F457119
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 510 | 232 | 510 | 160 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10072489|Ga0111539_100724894 |
| Length | 192 |
| Sequence | MPTFEVSAHMTVRPGQLEEFKKQAMRLPTEGPMTTTSLETKVHDFLSQKRIAVAGVSRHNSDHPVGNLIYQRLKKTGHDVFPVNPHMQTFEGDRCYRDLQSIPGGVDGVVIITRPEVTERIVHDCSDAGVRRVWMHQSLGKGSSVSQKAVTYCHQHDISVIAGACPMMYGDGVDVGHTCMRWILKFTGGLPT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 52 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 53 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 55 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 63 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 150 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 151 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 154 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 159 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 160 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 161 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 162 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 163 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 166 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 167 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 210 | 3300049666 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control | Metagenome | Rhizosphere |
| 211 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 212 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 213 | 3300049685 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control | Metagenome | Rhizosphere |
| 214 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 216 | 3300049768 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought | Metagenome | Rhizosphere |
| 217 | 3300049773 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control | Metagenome | Rhizosphere |
| 218 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 220 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 222 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 223 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 224 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 227 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 230 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 231 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 232 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.39 |
| Nodule | 0 |
| Rhizoplane | 4.9 |
| Rhizosphere | 94.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3088676 | 2162886007 | Unclassified | 1331 |
| 2 | Ga0065704_10090590 | 3300005289 | Viruses | 2776 |
| 3 | Ga0065704_10133022 | 3300005289 | Unclassified | 1605 |
| 4 | Ga0065704_10205014 | 3300005289 | Unclassified | 1131 |
| 5 | Ga0065704_10369352 | 3300005289 | Bacteria | 787 |
| 6 | Ga0065704_10805525 | 3300005289 | Unclassified | 523 |
| 7 | Ga0065712_10076400 | 3300005290 | Bacteria | 3663 |
| 8 | Ga0065712_10077821 | 3300005290 | Bacteria | 3437 |
| 9 | Ga0065712_10135983 | 3300005290 | Unclassified | 1497 |
| 10 | Ga0065712_10206312 | 3300005290 | Unclassified | 1080 |
| 11 | Ga0065712_10230908 | 3300005290 | Unclassified | 1011 |
| 12 | Ga0065715_10035530 | 3300005293 | Bacteria | 1498 |
| 13 | Ga0065715_10114683 | 3300005293 | Unclassified | 2442 |
| 14 | Ga0065715_10192838 | 3300005293 | Unclassified | 1388 |
| 15 | Ga0065715_11039474 | 3300005293 | Unclassified | 535 |
| 16 | Ga0065707_10002467 | 3300005295 | Bacteria | 4561 |
| 17 | Ga0065707_10090251 | 3300005295 | Bacteria | 4181 |
| 18 | Ga0065707_10112338 | 3300005295 | Bacteria | 2364 |
| 19 | Ga0065707_10119449 | 3300005295 | Bacteria | 2159 |
| 20 | Ga0065707_10181474 | 3300005295 | Unclassified | 1416 |
| 21 | Ga0070676_10124225 | 3300005328 | Bacteria | 1624 |
| 22 | Ga0070676_10161421 | 3300005328 | Bacteria | 1443 |
| 23 | Ga0070676_10182179 | 3300005328 | Bacteria | 1366 |
| 24 | Ga0070683_100012348 | 3300005329 | Bacteria | 7421 |
| 25 | Ga0070690_100038567 | 3300005330 | Unclassified | 3016 |
| 26 | Ga0070690_100062898 | 3300005330 | Archaea | 2394 |
| 27 | Ga0070690_100112222 | 3300005330 | Unclassified | 1820 |
| 28 | Ga0070670_100009539 | 3300005331 | Bacteria | 8282 |
| 29 | Ga0070670_100049097 | 3300005331 | Unclassified | 3630 |
| 30 | Ga0070670_100082507 | 3300005331 | Unclassified | 2762 |
| 31 | Ga0070670_100223008 | 3300005331 | Bacteria | 1640 |
| 32 | Ga0068869_100024646 | 3300005334 | Unclassified | 4169 |
| 33 | Ga0070666_10647351 | 3300005335 | Unclassified | 773 |
| 34 | Ga0070680_100344312 | 3300005336 | Unclassified | 1267 |
| 35 | Ga0070680_100715597 | 3300005336 | Unclassified | 862 |
| 36 | Ga0070680_101172955 | 3300005336 | Unclassified | 664 |
| 37 | Ga0070682_100247141 | 3300005337 | Bacteria | 1284 |
| 38 | Ga0068868_100498629 | 3300005338 | Bacteria | 1066 |
| 39 | Ga0068868_100977664 | 3300005338 | Unclassified | 773 |
| 40 | Ga0070689_100020229 | 3300005340 | Bacteria | 4937 |
| 41 | Ga0070689_100044284 | 3300005340 | Unclassified | 3423 |
| 42 | Ga0070689_100074187 | 3300005340 | Bacteria | 2662 |
| 43 | Ga0070689_100149752 | 3300005340 | Unclassified | 1881 |
| 44 | Ga0070689_100854302 | 3300005340 | Unclassified | 803 |
| 45 | Ga0070687_100006294 | 3300005343 | Unclassified | 4861 |
| 46 | Ga0070687_100014411 | 3300005343 | Bacteria | 3550 |
| 47 | Ga0070687_100194129 | 3300005343 | Unclassified | 1225 |
| 48 | Ga0070661_100018541 | 3300005344 | Bacteria | 4949 |
| 49 | Ga0070669_100005982 | 3300005353 | Bacteria | 8779 |
| 50 | Ga0070669_100228836 | 3300005353 | Bacteria | 1473 |
| 51 | Ga0070669_100308479 | 3300005353 | Bacteria | 1275 |
| 52 | Ga0070675_100000986 | 3300005354 | Bacteria | 20361 |
| 53 | Ga0070675_100002041 | 3300005354 | Bacteria | 14983 |
| 54 | Ga0070675_100018445 | 3300005354 | Bacteria | 5554 |
| 55 | Ga0070675_100106288 | 3300005354 | Bacteria | 2369 |
| 56 | Ga0070675_100168866 | 3300005354 | Unclassified | 1885 |
| 57 | Ga0070671_100007092 | 3300005355 | Bacteria | 8968 |
| 58 | Ga0070671_100038808 | 3300005355 | Bacteria | 3952 |
| 59 | Ga0070671_100731953 | 3300005355 | Bacteria | 859 |
| 60 | Ga0070673_100003385 | 3300005364 | Bacteria | 9921 |
| 61 | Ga0070673_100052842 | 3300005364 | Bacteria | 3189 |
| 62 | Ga0070673_101378274 | 3300005364 | Unclassified | 663 |
| 63 | Ga0070673_101422655 | 3300005364 | Bacteria | 653 |
| 64 | Ga0070688_100292761 | 3300005365 | Bacteria | 1174 |
| 65 | Ga0070688_100340371 | 3300005365 | Unclassified | 1095 |
| 66 | Ga0070667_100329593 | 3300005367 | Bacteria | 1379 |
| 67 | Ga0070709_10310538 | 3300005434 | Unclassified | 1154 |
