176 3300005617 Ga0068859_100848241 Ga0068859_1008482411 160
177 3300005617 Ga0068859_101537039 Ga0068859_1015370392 160
178 3300005618 Ga0068864_100036386 Ga0068864_1000363864 160
179 3300005618 Ga0068864_100042123 Ga0068864_1000421235 160
180 3300005618 Ga0068864_100351717 Ga0068864_1003517172 160
181 3300005618 Ga0068864_101368594 Ga0068864_1013685941 160
182 3300005719 Ga0068861_100000410 Ga0068861_10000041014 160
183 3300005719 Ga0068861_101161007 Ga0068861_1011610072 160
184 3300005840 Ga0068870_10019235 Ga0068870_100192353 160
185 3300005840 Ga0068870_10043714 Ga0068870_100437141 160
186 3300005840 Ga0068870_10595939 Ga0068870_105959391 160
187 3300005840 Ga0068870_10796930 Ga0068870_107969301 160
188 3300005841 Ga0068863_100008826 Ga0068863_1000088266 160
189 3300005841 Ga0068863_100303900 Ga0068863_1003039002 160
190 3300005842 Ga0068858_100009270 Ga0068858_1000092705 160
191 3300005842 Ga0068858_100080818 Ga0068858_1000808184 160
192 3300005842 Ga0068858_100095721 Ga0068858_1000957212 160
193 3300005842 Ga0068858_100193047 Ga0068858_1001930471 160
194 3300005842 Ga0068858_100482799 Ga0068858_1004827992 160
195 3300005843 Ga0068860_100002194 Ga0068860_1000021944 160
196 3300005843 Ga0068860_100160310 Ga0068860_1001603102 160
197 3300005843 Ga0068860_101246694 Ga0068860_1012466941 160
198 3300005844 Ga0068862_100002592 Ga0068862_1000025926 160
199 3300005937 Ga0081455_10309608 Ga0081455_103096082 160
200 3300006237 Ga0097621_100087228 Ga0097621_1000872285 160
201 3300006237 Ga0097621_100269936 Ga0097621_1002699362 160
202 3300006358 Ga0068871_100353190 Ga0068871_1003531902 160
203 3300006358 Ga0068871_100436145 Ga0068871_1004361452 160
204 3300006358 Ga0068871_102335418 Ga0068871_1023354181 160
205 3300006844 Ga0075428_100019283 Ga0075428_1000192833 160
206 3300006844 Ga0075428_100339156 Ga0075428_1003391562 160
207 3300006844 Ga0075428_101173985 Ga0075428_1011739851 160
208 3300006844 Ga0075428_101598658 Ga0075428_1015986582 160
209 3300006846 Ga0075430_100548634 Ga0075430_1005486341 160
210 3300006847 Ga0075431_100381713 Ga0075431_1003817132 160
211 3300006847 Ga0075431_100384006 Ga0075431_1003840062 160
212 3300006852 Ga0075433_10045029 Ga0075433_100450294 160
213 3300006852 Ga0075433_10182879 Ga0075433_101828792 160
214 3300006852 Ga0075433_10234302 Ga0075433_102343023 160
215 3300006852 Ga0075433_10694074 Ga0075433_106940742 160
216 3300006871 Ga0075434_100013394 Ga0075434_1000133941 160
217 3300006871 Ga0075434_100081445 Ga0075434_1000814456 160
218 3300006871 Ga0075434_100249579 Ga0075434_1002495793 160
219 3300006871 Ga0075434_100270957 Ga0075434_1002709574 160
220 3300006871 Ga0075434_101418807 Ga0075434_1014188072 160
221 3300006880 Ga0075429_100003426 Ga0075429_10000342614 160
222 3300006880 Ga0075429_100132596 Ga0075429_1001325962 160
223 3300006880 Ga0075429_100328555 Ga0075429_1003285552 160
224 3300006880 Ga0075429_100958904 Ga0075429_1009589042 160
225 3300006881 Ga0068865_100219105 Ga0068865_1002191053 160
226 3300006931 Ga0097620_100000433 Ga0097620_1000004337 160
227 3300006931 Ga0097620_100000798 Ga0097620_1000007986 160