| 68 | Ga0070713_101658390 | 3300005436 | Unclassified | 621 |
| 69 | Ga0070701_10005894 | 3300005438 | Bacteria | 5112 |
| 70 | Ga0070701_10007601 | 3300005438 | Bacteria | 4642 |
| 71 | Ga0070701_10106543 | 3300005438 | Unclassified | 1560 |
| 72 | Ga0070705_100048143 | 3300005440 | Unclassified | 2468 |
| 73 | Ga0070705_100096623 | 3300005440 | Bacteria | 1855 |
| 74 | Ga0070705_100108218 | 3300005440 | Bacteria | 1770 |
| 75 | Ga0070705_100162700 | 3300005440 | Bacteria | 1494 |
| 76 | Ga0070700_100008129 | 3300005441 | Bacteria | 5705 |
| 77 | Ga0070700_100582763 | 3300005441 | Unclassified | 874 |
| 78 | Ga0070694_100004550 | 3300005444 | Bacteria | 8338 |
| 79 | Ga0070694_100014770 | 3300005444 | Unclassified | 4893 |
| 80 | Ga0070694_100357140 | 3300005444 | Unclassified | 1134 |
| 81 | Ga0070694_100775323 | 3300005444 | Unclassified | 785 |
| 82 | Ga0070663_100640053 | 3300005455 | Unclassified | 898 |
| 83 | Ga0070678_100064102 | 3300005456 | Unclassified | 2722 |
| 84 | Ga0070678_100158896 | 3300005456 | Unclassified | 1829 |
| 85 | Ga0070662_100088587 | 3300005457 | Archaea | 2320 |
| 86 | Ga0070662_100310603 | 3300005457 | Bacteria | 1283 |
| 87 | Ga0068867_100005805 | 3300005459 | Bacteria | 8757 |
| 88 | Ga0070685_10162624 | 3300005466 | Unclassified | 1424 |
| 89 | Ga0070707_100396057 | 3300005468 | Bacteria | 1341 |
| 90 | Ga0070698_100009951 | 3300005471 | Bacteria | 10166 |
| 91 | Ga0070698_100977811 | 3300005471 | Unclassified | 793 |
| 92 | Ga0070699_100012987 | 3300005518 | Bacteria | 7176 |
| 93 | Ga0070699_100027731 | 3300005518 | Bacteria | 4884 |
| 94 | Ga0070679_100527877 | 3300005530 | Unclassified | 1124 |
| 95 | Ga0070679_100890820 | 3300005530 | Bacteria | 833 |
| 96 | Ga0070684_100000479 | 3300005535 | Bacteria | 27366 |
| 97 | Ga0070684_100413088 | 3300005535 | Bacteria | 1245 |
| 98 | Ga0068853_100491607 | 3300005539 | Unclassified | 1158 |
| 99 | Ga0070672_100043908 | 3300005543 | Unclassified | 3450 |
| 100 | Ga0070672_100160722 | 3300005543 | Bacteria | 1863 |
| 101 | Ga0070672_100208728 | 3300005543 | Bacteria | 1635 |
| 102 | Ga0070686_100015821 | 3300005544 | Bacteria | 4380 |
| 103 | Ga0070686_100017736 | 3300005544 | Unclassified | 4166 |
| 104 | Ga0070686_100017881 | 3300005544 | Bacteria | 4150 |
| 105 | Ga0070695_100312809 | 3300005545 | Bacteria | 1165 |
| 106 | Ga0070696_100146826 | 3300005546 | Archaea | 1728 |
| 107 | Ga0070696_100163895 | 3300005546 | Bacteria | 1639 |
| 108 | Ga0070693_100538853 | 3300005547 | Unclassified | 834 |
| 109 | Ga0070665_100031212 | 3300005548 | Bacteria | 5363 |
| 110 | Ga0070665_101147977 | 3300005548 | Unclassified | 788 |
| 111 | Ga0070704_100001470 | 3300005549 | Bacteria | 12643 |
| 112 | Ga0070704_100006326 | 3300005549 | Bacteria | 6976 |
| 113 | Ga0070704_100015712 | 3300005549 | Bacteria | 4765 |
| 114 | Ga0070704_100182418 | 3300005549 | Bacteria | 1680 |
| 115 | Ga0068855_101007311 | 3300005563 | Unclassified | 875 |
| 116 | Ga0070664_100000224 | 3300005564 | Bacteria | 40566 |
| 117 | Ga0070664_100337048 | 3300005564 | Bacteria | 1369 |
| 118 | Ga0070664_100509357 | 3300005564 | Unclassified | 1110 |
| 119 | Ga0070664_100529458 | 3300005564 | Bacteria | 1088 |
| 120 | Ga0068857_100004602 | 3300005577 | Bacteria | 11681 |
| 121 | Ga0068857_100004763 | 3300005577 | Bacteria | 11490 |
| 122 | Ga0068857_100044463 | 3300005577 | Bacteria | 3940 |
| 123 | Ga0068854_100662665 | 3300005578 | Unclassified | 897 |
| 124 | Ga0068856_100013428 | 3300005614 | Bacteria | 7930 |
| 125 | Ga0070702_100045231 | 3300005615 | Bacteria | 2489 |
| 126 | Ga0068859_100000433 | 3300005617 | Bacteria | 41951 |
| 127 | Ga0068859_100000798 | 3300005617 | Bacteria | 31967 |
| 128 | Ga0068859_100015181 | 3300005617 | Bacteria | 7731 |
| 129 | Ga0068859_100062881 | 3300005617 | Bacteria | 3742 |
| 130 | Ga0068859_100761657 | 3300005617 | Unclassified | 1057 |
| 131 | Ga0068859_100848241 | 3300005617 | Unclassified | 1000 |
| 132 | Ga0068859_101537039 | 3300005617 | Unclassified | 735 |
| 133 | Ga0068859_102144960 | 3300005617 | Unclassified | 617 |
| 134 | Ga0068864_100036386 | 3300005618 | Bacteria | 4196 |
| 135 | Ga0068864_100042123 | 3300005618 | Unclassified | 3907 |
| 136 | Ga0068864_100351717 | 3300005618 | Unclassified | 1390 |
| 137 | Ga0068864_101368594 | 3300005618 | Bacteria | 709 |
| 138 | Ga0068861_100000410 | 3300005719 | Bacteria | 24782 |
| 139 | Ga0068861_101161007 | 3300005719 | Unclassified | 745 |
| 140 | Ga0068870_10019235 | 3300005840 | Unclassified | 3310 |
| 141 | Ga0068870_10043714 | 3300005840 | Bacteria | 2338 |
| 142 | Ga0068870_10595939 | 3300005840 | Unclassified | 750 |
| 143 | Ga0068870_10796930 | 3300005840 | Unclassified | 660 |
| 144 | Ga0068863_100008826 | 3300005841 | Bacteria | 9845 |
| 145 | Ga0068863_100024545 | 3300005841 | Bacteria | 5749 |
| 146 | Ga0068863_100303900 | 3300005841 | Bacteria | 1548 |
| 147 | Ga0068858_100009270 | 3300005842 | Bacteria | 9399 |
| 148 | Ga0068858_100080818 | 3300005842 | Bacteria | 3021 |
| 149 | Ga0068858_100095721 | 3300005842 | Unclassified | 2766 |
| 150 | Ga0068858_100193047 | 3300005842 | Unclassified | 1924 |
| 151 | Ga0068858_100482799 | 3300005842 | Bacteria | 1196 |
| 152 | Ga0068860_100002194 | 3300005843 | Bacteria | 20537 |
| 153 | Ga0068860_100160310 | 3300005843 | Bacteria | 2169 |
| 154 | Ga0068860_101246694 | 3300005843 | Unclassified | 764 |
| 155 | Ga0068862_100002592 | 3300005844 | Bacteria | 15960 |
| 156 | Ga0081455_10061305 | 3300005937 | Unclassified | 3166 |
| 157 | Ga0081455_10309608 | 3300005937 | Bacteria | 1129 |
| 158 | Ga0075366_10505933 | 3300006195 | Unclassified | 747 |
| 159 | Ga0097621_100087228 | 3300006237 | Unclassified | 2605 |
| 160 | Ga0097621_100269936 | 3300006237 | Unclassified | 1494 |
| 161 | Ga0068871_100353190 | 3300006358 | Unclassified | 1301 |
| 162 | Ga0068871_100436145 | 3300006358 | Bacteria | 1172 |
| 163 | Ga0068871_102335418 | 3300006358 | Unclassified | 510 |
| 164 | Ga0075428_100019283 | 3300006844 | Bacteria | 7548 |
| 165 | Ga0075428_100339156 | 3300006844 | Unclassified | 1614 |
| 166 | Ga0075428_100652730 | 3300006844 | Bacteria | 1122 |
| 167 | Ga0075428_101173985 | 3300006844 | Unclassified | 810 |
| 168 | Ga0075428_101598658 | 3300006844 | Unclassified | 682 |
| 169 | Ga0075430_100548634 | 3300006846 | Bacteria | 953 |
| 170 | Ga0075431_100381713 | 3300006847 | Unclassified | 1413 |
| 171 | Ga0075431_100384006 | 3300006847 | Bacteria | 1408 |
| 172 | Ga0075433_10045029 | 3300006852 | Bacteria | 3834 |
| 173 | Ga0075433_10089891 | 3300006852 | Bacteria | 2714 |
| 174 | Ga0075433_10182879 | 3300006852 | Unclassified | 1865 |
| 175 | Ga0075433_10234302 | 3300006852 | Bacteria | 1630 |
| 176 | Ga0075433_10694074 | 3300006852 | Unclassified | 892 |
| 177 | Ga0075434_100013394 | 3300006871 | Bacteria | 7802 |
| 178 | Ga0075434_100081445 | 3300006871 | Bacteria | 3234 |
| 179 | Ga0075434_100249579 | 3300006871 | Bacteria | 1794 |
| 180 | Ga0075434_100270957 | 3300006871 | Bacteria | 1717 |
| 181 | Ga0075434_101418807 | 3300006871 | Bacteria | 704 |
| 182 | Ga0075429_100003426 | 3300006880 | Bacteria | 13527 |
| 183 | Ga0075429_100132596 | 3300006880 | Unclassified | 2180 |
| 184 | Ga0075429_100328555 | 3300006880 | Bacteria | 1338 |
| 185 | Ga0075429_100958904 | 3300006880 | Unclassified | 748 |
| 186 | Ga0068865_100219105 | 3300006881 | Bacteria | 1487 |
| 187 | Ga0068865_100469302 | 3300006881 | Unclassified | 1044 |
| 188 | Ga0097620_100000433 | 3300006931 | Bacteria | 41951 |
| 189 | Ga0097620_100000798 | 3300006931 | Bacteria | 31967 |
| 190 | Ga0097620_100015182 | 3300006931 | Bacteria | 7731 |
| 191 | Ga0097620_100062882 | 3300006931 | Bacteria | 3742 |
| 192 | Ga0097620_100761678 | 3300006931 | Unclassified | 1057 |
| 193 | Ga0097620_100848306 | 3300006931 | Unclassified | 1000 |
| 194 | Ga0097620_101536910 | 3300006931 | Unclassified | 735 |
| 195 | Ga0097620_102144989 | 3300006931 | Unclassified | 617 |
| 196 | Ga0075435_100087233 | 3300007076 | Bacteria | 2571 |
| 197 | Ga0075435_100095462 | 3300007076 | Bacteria | 2459 |
| 198 | Ga0105240_10303304 | 3300009093 | Bacteria | 1826 |
| 199 | Ga0111539_10027564 | 3300009094 | Bacteria | 6938 |
| 200 | Ga0111539_10032854 | 3300009094 | Bacteria | 6301 |
| 201 | Ga0111539_10040795 | 3300009094 | Bacteria | 5585 |
| 202 | Ga0111539_10072489 | 3300009094 | Bacteria | 4061 |
| 203 | Ga0111539_10194034 | 3300009094 | Unclassified | 2369 |
| 204 | Ga0111539_10265851 | 3300009094 | Bacteria | 1997 |
| 205 | Ga0111539_10470478 | 3300009094 | Bacteria | 1463 |
| 206 | Ga0111539_10656559 | 3300009094 | Unclassified | 1221 |
| 207 | Ga0105245_11110743 | 3300009098 | Bacteria | 837 |
| 208 | Ga0114129_10004473 | 3300009147 | Bacteria | 19707 |
| 209 | Ga0114129_10105684 | 3300009147 | Bacteria | 3890 |
| 210 | Ga0114129_10336817 | 3300009147 | Bacteria | 2002 |
| 211 | Ga0114129_10736005 | 3300009147 | Bacteria | 1264 |
| 212 | Ga0114129_12287474 | 3300009147 | Unclassified | 649 |
| 213 | Ga0105243_10020707 | 3300009148 | Unclassified | 4989 |
| 214 | Ga0105243_10061887 | 3300009148 | Unclassified | 2995 |
| 215 | Ga0105243_10465040 | 3300009148 | Bacteria | 1190 |
| 216 | Ga0105243_11643903 | 3300009148 | Unclassified | 670 |
| 217 | Ga0105241_10023260 | 3300009174 | Bacteria | 4595 |
| 218 | Ga0105241_10234022 | 3300009174 | Bacteria | 1550 |
| 219 | Ga0105242_10163510 | 3300009176 | Bacteria | 1950 |
| 220 | Ga0105248_10212309 | 3300009177 | Unclassified | 2181 |
| 221 | Ga0105248_10450946 | 3300009177 | Unclassified | 1449 |
| 222 | Ga0105248_10787752 | 3300009177 | Bacteria | 1073 |
| 223 | Ga0105237_10062111 | 3300009545 | Bacteria | 3735 |
| 224 | Ga0105238_10158825 | 3300009551 | Bacteria | 2236 |
| 225 | Ga0105249_10002389 | 3300009553 | Bacteria | 16296 |
| 226 | Ga0105249_11045713 | 3300009553 | Unclassified | 886 |
| 227 | Ga0105239_10006592 | 3300010375 | Bacteria | 13446 |
| 228 | Ga0105246_10350923 | 3300011119 | Unclassified | 1209 |
| 229 | Ga0157374_10124574 | 3300013296 | Unclassified | 2490 |
| 230 | Ga0157374_10156025 | 3300013296 | Unclassified | 2221 |
| 231 | Ga0157374_10680092 | 3300013296 | Bacteria | 1041 |
| 232 | Ga0157374_11608174 | 3300013296 | Unclassified | 674 |
| 233 | Ga0157378_10120473 | 3300013297 | Unclassified | 2418 |
| 234 | Ga0157378_10124213 | 3300013297 | Unclassified | 2383 |
| 235 | Ga0163162_10080403 | 3300013306 | Unclassified | 3327 |
| 236 | Ga0163162_10774470 | 3300013306 | Unclassified | 1078 |
| 237 | Ga0163162_11063583 | 3300013306 | Unclassified | 916 |
| 238 | Ga0163162_11240843 | 3300013306 | Unclassified | 846 |
| 239 | Ga0157375_10005046 | 3300013308 | Bacteria | 11463 |
| 240 | Ga0157375_10082232 | 3300013308 | Bacteria | 3262 |
| 241 | Ga0157375_10407230 | 3300013308 | Bacteria | 1526 |
| 242 | Ga0157375_10652919 | 3300013308 | Unclassified | 1208 |
| 243 | Ga0163163_10012751 | 3300014325 | Bacteria | 7668 |
| 244 | Ga0163163_10031311 | 3300014325 | Bacteria | 5133 |
| 245 | Ga0163163_10350949 | 3300014325 | Bacteria | 1531 |
| 246 | Ga0157380_10009141 | 3300014326 | Bacteria | 7088 |
| 247 | Ga0157380_10242903 | 3300014326 | Bacteria | 1625 |
| 248 | Ga0157380_11442916 | 3300014326 | Unclassified | 740 |
| 249 | Ga0182008_10008707 | 3300014497 | Bacteria | 5519 |
| 250 | Ga0157377_10030046 | 3300014745 | Bacteria | 2940 |
| 251 | Ga0157377_10055129 | 3300014745 | Bacteria | 2253 |
| 252 | Ga0157379_10063954 | 3300014968 | Unclassified | 3289 |
| 253 | Ga0157379_10745607 | 3300014968 | Unclassified | 922 |
| 254 | Ga0157376_10284678 | 3300014969 | Bacteria | 1558 |
| 255 | Ga0157376_10462285 | 3300014969 | Unclassified | 1240 |
| 256 | Ga0207642_10180907 | 3300025899 | Unclassified | 1149 |
| 257 | Ga0207680_10361278 | 3300025903 | Unclassified | 1021 |
| 258 | Ga0207680_10468029 | 3300025903 | Bacteria | 896 |
| 259 | Ga0207699_10252557 | 3300025906 | Unclassified | 1216 |
| 260 | Ga0207645_10129073 | 3300025907 | Bacteria | 1645 |
| 261 | Ga0207643_10021930 | 3300025908 | Unclassified | 3514 |
| 262 | Ga0207643_10818658 | 3300025908 | Unclassified | 603 |
| 263 | Ga0207654_10007936 | 3300025911 | Bacteria | 5353 |
| 264 | Ga0207671_10046960 | 3300025914 | Bacteria | 3195 |
| 265 | Ga0207660_10265018 | 3300025917 | Unclassified | 1360 |
| 266 | Ga0207662_10015989 | 3300025918 | Unclassified | 4229 |
| 267 | Ga0207662_10145980 | 3300025918 | Unclassified | 1502 |
| 268 | Ga0207649_10011382 | 3300025920 | Bacteria | 4906 |
| 269 | Ga0207652_10815989 | 3300025921 | Bacteria | 828 |
| 270 | Ga0207646_10678010 | 3300025922 | Unclassified | 922 |
| 271 | Ga0207681_10006926 | 3300025923 | Bacteria | 6955 |
| 272 | Ga0207681_10170655 | 3300025923 | Bacteria | 1648 |
| 273 | Ga0207681_10205691 | 3300025923 | Bacteria | 1514 |
| 274 | Ga0207650_10035621 | 3300025925 | Bacteria | 3616 |
| 275 | Ga0207650_10071451 | 3300025925 | Unclassified | 2611 |
| 276 | Ga0207650_10122474 | 3300025925 | Unclassified | 2027 |
| 277 | Ga0207650_10130150 | 3300025925 | Unclassified | 1968 |
| 278 | Ga0207650_10314577 | 3300025925 | Bacteria | 1281 |
| 279 | Ga0207650_10892687 | 3300025925 | Unclassified | 755 |
| 280 | Ga0207659_10000770 | 3300025926 | Bacteria | 18992 |