228 3300006931 Ga0097620_100015182 Ga0097620_1000151825 160
229 3300006931 Ga0097620_100062882 Ga0097620_1000628824 160
230 3300006931 Ga0097620_100761678 Ga0097620_1007616782 160
231 3300006931 Ga0097620_100848306 Ga0097620_1008483062 160
232 3300006931 Ga0097620_101536910 Ga0097620_1015369102 160
233 3300007076 Ga0075435_100087233 Ga0075435_1000872331 160
234 3300007076 Ga0075435_100095462 Ga0075435_1000954622 160
235 3300009093 Ga0105240_10303304 Ga0105240_103033043 160
236 3300009094 Ga0111539_10027564 Ga0111539_100275645 160
237 3300009094 Ga0111539_10032854 Ga0111539_100328543 160
238 3300009094 Ga0111539_10040795 Ga0111539_100407956 160
239 3300009094 Ga0111539_10072489 Ga0111539_100724894 160
240 3300009094 Ga0111539_10194034 Ga0111539_101940342 160
241 3300009094 Ga0111539_10265851 Ga0111539_102658513 160
242 3300009094 Ga0111539_10470478 Ga0111539_104704782 160
243 3300009147 Ga0114129_10004473 Ga0114129_100044738 160
244 3300009147 Ga0114129_10105684 Ga0114129_101056843 160
245 3300009147 Ga0114129_10336817 Ga0114129_103368172 160
246 3300009147 Ga0114129_10736005 Ga0114129_107360052 160
247 3300009147 Ga0114129_12287474 Ga0114129_122874741 160
248 3300009148 Ga0105243_10020707 Ga0105243_100207075 160
249 3300009148 Ga0105243_10465040 Ga0105243_104650402 160
250 3300009174 Ga0105241_10023260 Ga0105241_100232603 160
251 3300009174 Ga0105241_10234022 Ga0105241_102340222 160
252 3300009177 Ga0105248_10212309 Ga0105248_102123092 160
253 3300009177 Ga0105248_10450946 Ga0105248_104509462 160
254 3300009177 Ga0105248_10787752 Ga0105248_107877521 160
255 3300009545 Ga0105237_10062111 Ga0105237_100621114 160
256 3300009551 Ga0105238_10158825 Ga0105238_101588253 160
257 3300009553 Ga0105249_10002389 Ga0105249_100023898 160
258 3300009553 Ga0105249_11045713 Ga0105249_110457132 160
259 3300010375 Ga0105239_10006592 Ga0105239_100065928 160
260 3300011119 Ga0105246_10350923 Ga0105246_103509232 160
261 3300013296 Ga0157374_10124574 Ga0157374_101245744 160
262 3300013296 Ga0157374_10156025 Ga0157374_101560252 160
263 3300013297 Ga0157378_10120473 Ga0157378_101204732 160
264 3300013306 Ga0163162_10080403 Ga0163162_100804033 160
265 3300013306 Ga0163162_10774470 Ga0163162_107744702 160
266 3300013306 Ga0163162_11063583 Ga0163162_110635831 160
267 3300013306 Ga0163162_11240843 Ga0163162_112408432 160
268 3300013308 Ga0157375_10005046 Ga0157375_100050466 160
269 3300013308 Ga0157375_10082232 Ga0157375_100822323 160
270 3300013308 Ga0157375_10407230 Ga0157375_104072302 160
271 3300013308 Ga0157375_10652919 Ga0157375_106529192 160
272 3300014325 Ga0163163_10012751 Ga0163163_100127514 160
273 3300014325 Ga0163163_10031311 Ga0163163_100313113 160
274 3300014325 Ga0163163_10350949 Ga0163163_103509493 160
275 3300014326 Ga0157380_10009141 Ga0157380_100091413 160
276 3300014326 Ga0157380_10242903 Ga0157380_102429033 160
277 3300014745 Ga0157377_10030046 Ga0157377_100300463 160
278 3300014745 Ga0157377_10055129 Ga0157377_100551294 160
279 3300014968 Ga0157379_10063954 Ga0157379_100639543 160
280 3300014968 Ga0157379_10745607 Ga0157379_107456072 160
281 3300014969 Ga0157376_10284678 Ga0157376_102846781 160