| 281 | Ga0207659_10002736 | 3300025926 | Bacteria | 10521 |
| 282 | Ga0207659_10012559 | 3300025926 | Bacteria | 5393 |
| 283 | Ga0207659_10031252 | 3300025926 | Unclassified | 3643 |
| 284 | Ga0207659_10316852 | 3300025926 | Bacteria | 1285 |
| 285 | Ga0207659_11180668 | 3300025926 | Unclassified | 658 |
| 286 | Ga0207644_10015899 | 3300025931 | Bacteria | 5060 |
| 287 | Ga0207706_10025310 | 3300025933 | Bacteria | 5319 |
| 288 | Ga0207706_10142367 | 3300025933 | Bacteria | 2109 |
| 289 | Ga0207706_10350575 | 3300025933 | Bacteria | 1284 |
| 290 | Ga0207686_10558823 | 3300025934 | Unclassified | 896 |
| 291 | Ga0207709_10159481 | 3300025935 | Unclassified | 1571 |
| 292 | Ga0207709_10220619 | 3300025935 | Unclassified | 1367 |
| 293 | Ga0207670_10010541 | 3300025936 | Bacteria | 5331 |
| 294 | Ga0207670_10060926 | 3300025936 | Bacteria | 2573 |
| 295 | Ga0207670_10098152 | 3300025936 | Unclassified | 2087 |
| 296 | Ga0207670_10357511 | 3300025936 | Bacteria | 1158 |
| 297 | Ga0207670_10564760 | 3300025936 | Bacteria | 931 |
| 298 | Ga0207670_10684772 | 3300025936 | Unclassified | 848 |
| 299 | Ga0207691_10027473 | 3300025940 | Bacteria | 5334 |
| 300 | Ga0207691_10134701 | 3300025940 | Bacteria | 2180 |
| 301 | Ga0207711_10064517 | 3300025941 | Unclassified | 3164 |
| 302 | Ga0207711_10118958 | 3300025941 | Unclassified | 2357 |
| 303 | Ga0207689_10089597 | 3300025942 | Unclassified | 2527 |
| 304 | Ga0207689_10485344 | 3300025942 | Bacteria | 1035 |
| 305 | Ga0207679_10006534 | 3300025945 | Bacteria | 7370 |
| 306 | Ga0207679_10177531 | 3300025945 | Unclassified | 1759 |
| 307 | Ga0207679_10497131 | 3300025945 | Bacteria | 1088 |
| 308 | Ga0207679_11308111 | 3300025945 | Unclassified | 665 |
| 309 | Ga0207667_10739093 | 3300025949 | Unclassified | 984 |
| 310 | Ga0207667_11117062 | 3300025949 | Unclassified | 771 |
| 311 | Ga0207651_10063719 | 3300025960 | Bacteria | 2576 |
| 312 | Ga0207651_10066444 | 3300025960 | Archaea | 2534 |
| 313 | Ga0207651_10181689 | 3300025960 | Bacteria | 1669 |
| 314 | Ga0207651_10223885 | 3300025960 | Bacteria | 1523 |
| 315 | Ga0207651_10347290 | 3300025960 | Unclassified | 1248 |
| 316 | Ga0207651_10684851 | 3300025960 | Unclassified | 902 |
| 317 | Ga0207651_10874895 | 3300025960 | Unclassified | 799 |
| 318 | Ga0207712_10004314 | 3300025961 | Bacteria | 8979 |
| 319 | Ga0207640_10343865 | 3300025981 | Unclassified | 1196 |
| 320 | Ga0207658_10129666 | 3300025986 | Unclassified | 2024 |
| 321 | Ga0207677_10403326 | 3300026023 | Unclassified | 1160 |
| 322 | Ga0207677_10469562 | 3300026023 | Bacteria | 1082 |
| 323 | Ga0207703_10019674 | 3300026035 | Bacteria | 5277 |
| 324 | Ga0207703_10074719 | 3300026035 | Unclassified | 2807 |
| 325 | Ga0207703_10090141 | 3300026035 | Unclassified | 2576 |
| 326 | Ga0207703_10181006 | 3300026035 | Bacteria | 1860 |
| 327 | Ga0207703_10603746 | 3300026035 | Unclassified | 1038 |
| 328 | Ga0207678_10641558 | 3300026067 | Unclassified | 933 |
| 329 | Ga0207708_10012999 | 3300026075 | Bacteria | 6210 |
| 330 | Ga0207708_10171814 | 3300026075 | Bacteria | 1717 |
| 331 | Ga0207708_10964025 | 3300026075 | Unclassified | 740 |
| 332 | Ga0207702_10060059 | 3300026078 | Unclassified | 3240 |
| 333 | Ga0207641_10005559 | 3300026088 | Bacteria | 10744 |
| 334 | Ga0207641_10013677 | 3300026088 | Bacteria | 6659 |
| 335 | Ga0207641_10256554 | 3300026088 | Bacteria | 1635 |
| 336 | Ga0207641_10983816 | 3300026088 | Unclassified | 840 |
| 337 | Ga0207648_10000835 | 3300026089 | Bacteria | 34699 |
| 338 | Ga0207676_10005398 | 3300026095 | Bacteria | 9048 |
| 339 | Ga0207676_10067593 | 3300026095 | Bacteria | 2855 |
| 340 | Ga0207676_10234101 | 3300026095 | Unclassified | 1644 |
| 341 | Ga0207676_11333095 | 3300026095 | Unclassified | 713 |
| 342 | Ga0207674_10008418 | 3300026116 | Bacteria | 11914 |
| 343 | Ga0207674_10051361 | 3300026116 | Unclassified | 4208 |
| 344 | Ga0207674_10074590 | 3300026116 | Bacteria | 3404 |
| 345 | Ga0207674_10190424 | 3300026116 | Bacteria | 2001 |
| 346 | Ga0207675_100001637 | 3300026118 | Bacteria | 22454 |
| 347 | Ga0207675_100308191 | 3300026118 | Unclassified | 1543 |
| 348 | Ga0207683_10196133 | 3300026121 | Unclassified | 1835 |
| 349 | Ga0207683_10250202 | 3300026121 | Bacteria | 1617 |
| 350 | Ga0207683_10557739 | 3300026121 | Bacteria | 1059 |
| 351 | Ga0207683_10692983 | 3300026121 | Unclassified | 944 |
| 352 | Ga0207698_11263048 | 3300026142 | Unclassified | 753 |
| 353 | Ga0209966_1029147 | 3300027695 | Bacteria | 1111 |
| 354 | Ga0207428_10007529 | 3300027907 | Bacteria | 9921 |
| 355 | Ga0207428_10017908 | 3300027907 | Bacteria | 6071 |
| 356 | Ga0207428_10434271 | 3300027907 | Bacteria | 958 |
| 357 | Ga0207428_10438167 | 3300027907 | Unclassified | 954 |
| 358 | Ga0268266_10702925 | 3300028379 | Bacteria | 974 |
| 359 | Ga0268265_10001817 | 3300028380 | Bacteria | 17054 |
| 360 | Ga0268265_10150559 | 3300028380 | Unclassified | 1962 |
| 361 | Ga0268265_11326346 | 3300028380 | Unclassified | 720 |
| 362 | Ga0268264_10013880 | 3300028381 | Bacteria | 6624 |
| 363 | Ga0268264_10797462 | 3300028381 | Unclassified | 943 |
| 364 | Ga0265325_10032343 | 3300031241 | Bacteria | 2793 |
| 365 | Ga0307416_100480102 | 3300032002 | Unclassified | 1303 |
| 366 | Ga0307415_100820644 | 3300032126 | Unclassified | 851 |
| 367 | Ga0373958_0103095 | 3300034819 | Unclassified | 672 |
| 368 | Ga0373940_0127299 | 3300035088 | Unclassified | 795 |
| 369 | Ga0373939_0034695 | 3300035114 | Unclassified | 1482 |
| 370 | Ga0373939_0037632 | 3300035114 | Unclassified | 1438 |
| 371 | Ga0373941_0121447 | 3300035115 | Unclassified | 932 |
| 372 | Ga0373942_0115007 | 3300035207 | Unclassified | 835 |
| 373 | Ga0373961_0107574 | 3300035241 | Unclassified | 910 |
| 374 | Ga0373962_0266805 | 3300035242 | Unclassified | 599 |
| 375 | Ga0373931_0109025 | 3300035691 | Bacteria | 1568 |
| 376 | Ga0373931_0471889 | 3300035691 | Unclassified | 805 |
| 377 | Ga0373931_1115098 | 3300035691 | Unclassified | 538 |
| 378 | Ga0373935_0828832 | 3300035692 | Unclassified | 684 |
| 379 | Ga0373927_0054818 | 3300035695 | Bacteria | 2579 |
| 380 | Ga0373925_0866208 | 3300037068 | Bacteria | 745 |
| 381 | Ga0439436_0043417 | 3300041404 | Unclassified | 1283 |
| 382 | Ga0439436_0180364 | 3300041404 | Unclassified | 601 |
| 383 | Ga0439453_0009502 | 3300041408 | Bacteria | 1586 |
| 384 | Ga0439461_0040446 | 3300041410 | Unclassified | 1005 |
| 385 | Ga0439433_0051680 | 3300041999 | Unclassified | 970 |
| 386 | Ga0450898_107680 | 3300042134 | Bacteria | 587 |
| 387 | Ga0439435_0037185 | 3300042436 | Bacteria | 1348 |
| 388 | Ga0451577_0226523 | 3300042876 | Bacteria | 1690 |
| 389 | Ga0451577_0619416 | 3300042876 | Bacteria | 982 |
| 390 | Ga0453683_0351423 | 3300044673 | Unclassified | 947 |
| 391 | Ga0451576_0005215 | 3300045051 | Bacteria | 16411 |
| 392 | Ga0451576_0044829 | 3300045051 | Unclassified | 4659 |
| 393 | Ga0451576_0070771 | 3300045051 | Bacteria | 3630 |
| 394 | Ga0451576_0146163 | 3300045051 | Unclassified | 2465 |
| 395 | Ga0451576_0295705 | 3300045051 | Bacteria | 1693 |
| 396 | Ga0451576_0620729 | 3300045051 | Unclassified | 1136 |
| 397 | Ga0451576_0933430 | 3300045051 | Bacteria | 910 |
| 398 | Ga0451576_1659755 | 3300045051 | Unclassified | 662 |
| 399 | Ga0495580_0143259 | 3300046472 | Unclassified | 1657 |
| 400 | Ga0495580_0156359 | 3300046472 | Bacteria | 1579 |
| 401 | Ga0495580_0238096 | 3300046472 | Bacteria | 1248 |
| 402 | Ga0495582_0126677 | 3300046473 | Bacteria | 1441 |
| 403 | Ga0495582_0312448 | 3300046473 | Unclassified | 904 |
| 404 | Ga0495584_0311074 | 3300046491 | Bacteria | 800 |
| 405 | Ga0495584_0325433 | 3300046491 | Unclassified | 781 |
| 406 | Ga0495594_0006593 | 3300046499 | Bacteria | 5973 |
| 407 | Ga0495594_0534863 | 3300046499 | Unclassified | 665 |
| 408 | Ga0495630_0787489 | 3300046517 | Unclassified | 726 |
| 409 | Ga0495663_0018268 | 3300046525 | Unclassified | 1996 |
| 410 | Ga0495666_0240945 | 3300046526 | Unclassified | 825 |
| 411 | Ga0495598_0104831 | 3300046537 | Bacteria | 940 |
| 412 | Ga0495621_0003475 | 3300046539 | Bacteria | 4348 |
| 413 | Ga0495621_0067042 | 3300046539 | Unclassified | 1314 |
| 414 | Ga0495621_0161414 | 3300046539 | Unclassified | 886 |
| 415 | Ga0495621_0219504 | 3300046539 | Unclassified | 769 |
| 416 | Ga0495633_0180091 | 3300046558 | Bacteria | 973 |
| 417 | Ga0495668_0257533 | 3300046616 | Bacteria | 955 |
| 418 | Ga0495635_0025402 | 3300046663 | Bacteria | 4126 |
| 419 | Ga0495659_0014502 | 3300046664 | Bacteria | 2580 |
| 420 | Ga0495659_0110240 | 3300046664 | Bacteria | 1074 |
| 421 | Ga0495659_0172628 | 3300046664 | Bacteria | 877 |
| 422 | Ga0495658_0115588 | 3300046683 | Bacteria | 1617 |
| 423 | Ga0495669_0010253 | 3300046684 | Bacteria | 3959 |
| 424 | Ga0495613_0008197 | 3300046689 | Bacteria | 7762 |
| 425 | Ga0495581_0300358 | 3300047315 | Unclassified | 938 |
| 426 | Ga0495636_0046342 | 3300047318 | Bacteria | 1813 |
| 427 | Ga0495636_0126588 | 3300047318 | Bacteria | 1134 |
| 428 | Ga0495684_0316687 | 3300047471 | Bacteria | 1116 |
| 429 | Ga0495614_0141589 | 3300048089 | Unclassified | 1069 |
| 430 | Ga0495615_0003580 | 3300048090 | Unclassified | 2618 |
| 431 | Ga0496100_1208252 | 3300048903 | Unclassified | 596 |
| 432 | Ga0496101_0337195 | 3300048904 | Unclassified | 1184 |
| 433 | Ga0496102_0780644 | 3300048905 | Unclassified | 878 |
| 434 | Ga0496104_0070351 | 3300048907 | Bacteria | 3326 |
| 435 | Ga0496105_0018911 | 3300048908 | Bacteria | 5549 |
| 436 | Ga0496105_0535813 | 3300048908 | Unclassified | 916 |
| 437 | Ga0496106_0124214 | 3300048909 | Bacteria | 2020 |
| 438 | Ga0496106_0260457 | 3300048909 | Bacteria | 1388 |
| 439 | Ga0496106_0827424 | 3300048909 | Unclassified | 734 |
| 440 | Ga0496107_0740275 | 3300048910 | Unclassified | 722 |
| 441 | Ga0496108_0010091 | 3300048911 | Bacteria | 7663 |
| 442 | Ga0496108_0423589 | 3300048911 | Bacteria | 1163 |
| 443 | Ga0496108_0790263 | 3300048911 | Unclassified | 819 |
| 444 | Ga0496109_0001912 | 3300048912 | Bacteria | 17308 |
| 445 | Ga0496109_0280632 | 3300048912 | Bacteria | 1570 |
| 446 | Ga0496109_1485880 | 3300048912 | Unclassified | 613 |
| 447 | Ga0496110_0001931 | 3300048913 | Bacteria | 15354 |
| 448 | Ga0496110_0049047 | 3300048913 | Bacteria | 3703 |
| 449 | Ga0496111_0006720 | 3300048914 | Bacteria | 7487 |
| 450 | Ga0496111_0335506 | 3300048914 | Bacteria | 1119 |
| 451 | Ga0496112_0001225 | 3300048915 | Bacteria | 19326 |
| 452 | Ga0496112_1417732 | 3300048915 | Unclassified | 609 |
| 453 | Ga0496113_0474947 | 3300048916 | Unclassified | 1005 |
| 454 | Ga0496114_1211674 | 3300048917 | Unclassified | 641 |
| 455 | Ga0496115_0102871 | 3300048918 | Unclassified | 2343 |
| 456 | Ga0501040_0097927 | 3300049576 | Bacteria | 2044 |
| 457 | Ga0501041_0285976 | 3300049577 | Bacteria | 1038 |
| 458 | Ga0501046_0655589 | 3300049580 | Unclassified | 742 |
| 459 | Ga0501071_0221702 | 3300049587 | Unclassified | 1423 |
| 460 | Ga0501072_0167572 | 3300049588 | Bacteria | 1753 |
| 461 | Ga0501072_0180189 | 3300049588 | Bacteria | 1685 |
| 462 | Ga0501076_0161214 | 3300049592 | Bacteria | 1827 |
| 463 | Ga0501076_0823293 | 3300049592 | Bacteria | 766 |
| 464 | Ga0501076_0940321 | 3300049592 | Unclassified | 712 |
| 465 | Ga0501217_148994 | 3300049661 | Unclassified | 698 |
| 466 | Ga0501228_013915 | 3300049666 | Unclassified | 844 |
| 467 | Ga0501249_047856 | 3300049679 | Unclassified | 978 |
| 468 | Ga0501255_013500 | 3300049684 | Bacteria | 971 |
| 469 | Ga0501256_010495 | 3300049685 | Bacteria | 885 |
| 470 | Ga0501081_0092720 | 3300049743 | Unclassified | 2126 |
| 471 | Ga0501081_0518242 | 3300049743 | Unclassified | 889 |
| 472 | Ga0501265_056374 | 3300049762 | Unclassified | 631 |
| 473 | Ga0501271_033103 | 3300049768 | Bacteria | 647 |
| 474 | Ga0501276_007796 | 3300049773 | Unclassified | 862 |
| 475 | Ga0501045_0796043 | 3300049824 | Unclassified | 696 |
| 476 | nmdc:mga07m45_652593_c1 | 3300050496 | Bacteria | 606 |
| 477 | nmdc:mga05p37_109336_c1 | 3300050507 | Bacteria | 3401 |
| 478 | nmdc:mga05p37_1845264_c1 | 3300050507 | Bacteria | 581 |
| 479 | nmdc:mga05p37_48_c1 | 3300050507 | Bacteria | 104863 |
| 480 | nmdc:mga05p37_578625_c1 | 3300050507 | Bacteria | 1272 |
| 481 | nmdc:mga09592_312380_c1 | 3300050508 | Bacteria | 1362 |
| 482 | nmdc:mga09592_335156_c1 | 3300050508 | Bacteria | 1310 |
| 483 | nmdc:mga09592_649796_c1 | 3300050508 | Bacteria | 900 |
| 484 | nmdc:mga06r32_317197_c1 | 3300050510 | Unclassified | 1544 |
| 485 | nmdc:mga06r32_660488_c1 | 3300050510 | Bacteria | 1013 |
| 486 | nmdc:mga08y16_14177_c1 | 3300050511 | Bacteria | 8388 |
| 487 | nmdc:mga08y16_324229_c1 | 3300050511 | Bacteria | 1585 |
| 488 | nmdc:mga08y16_41946_c1 | 3300050511 | Unclassified | 4792 |
| 489 | nmdc:mga08y16_447573_c1 | 3300050511 | Bacteria | 1317 |
| 490 | nmdc:mga08y16_509981_c1 | 3300050511 | Bacteria | 1221 |
| 491 | nmdc:mga08y16_815807_c1 | 3300050511 | Bacteria | 925 |
| 492 | nmdc:mga08y16_825751_c1 | 3300050511 | Bacteria | 918 |
| 493 | nmdc:mga08y16_9646_c1 | 3300050511 | Bacteria | 10137 |
| 494 | nmdc:mga0n895_235974_c1 | 3300050512 | Bacteria | 1856 |