282 3300014969 Ga0157376_10462285 Ga0157376_104622853 160
283 3300025903 Ga0207680_10361278 Ga0207680_103612782 160
284 3300025903 Ga0207680_10468029 Ga0207680_104680292 160
285 3300025906 Ga0207699_10252557 Ga0207699_102525571 160
286 3300025907 Ga0207645_10129073 Ga0207645_101290733 160
287 3300025908 Ga0207643_10021930 Ga0207643_100219303 160
288 3300025908 Ga0207643_10818658 Ga0207643_108186582 160
289 3300025911 Ga0207654_10007936 Ga0207654_100079364 160
290 3300025914 Ga0207671_10046960 Ga0207671_100469602 160
291 3300025917 Ga0207660_10265018 Ga0207660_102650182 160
292 3300025918 Ga0207662_10015989 Ga0207662_100159894 160
293 3300025918 Ga0207662_10145980 Ga0207662_101459802 160
294 3300025920 Ga0207649_10011382 Ga0207649_100113825 160
295 3300025921 Ga0207652_10815989 Ga0207652_108159892 160
296 3300025922 Ga0207646_10678010 Ga0207646_106780102 160
297 3300025923 Ga0207681_10006926 Ga0207681_100069265 160
298 3300025923 Ga0207681_10170655 Ga0207681_101706553 160
299 3300025923 Ga0207681_10205691 Ga0207681_102056912 160
300 3300025925 Ga0207650_10035621 Ga0207650_100356212 160
301 3300025925 Ga0207650_10071451 Ga0207650_100714512 160
302 3300025925 Ga0207650_10122474 Ga0207650_101224742 160
303 3300025925 Ga0207650_10130150 Ga0207650_101301503 160
304 3300025925 Ga0207650_10314577 Ga0207650_103145772 160
305 3300025925 Ga0207650_10892687 Ga0207650_108926872 160
306 3300025926 Ga0207659_10000770 Ga0207659_100007706 160
307 3300025926 Ga0207659_10002736 Ga0207659_100027364 160
308 3300025926 Ga0207659_10012559 Ga0207659_100125593 160
309 3300025926 Ga0207659_10031252 Ga0207659_100312525 160
310 3300025926 Ga0207659_10316852 Ga0207659_103168522 160
311 3300025926 Ga0207659_11180668 Ga0207659_111806682 160
312 3300025933 Ga0207706_10025310 Ga0207706_100253103 160
313 3300025933 Ga0207706_10142367 Ga0207706_101423673 160
314 3300025933 Ga0207706_10350575 Ga0207706_103505751 160
315 3300025935 Ga0207709_10159481 Ga0207709_101594812 160
316 3300025936 Ga0207670_10010541 Ga0207670_100105415 160
317 3300025936 Ga0207670_10060926 Ga0207670_100609263 160
318 3300025936 Ga0207670_10098152 Ga0207670_100981523 160
319 3300025936 Ga0207670_10357511 Ga0207670_103575112 160
320 3300025936 Ga0207670_10564760 Ga0207670_105647601 160
321 3300025936 Ga0207670_10684772 Ga0207670_106847721 160
322 3300025940 Ga0207691_10027473 Ga0207691_100274736 160
323 3300025940 Ga0207691_10134701 Ga0207691_101347013 160
324 3300025941 Ga0207711_10064517 Ga0207711_100645173 160
325 3300025941 Ga0207711_10118958 Ga0207711_101189582 160
326 3300025942 Ga0207689_10485344 Ga0207689_104853442 160
327 3300025945 Ga0207679_10006534 Ga0207679_100065342 160
328 3300025945 Ga0207679_10177531 Ga0207679_101775312 160
329 3300025945 Ga0207679_10497131 Ga0207679_104971312 160
330 3300025945 Ga0207679_11308111 Ga0207679_113081111 160
331 3300025949 Ga0207667_10739093 Ga0207667_107390932 160
332 3300025949 Ga0207667_11117062 Ga0207667_111170622 160
333 3300025960 Ga0207651_10063719 Ga0207651_100637195 160
334 3300025960 Ga0207651_10066444 Ga0207651_100664443 160