| 495 | nmdc:mga0n895_342004_c1 | 3300050512 | Bacteria | 1515 |
| 496 | nmdc:mga0n895_5270_c1 | 3300050512 | Bacteria | 10271 |
| 497 | nmdc:mga0n895_581688_c1 | 3300050512 | Unclassified | 1123 |
| 498 | nmdc:mga0n895_59800_c1 | 3300050512 | Bacteria | 3760 |
| 499 | nmdc:mga0n895_758334_c1 | 3300050512 | Unclassified | 963 |
| 500 | nmdc:mga0rr50_17008_c1 | 3300050513 | Bacteria | 4844 |
| 501 | nmdc:mga0rr50_203056_c1 | 3300050513 | Bacteria | 1629 |
| 502 | nmdc:mga0a205_17976_c1 | 3300050515 | Bacteria | 6639 |
| 503 | nmdc:mga0a205_24686_c1 | 3300050515 | Bacteria | 5719 |
| 504 | nmdc:mga0a205_270454_c1 | 3300050515 | Bacteria | 1576 |
| 505 | Ga0495601_0035163 | 3300053077 | Bacteria | 3126 |
| 506 | Ga0495619_0472777 | 3300053085 | Bacteria | 863 |
| 507 | Ga0590071_000079 | 3300059421 | Bacteria | 26516 |
| 508 | Ga0590074_000280 | 3300059423 | Bacteria | 6888 |
| 509 | Ga0590075_000048 | 3300059424 | Bacteria | 31197 |
| 510 | Ga0590077_000030 | 3300059426 | Bacteria | 33448 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013296 | Ga0157374_11608174 | Ga0157374_116081742 | 140 |
| 2 | 3300041404 | Ga0439436_0180364 | Ga0439436_0180364_34_492 | 151 |
| 3 | 3300005841 | Ga0068863_100024545 | Ga0068863_1000245454 | 155 |
| 4 | 3300013296 | Ga0157374_10680092 | Ga0157374_106800922 | 155 |
| 5 | 3300025931 | Ga0207644_10015899 | Ga0207644_100158993 | 155 |
| 6 | 3300026088 | Ga0207641_10013677 | Ga0207641_100136777 | 155 |
| 7 | 3300050512 | nmdc:mga0n895_235974_c1 | nmdc:mga0n895_235974_c1_1208_1675 | 155 |
| 8 | 3300005330 | Ga0070690_100038567 | Ga0070690_1000385673 | 156 |
| 9 | 3300005438 | Ga0070701_10007601 | Ga0070701_100076015 | 156 |
| 10 | 3300005444 | Ga0070694_100357140 | Ga0070694_1003571402 | 156 |
| 11 | 3300005544 | Ga0070686_100017736 | Ga0070686_1000177363 | 156 |
| 12 | 3300005615 | Ga0070702_100045231 | Ga0070702_1000452313 | 156 |
| 13 | 3300013297 | Ga0157378_10124213 | Ga0157378_101242134 | 156 |
| 14 | 3300045051 | Ga0451576_0005215 | Ga0451576_0005215_14726_15196 | 156 |
| 15 | 3300005334 | Ga0068869_100024646 | Ga0068869_1000246463 | 157 |
| 16 | 3300005440 | Ga0070705_100162700 | Ga0070705_1001627003 | 157 |
| 17 | 3300005549 | Ga0070704_100006326 | Ga0070704_1000063267 | 157 |
| 18 | 3300006881 | Ga0068865_100469302 | Ga0068865_1004693022 | 157 |
| 19 | 3300025942 | Ga0207689_10089597 | Ga0207689_100895974 | 157 |
| 20 | 3300046539 | Ga0495621_0067042 | Ga0495621_0067042_201_674 | 157 |
| 21 | 3300049592 | Ga0501076_0823293 | Ga0501076_0823293_46_678 | 157 |
| 22 | 3300005547 | Ga0070693_100538853 | Ga0070693_1005388532 | 158 |
| 23 | 3300009094 | Ga0111539_10656559 | Ga0111539_106565592 | 158 |
| 24 | 3300009148 | Ga0105243_10061887 | Ga0105243_100618873 | 158 |
| 25 | 3300009148 | Ga0105243_11643903 | Ga0105243_116439031 | 158 |
| 26 | 3300025935 | Ga0207709_10220619 | Ga0207709_102206192 | 158 |
| 27 | 3300026075 | Ga0207708_10171814 | Ga0207708_101718142 | 158 |
| 28 | 3300045051 | Ga0451576_0620729 | Ga0451576_0620729_184_660 | 158 |
| 29 | 3300049592 | Ga0501076_0161214 | Ga0501076_0161214_1213_1692 | 158 |
| 30 | 3300005617 | Ga0068859_102144960 | Ga0068859_1021449601 | 159 |
| 31 | 3300005937 | Ga0081455_10061305 | Ga0081455_100613055 | 159 |
| 32 | 3300006195 | Ga0075366_10505933 | Ga0075366_105059332 | 159 |
| 33 | 3300006844 | Ga0075428_100652730 | Ga0075428_1006527303 | 159 |
| 34 | 3300006852 | Ga0075433_10089891 | Ga0075433_100898913 | 159 |
| 35 | 3300006931 | Ga0097620_102144989 | Ga0097620_1021449891 | 159 |
| 36 | 3300009098 | Ga0105245_11110743 | Ga0105245_111107431 | 159 |
| 37 | 3300009176 | Ga0105242_10163510 | Ga0105242_101635104 | 159 |
| 38 | 3300014326 | Ga0157380_11442916 | Ga0157380_114429162 | 159 |
| 39 | 3300014497 | Ga0182008_10008707 | Ga0182008_100087078 | 159 |
| 40 | 3300025899 | Ga0207642_10180907 | Ga0207642_101809072 | 159 |
| 41 | 3300025934 | Ga0207686_10558823 | Ga0207686_105588231 | 159 |
| 42 | 3300026023 | Ga0207677_10469562 | Ga0207677_104695622 | 159 |
| 43 | 3300031241 | Ga0265325_10032343 | Ga0265325_100323433 | 159 |
| 44 | 3300035088 | Ga0373940_0127299 | Ga0373940_0127299_133_612 | 159 |
| 45 | 3300035691 | Ga0373931_0109025 | Ga0373931_0109025_1069_1548 | 159 |
| 46 | 3300041404 | Ga0439436_0043417 | Ga0439436_0043417_647_1129 | 159 |
| 47 | 3300041410 | Ga0439461_0040446 | Ga0439461_0040446_59_541 | 159 |
| 48 | 3300041999 | Ga0439433_0051680 | Ga0439433_0051680_376_858 | 159 |
| 49 | 3300046539 | Ga0495621_0219504 | Ga0495621_0219504_238_717 | 159 |
| 50 | 3300050507 | nmdc:mga05p37_109336_c1 | nmdc:mga05p37_109336_c1_1877_2356 | 159 |
| 51 | 3300050511 | nmdc:mga08y16_324229_c1 | nmdc:mga08y16_324229_c1_713_1192 | 159 |
| 52 | 3300050512 | nmdc:mga0n895_59800_c1 | nmdc:mga0n895_59800_c1_3128_3607 | 159 |
| 53 | 3300050513 | nmdc:mga0rr50_203056_c1 | nmdc:mga0rr50_203056_c1_488_967 | 159 |
| 54 | 3300050515 | nmdc:mga0a205_17976_c1 | nmdc:mga0a205_17976_c1_4985_5464 | 159 |
| 55 | 2162886007 | SwRhRL2b_contig_3088676 | SwRhRL2b_0820.00002100 | 160 |
| 56 | 3300005289 | Ga0065704_10090590 | Ga0065704_100905904 | 160 |
| 57 | 3300005289 | Ga0065704_10133022 | Ga0065704_101330222 | 160 |
| 58 | 3300005289 | Ga0065704_10205014 | Ga0065704_102050141 | 160 |
| 59 | 3300005289 | Ga0065704_10369352 | Ga0065704_103693522 | 160 |
| 60 | 3300005289 | Ga0065704_10805525 | Ga0065704_108055251 | 160 |
| 61 | 3300005290 | Ga0065712_10076400 | Ga0065712_100764003 | 160 |
| 62 | 3300005290 | Ga0065712_10077821 | Ga0065712_100778212 | 160 |
| 63 | 3300005290 | Ga0065712_10135983 | Ga0065712_101359832 | 160 |
| 64 | 3300005290 | Ga0065712_10206312 | Ga0065712_102063122 | 160 |
| 65 | 3300005290 | Ga0065712_10230908 | Ga0065712_102309081 | 160 |
| 66 | 3300005293 | Ga0065715_10035530 | Ga0065715_100355302 | 160 |
| 67 | 3300005293 | Ga0065715_10114683 | Ga0065715_101146833 | 160 |
| 68 | 3300005293 | Ga0065715_10192838 | Ga0065715_101928383 | 160 |
| 69 | 3300005293 | Ga0065715_11039474 | Ga0065715_110394741 | 160 |
| 70 | 3300005295 | Ga0065707_10002467 | Ga0065707_100024672 | 160 |
| 71 | 3300005295 | Ga0065707_10090251 | Ga0065707_100902514 | 160 |
| 72 | 3300005295 | Ga0065707_10112338 | Ga0065707_101123384 | 160 |
| 73 | 3300005295 | Ga0065707_10119449 | Ga0065707_101194493 | 160 |
| 74 | 3300005295 | Ga0065707_10181474 | Ga0065707_101814743 | 160 |
| 75 | 3300005328 | Ga0070676_10124225 | Ga0070676_101242253 | 160 |
| 76 | 3300005328 | Ga0070676_10161421 | Ga0070676_101614212 | 160 |
| 77 | 3300005328 | Ga0070676_10182179 | Ga0070676_101821791 | 160 |
| 78 | 3300005329 | Ga0070683_100012348 | Ga0070683_1000123486 | 160 |