335 3300025960 Ga0207651_10181689 Ga0207651_101816892 160
336 3300025960 Ga0207651_10223885 Ga0207651_102238853 160
337 3300025960 Ga0207651_10347290 Ga0207651_103472901 160
338 3300025960 Ga0207651_10684851 Ga0207651_106848511 160
339 3300025960 Ga0207651_10874895 Ga0207651_108748952 160
340 3300025961 Ga0207712_10004314 Ga0207712_100043146 160
341 3300025981 Ga0207640_10343865 Ga0207640_103438652 160
342 3300025986 Ga0207658_10129666 Ga0207658_101296664 160
343 3300026023 Ga0207677_10403326 Ga0207677_104033262 160
344 3300026035 Ga0207703_10019674 Ga0207703_100196744 160
345 3300026035 Ga0207703_10074719 Ga0207703_100747191 160
346 3300026035 Ga0207703_10090141 Ga0207703_100901413 160
347 3300026035 Ga0207703_10181006 Ga0207703_101810062 160
348 3300026035 Ga0207703_10603746 Ga0207703_106037462 160
349 3300026067 Ga0207678_10641558 Ga0207678_106415582 160
350 3300026075 Ga0207708_10012999 Ga0207708_100129994 160
351 3300026075 Ga0207708_10964025 Ga0207708_109640251 160
352 3300026078 Ga0207702_10060059 Ga0207702_100600594 160
353 3300026088 Ga0207641_10005559 Ga0207641_100055595 160
354 3300026088 Ga0207641_10256554 Ga0207641_102565543 160
355 3300026088 Ga0207641_10983816 Ga0207641_109838162 160
356 3300026089 Ga0207648_10000835 Ga0207648_1000083529 160
357 3300026095 Ga0207676_10005398 Ga0207676_100053982 160
358 3300026095 Ga0207676_10067593 Ga0207676_100675934 160
359 3300026095 Ga0207676_10234101 Ga0207676_102341013 160
360 3300026095 Ga0207676_11333095 Ga0207676_113330951 160
361 3300026116 Ga0207674_10008418 Ga0207674_100084185 160
362 3300026116 Ga0207674_10051361 Ga0207674_100513613 160
363 3300026116 Ga0207674_10074590 Ga0207674_100745902 160
364 3300026116 Ga0207674_10190424 Ga0207674_101904243 160
365 3300026118 Ga0207675_100001637 Ga0207675_10000163714 160
366 3300026118 Ga0207675_100308191 Ga0207675_1003081913 160
367 3300026121 Ga0207683_10196133 Ga0207683_101961332 160
368 3300026121 Ga0207683_10250202 Ga0207683_102502022 160
369 3300026121 Ga0207683_10557739 Ga0207683_105577392 160
370 3300026121 Ga0207683_10692983 Ga0207683_106929832 160
371 3300026142 Ga0207698_11263048 Ga0207698_112630482 160
372 3300027695 Ga0209966_1029147 Ga0209966_10291472 160
373 3300027907 Ga0207428_10007529 Ga0207428_100075296 160
374 3300027907 Ga0207428_10017908 Ga0207428_100179082 160
375 3300027907 Ga0207428_10434271 Ga0207428_104342712 160
376 3300027907 Ga0207428_10438167 Ga0207428_104381672 160
377 3300028379 Ga0268266_10702925 Ga0268266_107029252 160
378 3300028380 Ga0268265_10001817 Ga0268265_100018176 160
379 3300028380 Ga0268265_10150559 Ga0268265_101505592 160
380 3300028380 Ga0268265_11326346 Ga0268265_113263462 160
381 3300028381 Ga0268264_10013880 Ga0268264_100138804 160
382 3300028381 Ga0268264_10797462 Ga0268264_107974622 160
383 3300032002 Ga0307416_100480102 Ga0307416_1004801022 160
384 3300032126 Ga0307415_100820644 Ga0307415_1008206441 160
385 3300034819 Ga0373958_0103095 Ga0373958_0103095_176_658 160
386 3300035114 Ga0373939_0034695 Ga0373939_0034695_249_731 160
387 3300035114 Ga0373939_0037632 Ga0373939_0037632_436_918 160