| 79 | 3300005330 | Ga0070690_100062898 | Ga0070690_1000628983 | 160 |
| 80 | 3300005330 | Ga0070690_100112222 | Ga0070690_1001122224 | 160 |
| 81 | 3300005331 | Ga0070670_100009539 | Ga0070670_1000095398 | 160 |
| 82 | 3300005331 | Ga0070670_100049097 | Ga0070670_1000490976 | 160 |
| 83 | 3300005331 | Ga0070670_100082507 | Ga0070670_1000825075 | 160 |
| 84 | 3300005331 | Ga0070670_100223008 | Ga0070670_1002230082 | 160 |
| 85 | 3300005335 | Ga0070666_10647351 | Ga0070666_106473511 | 160 |
| 86 | 3300005336 | Ga0070680_100344312 | Ga0070680_1003443122 | 160 |
| 87 | 3300005336 | Ga0070680_100715597 | Ga0070680_1007155971 | 160 |
| 88 | 3300005336 | Ga0070680_101172955 | Ga0070680_1011729551 | 160 |
| 89 | 3300005337 | Ga0070682_100247141 | Ga0070682_1002471411 | 160 |
| 90 | 3300005338 | Ga0068868_100498629 | Ga0068868_1004986292 | 160 |
| 91 | 3300005338 | Ga0068868_100977664 | Ga0068868_1009776641 | 160 |
| 92 | 3300005340 | Ga0070689_100020229 | Ga0070689_1000202292 | 160 |
| 93 | 3300005340 | Ga0070689_100044284 | Ga0070689_1000442845 | 160 |
| 94 | 3300005340 | Ga0070689_100074187 | Ga0070689_1000741873 | 160 |
| 95 | 3300005340 | Ga0070689_100149752 | Ga0070689_1001497524 | 160 |
| 96 | 3300005340 | Ga0070689_100854302 | Ga0070689_1008543021 | 160 |
| 97 | 3300005343 | Ga0070687_100006294 | Ga0070687_1000062943 | 160 |
| 98 | 3300005343 | Ga0070687_100014411 | Ga0070687_1000144113 | 160 |
| 99 | 3300005343 | Ga0070687_100194129 | Ga0070687_1001941293 | 160 |
| 100 | 3300005344 | Ga0070661_100018541 | Ga0070661_1000185412 | 160 |
| 101 | 3300005353 | Ga0070669_100005982 | Ga0070669_1000059826 | 160 |
| 102 | 3300005353 | Ga0070669_100228836 | Ga0070669_1002288362 | 160 |
| 103 | 3300005353 | Ga0070669_100308479 | Ga0070669_1003084792 | 160 |
| 104 | 3300005354 | Ga0070675_100000986 | Ga0070675_10000098611 | 160 |
| 105 | 3300005354 | Ga0070675_100002041 | Ga0070675_10000204110 | 160 |
| 106 | 3300005354 | Ga0070675_100018445 | Ga0070675_1000184454 | 160 |
| 107 | 3300005354 | Ga0070675_100106288 | Ga0070675_1001062883 | 160 |
| 108 | 3300005354 | Ga0070675_100168866 | Ga0070675_1001688662 | 160 |
| 109 | 3300005355 | Ga0070671_100007092 | Ga0070671_10000709212 | 160 |
| 110 | 3300005355 | Ga0070671_100038808 | Ga0070671_1000388082 | 160 |
| 111 | 3300005355 | Ga0070671_100731953 | Ga0070671_1007319531 | 160 |
| 112 | 3300005364 | Ga0070673_100003385 | Ga0070673_1000033853 | 160 |
| 113 | 3300005364 | Ga0070673_100052842 | Ga0070673_1000528423 | 160 |
| 114 | 3300005364 | Ga0070673_101378274 | Ga0070673_1013782741 | 160 |
| 115 | 3300005364 | Ga0070673_101422655 | Ga0070673_1014226551 | 160 |
| 116 | 3300005365 | Ga0070688_100292761 | Ga0070688_1002927613 | 160 |
| 117 | 3300005365 | Ga0070688_100340371 | Ga0070688_1003403712 | 160 |
| 118 | 3300005367 | Ga0070667_100329593 | Ga0070667_1003295932 | 160 |
| 119 | 3300005434 | Ga0070709_10310538 | Ga0070709_103105382 | 160 |
| 120 | 3300005436 | Ga0070713_101658390 | Ga0070713_1016583901 | 160 |
| 121 | 3300005438 | Ga0070701_10005894 | Ga0070701_100058945 | 160 |
| 122 | 3300005438 | Ga0070701_10106543 | Ga0070701_101065432 | 160 |
| 123 | 3300005440 | Ga0070705_100048143 | Ga0070705_1000481434 | 160 |
| 124 | 3300005440 | Ga0070705_100096623 | Ga0070705_1000966234 | 160 |
| 125 | 3300005440 | Ga0070705_100108218 | Ga0070705_1001082183 | 160 |
| 126 | 3300005441 | Ga0070700_100008129 | Ga0070700_1000081294 | 160 |
| 127 | 3300005441 | Ga0070700_100582763 | Ga0070700_1005827632 | 160 |
| 128 | 3300005444 | Ga0070694_100004550 | Ga0070694_1000045504 | 160 |
| 129 | 3300005444 | Ga0070694_100014770 | Ga0070694_1000147703 | 160 |
| 130 | 3300005444 | Ga0070694_100775323 | Ga0070694_1007753231 | 160 |
| 131 | 3300005455 | Ga0070663_100640053 | Ga0070663_1006400532 | 160 |
| 132 | 3300005456 | Ga0070678_100064102 | Ga0070678_1000641023 | 160 |
| 133 | 3300005456 | Ga0070678_100158896 | Ga0070678_1001588962 | 160 |
| 134 | 3300005457 | Ga0070662_100088587 | Ga0070662_1000885872 | 160 |
| 135 | 3300005457 | Ga0070662_100310603 | Ga0070662_1003106031 | 160 |
| 136 | 3300005459 | Ga0068867_100005805 | Ga0068867_1000058056 | 160 |
| 137 | 3300005466 | Ga0070685_10162624 | Ga0070685_101626241 | 160 |
| 138 | 3300005468 | Ga0070707_100396057 | Ga0070707_1003960572 | 160 |
| 139 | 3300005471 | Ga0070698_100009951 | Ga0070698_1000099515 | 160 |
| 140 | 3300005471 | Ga0070698_100977811 | Ga0070698_1009778111 | 160 |
| 141 | 3300005518 | Ga0070699_100012987 | Ga0070699_1000129879 | 160 |
| 142 | 3300005518 | Ga0070699_100027731 | Ga0070699_1000277312 | 160 |
| 143 | 3300005530 | Ga0070679_100527877 | Ga0070679_1005278772 | 160 |
| 144 | 3300005530 | Ga0070679_100890820 | Ga0070679_1008908202 | 160 |
| 145 | 3300005535 | Ga0070684_100000479 | Ga0070684_10000047919 | 160 |
| 146 | 3300005535 | Ga0070684_100413088 | Ga0070684_1004130882 | 160 |
| 147 | 3300005539 | Ga0068853_100491607 | Ga0068853_1004916072 | 160 |
| 148 | 3300005543 | Ga0070672_100043908 | Ga0070672_1000439084 | 160 |
| 149 | 3300005543 | Ga0070672_100160722 | Ga0070672_1001607223 | 160 |
| 150 | 3300005543 | Ga0070672_100208728 | Ga0070672_1002087282 | 160 |
| 151 | 3300005544 | Ga0070686_100015821 | Ga0070686_1000158216 | 160 |
| 152 | 3300005544 | Ga0070686_100017881 | Ga0070686_1000178811 | 160 |
| 153 | 3300005545 | Ga0070695_100312809 | Ga0070695_1003128092 | 160 |
| 154 | 3300005546 | Ga0070696_100146826 | Ga0070696_1001468262 | 160 |
| 155 | 3300005546 | Ga0070696_100163895 | Ga0070696_1001638953 | 160 |
| 156 | 3300005548 | Ga0070665_100031212 | Ga0070665_1000312124 | 160 |
| 157 | 3300005548 | Ga0070665_101147977 | Ga0070665_1011479772 | 160 |
| 158 | 3300005549 | Ga0070704_100001470 | Ga0070704_1000014706 | 160 |
| 159 | 3300005549 | Ga0070704_100015712 | Ga0070704_1000157122 | 160 |
| 160 | 3300005549 | Ga0070704_100182418 | Ga0070704_1001824182 | 160 |
| 161 | 3300005563 | Ga0068855_101007311 | Ga0068855_1010073112 | 160 |
| 162 | 3300005564 | Ga0070664_100000224 | Ga0070664_10000022424 | 160 |
| 163 | 3300005564 | Ga0070664_100337048 | Ga0070664_1003370481 | 160 |
| 164 | 3300005564 | Ga0070664_100509357 | Ga0070664_1005093572 | 160 |
| 165 | 3300005564 | Ga0070664_100529458 | Ga0070664_1005294582 | 160 |
| 166 | 3300005577 | Ga0068857_100004602 | Ga0068857_1000046024 | 160 |
| 167 | 3300005577 | Ga0068857_100004763 | Ga0068857_1000047636 | 160 |
| 168 | 3300005577 | Ga0068857_100044463 | Ga0068857_1000444633 | 160 |
| 169 | 3300005578 | Ga0068854_100662665 | Ga0068854_1006626652 | 160 |