388 3300035115 Ga0373941_0121447 Ga0373941_0121447_436_918 160
389 3300035207 Ga0373942_0115007 Ga0373942_0115007_57_539 160
390 3300035241 Ga0373961_0107574 Ga0373961_0107574_396_878 160
391 3300035242 Ga0373962_0266805 Ga0373962_0266805_43_525 160
392 3300035691 Ga0373931_0471889 Ga0373931_0471889_268_750 160
393 3300035691 Ga0373931_1115098 Ga0373931_1115098_25_507 160
394 3300035692 Ga0373935_0828832 Ga0373935_0828832_161_643 160
395 3300035695 Ga0373927_0054818 Ga0373927_0054818_1328_1810 160
396 3300037068 Ga0373925_0866208 Ga0373925_0866208_29_511 160
397 3300041408 Ga0439453_0009502 Ga0439453_0009502_1085_1567 160
398 3300042134 Ga0450898_107680 Ga0450898_107680_71_553 160
399 3300042436 Ga0439435_0037185 Ga0439435_0037185_134_616 160
400 3300042876 Ga0451577_0226523 Ga0451577_0226523_365_850 160
401 3300042876 Ga0451577_0619416 Ga0451577_0619416_89_571 160
402 3300044673 Ga0453683_0351423 Ga0453683_0351423_312_800 160
403 3300045051 Ga0451576_0044829 Ga0451576_0044829_958_1443 160
404 3300045051 Ga0451576_0070771 Ga0451576_0070771_1097_1585 160
405 3300045051 Ga0451576_0146163 Ga0451576_0146163_1660_2142 160
406 3300045051 Ga0451576_0295705 Ga0451576_0295705_436_924 160
407 3300045051 Ga0451576_0933430 Ga0451576_0933430_165_647 160
408 3300045051 Ga0451576_1659755 Ga0451576_1659755_26_508 160
409 3300046472 Ga0495580_0143259 Ga0495580_0143259_427_909 160
410 3300046472 Ga0495580_0156359 Ga0495580_0156359_251_733 160
411 3300046472 Ga0495580_0238096 Ga0495580_0238096_686_1168 160
412 3300046473 Ga0495582_0126677 Ga0495582_0126677_178_660 160
413 3300046473 Ga0495582_0312448 Ga0495582_0312448_129_614 160
414 3300046491 Ga0495584_0311074 Ga0495584_0311074_191_673 160
415 3300046491 Ga0495584_0325433 Ga0495584_0325433_260_742 160
416 3300046499 Ga0495594_0006593 Ga0495594_0006593_803_1285 160
417 3300046499 Ga0495594_0534863 Ga0495594_0534863_75_557 160
418 3300046517 Ga0495630_0787489 Ga0495630_0787489_93_578 160
419 3300046525 Ga0495663_0018268 Ga0495663_0018268_109_597 160
420 3300046526 Ga0495666_0240945 Ga0495666_0240945_72_554 160
421 3300046537 Ga0495598_0104831 Ga0495598_0104831_381_863 160
422 3300046539 Ga0495621_0003475 Ga0495621_0003475_2569_3057 160
423 3300046539 Ga0495621_0161414 Ga0495621_0161414_264_746 160
424 3300046558 Ga0495633_0180091 Ga0495633_0180091_65_547 160
425 3300046616 Ga0495668_0257533 Ga0495668_0257533_148_636 160
426 3300046663 Ga0495635_0025402 Ga0495635_0025402_270_797 160
427 3300046664 Ga0495659_0014502 Ga0495659_0014502_348_830 160
428 3300046664 Ga0495659_0110240 Ga0495659_0110240_86_568 160
429 3300046664 Ga0495659_0172628 Ga0495659_0172628_36_518 160
430 3300046683 Ga0495658_0115588 Ga0495658_0115588_1016_1501 160
431 3300046684 Ga0495669_0010253 Ga0495669_0010253_2535_3017 160
432 3300046689 Ga0495613_0008197 Ga0495613_0008197_1876_2358 160
433 3300047315 Ga0495581_0300358 Ga0495581_0300358_23_505 160
434 3300047318 Ga0495636_0046342 Ga0495636_0046342_301_783 160
435 3300047318 Ga0495636_0126588 Ga0495636_0126588_56_538 160
436 3300047471 Ga0495684_0316687 Ga0495684_0316687_241_726 160
437 3300048089 Ga0495614_0141589 Ga0495614_0141589_395_877 160
438 3300048090 Ga0495615_0003580 Ga0495615_0003580_2111_2599 160
439 3300048903 Ga0496100_1208252 Ga0496100_1208252_34_516 160
440 3300048904 Ga0496101_0337195 Ga0496101_0337195_528_1010 160
441 3300048905 Ga0496102_0780644 Ga0496102_0780644_267_749 160
442 3300048907 Ga0496104_0070351 Ga0496104_0070351_688_1170 160
443 3300048908 Ga0496105_0018911 Ga0496105_0018911_1009_1491 160
444 3300048908 Ga0496105_0535813 Ga0496105_0535813_297_779 160
445 3300048909 Ga0496106_0124214 Ga0496106_0124214_1179_1661 160
446 3300048909 Ga0496106_0260457 Ga0496106_0260457_456_938 160
447 3300048909 Ga0496106_0827424 Ga0496106_0827424_19_501 160
448 3300048910 Ga0496107_0740275 Ga0496107_0740275_10_492 160
449 3300048911 Ga0496108_0010091 Ga0496108_0010091_850_1332 160
450 3300048911 Ga0496108_0423589 Ga0496108_0423589_16_498 160
451 3300048911 Ga0496108_0790263 Ga0496108_0790263_305_787 160
452 3300048912 Ga0496109_0001912 Ga0496109_0001912_5225_5707 160
453 3300048912 Ga0496109_0280632 Ga0496109_0280632_500_982 160
454 3300048912 Ga0496109_1485880 Ga0496109_1485880_19_501 160
455 3300048913 Ga0496110_0001931 Ga0496110_0001931_8821_9303 160
456 3300048913 Ga0496110_0049047 Ga0496110_0049047_1583_2065 160
457 3300048914 Ga0496111_0006720 Ga0496111_0006720_5119_5601 160
458 3300048914 Ga0496111_0335506 Ga0496111_0335506_46_528 160
459 3300048915 Ga0496112_0001225 Ga0496112_0001225_18540_19022 160
460 3300048915 Ga0496112_1417732 Ga0496112_1417732_22_504 160
461 3300048916 Ga0496113_0474947 Ga0496113_0474947_79_561 160
462 3300048917 Ga0496114_1211674 Ga0496114_1211674_113_595 160
463 3300048918 Ga0496115_0102871 Ga0496115_0102871_1076_1558 160
464 3300049576 Ga0501040_0097927 Ga0501040_0097927_676_1179 160
465 3300049577 Ga0501041_0285976 Ga0501041_0285976_63_554 160
466 3300049580 Ga0501046_0655589 Ga0501046_0655589_68_604 160
467 3300049587 Ga0501071_0221702 Ga0501071_0221702_426_962 160
468 3300049588 Ga0501072_0167572 Ga0501072_0167572_443_946 160
469 3300049588 Ga0501072_0180189 Ga0501072_0180189_24_509 160
470 3300049592 Ga0501076_0940321 Ga0501076_0940321_118_654 160
471 3300049661 Ga0501217_148994 Ga0501217_148994_139_621 160
472 3300049666 Ga0501228_013915 Ga0501228_013915_125_607 160
473 3300049679 Ga0501249_047856 Ga0501249_047856_165_647 160
474 3300049684 Ga0501255_013500 Ga0501255_013500_118_600 160
475 3300049685 Ga0501256_010495 Ga0501256_010495_333_815 160
476 3300049743 Ga0501081_0092720 Ga0501081_0092720_708_1199 160
477 3300049743 Ga0501081_0518242 Ga0501081_0518242_46_582 160
478 3300049762 Ga0501265_056374 Ga0501265_056374_107_589 160
479 3300049768 Ga0501271_033103 Ga0501271_033103_19_501 160
480 3300049773 Ga0501276_007796 Ga0501276_007796_102_584 160
481 3300049824 Ga0501045_0796043 Ga0501045_0796043_130_621 160
482 3300050496 nmdc:mga07m45_652593_c1 nmdc:mga07m45_652593_c1_13_504 160
483 3300050507 nmdc:mga05p37_1845264_c1 nmdc:mga05p37_1845264_c1_81_569 160
484 3300050507 nmdc:mga05p37_48_c1 nmdc:mga05p37_48_c1_62026_62508 160
485 3300050507 nmdc:mga05p37_578625_c1 nmdc:mga05p37_578625_c1_411_893 160
486 3300050508 nmdc:mga09592_312380_c1 nmdc:mga09592_312380_c1_280_762 160
487 3300050508 nmdc:mga09592_335156_c1 nmdc:mga09592_335156_c1_749_1231 160
488 3300050508 nmdc:mga09592_649796_c1 nmdc:mga09592_649796_c1_193_675 160
489 3300050510 nmdc:mga06r32_317197_c1 nmdc:mga06r32_317197_c1_502_984 160
490 3300050510 nmdc:mga06r32_660488_c1 nmdc:mga06r32_660488_c1_39_521 160
491 3300050511 nmdc:mga08y16_14177_c1 nmdc:mga08y16_14177_c1_331_813 160
492 3300050511 nmdc:mga08y16_41946_c1 nmdc:mga08y16_41946_c1_2920_3411 160
493 3300050511 nmdc:mga08y16_447573_c1 nmdc:mga08y16_447573_c1_822_1304 160
494 3300050511 nmdc:mga08y16_509981_c1 nmdc:mga08y16_509981_c1_400_882 160
495 3300050511 nmdc:mga08y16_815807_c1 nmdc:mga08y16_815807_c1_238_720 160
496 3300050511 nmdc:mga08y16_825751_c1 nmdc:mga08y16_825751_c1_405_893 160
497 3300050511 nmdc:mga08y16_9646_c1 nmdc:mga08y16_9646_c1_6773_7255 160
498 3300050512 nmdc:mga0n895_342004_c1 nmdc:mga0n895_342004_c1_277_759 160
499 3300050512 nmdc:mga0n895_5270_c1 nmdc:mga0n895_5270_c1_286_768 160
500 3300050512 nmdc:mga0n895_581688_c1 nmdc:mga0n895_581688_c1_480_962 160
501 3300050512 nmdc:mga0n895_758334_c1 nmdc:mga0n895_758334_c1_437_922 160
502 3300050513 nmdc:mga0rr50_17008_c1 nmdc:mga0rr50_17008_c1_1590_2075 160
503 3300050515 nmdc:mga0a205_24686_c1 nmdc:mga0a205_24686_c1_2553_3038 160
504 3300050515 nmdc:mga0a205_270454_c1 nmdc:mga0a205_270454_c1_409_906 160
505 3300053077 Ga0495601_0035163 Ga0495601_0035163_1696_2178 160
506 3300053085 Ga0495619_0472777 Ga0495619_0472777_368_850 160
507 3300059421 Ga0590071_000079 Ga0590071_000079_23898_24380 160
508 3300059423 Ga0590074_000280 Ga0590074_000280_4015_4497 160
509 3300059424 Ga0590075_000048 Ga0590075_000048_24507_24989 160
510 3300059426 Ga0590077_000030 Ga0590077_000030_22344_22826 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

49

171

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y81-assembly1.cif.gz_A conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus 0.9052 17 128
3q9n-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8951 1 117
3q9n-assembly1.cif.gz_A in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8926 1 130
3q9u-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.8857 2 104
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.8629 1 135
ID Description Score Start End Superfamily
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9052 17 128 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8951 1 117 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8562 5 133 3.40.50.720
3ff4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8374 17 142 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8248 17 128 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7V4HC14-F1-model_v4 CoA-binding protein 0.9622 4 156
AF-A0A849M667-F1-model_v4 CoA-binding protein 0.9605 7 156
AF-A0A660TNN4-F1-model_v4 CoA-binding protein 0.9587 6 138
AF-A0A6H9L9M6-F1-model_v4 CoA-binding protein 0.9546 1 160
AF-A0A1G0PHE0-F1-model_v4 CoA-binding domain-containing protein 0.9533 3 160

Feature Viewer

pLDDT pTM Quality
90.17 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map