| 170 | 3300005614 | Ga0068856_100013428 | Ga0068856_1000134286 | 160 |
| 171 | 3300005617 | Ga0068859_100000433 | Ga0068859_1000004337 | 160 |
| 172 | 3300005617 | Ga0068859_100000798 | Ga0068859_1000007986 | 160 |
| 173 | 3300005617 | Ga0068859_100015181 | Ga0068859_1000151815 | 160 |
| 174 | 3300005617 | Ga0068859_100062881 | Ga0068859_1000628814 | 160 |
| 175 | 3300005617 | Ga0068859_100761657 | Ga0068859_1007616572 | 160 |
| 176 | 3300005617 | Ga0068859_100848241 | Ga0068859_1008482411 | 160 |
| 177 | 3300005617 | Ga0068859_101537039 | Ga0068859_1015370392 | 160 |
| 178 | 3300005618 | Ga0068864_100036386 | Ga0068864_1000363864 | 160 |
| 179 | 3300005618 | Ga0068864_100042123 | Ga0068864_1000421235 | 160 |
| 180 | 3300005618 | Ga0068864_100351717 | Ga0068864_1003517172 | 160 |
| 181 | 3300005618 | Ga0068864_101368594 | Ga0068864_1013685941 | 160 |
| 182 | 3300005719 | Ga0068861_100000410 | Ga0068861_10000041014 | 160 |
| 183 | 3300005719 | Ga0068861_101161007 | Ga0068861_1011610072 | 160 |
| 184 | 3300005840 | Ga0068870_10019235 | Ga0068870_100192353 | 160 |
| 185 | 3300005840 | Ga0068870_10043714 | Ga0068870_100437141 | 160 |
| 186 | 3300005840 | Ga0068870_10595939 | Ga0068870_105959391 | 160 |
| 187 | 3300005840 | Ga0068870_10796930 | Ga0068870_107969301 | 160 |
| 188 | 3300005841 | Ga0068863_100008826 | Ga0068863_1000088266 | 160 |
| 189 | 3300005841 | Ga0068863_100303900 | Ga0068863_1003039002 | 160 |
| 190 | 3300005842 | Ga0068858_100009270 | Ga0068858_1000092705 | 160 |
| 191 | 3300005842 | Ga0068858_100080818 | Ga0068858_1000808184 | 160 |
| 192 | 3300005842 | Ga0068858_100095721 | Ga0068858_1000957212 | 160 |
| 193 | 3300005842 | Ga0068858_100193047 | Ga0068858_1001930471 | 160 |
| 194 | 3300005842 | Ga0068858_100482799 | Ga0068858_1004827992 | 160 |
| 195 | 3300005843 | Ga0068860_100002194 | Ga0068860_1000021944 | 160 |
| 196 | 3300005843 | Ga0068860_100160310 | Ga0068860_1001603102 | 160 |
| 197 | 3300005843 | Ga0068860_101246694 | Ga0068860_1012466941 | 160 |
| 198 | 3300005844 | Ga0068862_100002592 | Ga0068862_1000025926 | 160 |
| 199 | 3300005937 | Ga0081455_10309608 | Ga0081455_103096082 | 160 |
| 200 | 3300006237 | Ga0097621_100087228 | Ga0097621_1000872285 | 160 |
| 201 | 3300006237 | Ga0097621_100269936 | Ga0097621_1002699362 | 160 |
| 202 | 3300006358 | Ga0068871_100353190 | Ga0068871_1003531902 | 160 |
| 203 | 3300006358 | Ga0068871_100436145 | Ga0068871_1004361452 | 160 |
| 204 | 3300006358 | Ga0068871_102335418 | Ga0068871_1023354181 | 160 |
| 205 | 3300006844 | Ga0075428_100019283 | Ga0075428_1000192833 | 160 |
| 206 | 3300006844 | Ga0075428_100339156 | Ga0075428_1003391562 | 160 |
| 207 | 3300006844 | Ga0075428_101173985 | Ga0075428_1011739851 | 160 |
| 208 | 3300006844 | Ga0075428_101598658 | Ga0075428_1015986582 | 160 |
| 209 | 3300006846 | Ga0075430_100548634 | Ga0075430_1005486341 | 160 |
| 210 | 3300006847 | Ga0075431_100381713 | Ga0075431_1003817132 | 160 |
| 211 | 3300006847 | Ga0075431_100384006 | Ga0075431_1003840062 | 160 |
| 212 | 3300006852 | Ga0075433_10045029 | Ga0075433_100450294 | 160 |
| 213 | 3300006852 | Ga0075433_10182879 | Ga0075433_101828792 | 160 |
| 214 | 3300006852 | Ga0075433_10234302 | Ga0075433_102343023 | 160 |
| 215 | 3300006852 | Ga0075433_10694074 | Ga0075433_106940742 | 160 |
| 216 | 3300006871 | Ga0075434_100013394 | Ga0075434_1000133941 | 160 |
| 217 | 3300006871 | Ga0075434_100081445 | Ga0075434_1000814456 | 160 |
| 218 | 3300006871 | Ga0075434_100249579 | Ga0075434_1002495793 | 160 |
| 219 | 3300006871 | Ga0075434_100270957 | Ga0075434_1002709574 | 160 |
| 220 | 3300006871 | Ga0075434_101418807 | Ga0075434_1014188072 | 160 |
| 221 | 3300006880 | Ga0075429_100003426 | Ga0075429_10000342614 | 160 |
| 222 | 3300006880 | Ga0075429_100132596 | Ga0075429_1001325962 | 160 |
| 223 | 3300006880 | Ga0075429_100328555 | Ga0075429_1003285552 | 160 |
| 224 | 3300006880 | Ga0075429_100958904 | Ga0075429_1009589042 | 160 |
| 225 | 3300006881 | Ga0068865_100219105 | Ga0068865_1002191053 | 160 |
| 226 | 3300006931 | Ga0097620_100000433 | Ga0097620_1000004337 | 160 |
| 227 | 3300006931 | Ga0097620_100000798 | Ga0097620_1000007986 | 160 |
| 228 | 3300006931 | Ga0097620_100015182 | Ga0097620_1000151825 | 160 |
| 229 | 3300006931 | Ga0097620_100062882 | Ga0097620_1000628824 | 160 |
| 230 | 3300006931 | Ga0097620_100761678 | Ga0097620_1007616782 | 160 |
| 231 | 3300006931 | Ga0097620_100848306 | Ga0097620_1008483062 | 160 |
| 232 | 3300006931 | Ga0097620_101536910 | Ga0097620_1015369102 | 160 |
| 233 | 3300007076 | Ga0075435_100087233 | Ga0075435_1000872331 | 160 |
| 234 | 3300007076 | Ga0075435_100095462 | Ga0075435_1000954622 | 160 |
| 235 | 3300009093 | Ga0105240_10303304 | Ga0105240_103033043 | 160 |
| 236 | 3300009094 | Ga0111539_10027564 | Ga0111539_100275645 | 160 |
| 237 | 3300009094 | Ga0111539_10032854 | Ga0111539_100328543 | 160 |
| 238 | 3300009094 | Ga0111539_10040795 | Ga0111539_100407956 | 160 |
| 239 | 3300009094 | Ga0111539_10072489 | Ga0111539_100724894 | 160 |
| 240 | 3300009094 | Ga0111539_10194034 | Ga0111539_101940342 | 160 |
| 241 | 3300009094 | Ga0111539_10265851 | Ga0111539_102658513 | 160 |
| 242 | 3300009094 | Ga0111539_10470478 | Ga0111539_104704782 | 160 |
| 243 | 3300009147 | Ga0114129_10004473 | Ga0114129_100044738 | 160 |
| 244 | 3300009147 | Ga0114129_10105684 | Ga0114129_101056843 | 160 |
| 245 | 3300009147 | Ga0114129_10336817 | Ga0114129_103368172 | 160 |
| 246 | 3300009147 | Ga0114129_10736005 | Ga0114129_107360052 | 160 |
| 247 | 3300009147 | Ga0114129_12287474 | Ga0114129_122874741 | 160 |
| 248 | 3300009148 | Ga0105243_10020707 | Ga0105243_100207075 | 160 |
| 249 | 3300009148 | Ga0105243_10465040 | Ga0105243_104650402 | 160 |
| 250 | 3300009174 | Ga0105241_10023260 | Ga0105241_100232603 | 160 |
| 251 | 3300009174 | Ga0105241_10234022 | Ga0105241_102340222 | 160 |
| 252 | 3300009177 | Ga0105248_10212309 | Ga0105248_102123092 | 160 |
| 253 | 3300009177 | Ga0105248_10450946 | Ga0105248_104509462 | 160 |
| 254 | 3300009177 | Ga0105248_10787752 | Ga0105248_107877521 | 160 |
| 255 | 3300009545 | Ga0105237_10062111 | Ga0105237_100621114 | 160 |
| 256 | 3300009551 | Ga0105238_10158825 | Ga0105238_101588253 | 160 |
| 257 | 3300009553 | Ga0105249_10002389 | Ga0105249_100023898 | 160 |
| 258 | 3300009553 | Ga0105249_11045713 | Ga0105249_110457132 | 160 |
| 259 | 3300010375 | Ga0105239_10006592 | Ga0105239_100065928 | 160 |
| 260 | 3300011119 | Ga0105246_10350923 | Ga0105246_103509232 | 160 |
| 261 | 3300013296 | Ga0157374_10124574 | Ga0157374_101245744 | 160 |
| 262 | 3300013296 | Ga0157374_10156025 | Ga0157374_101560252 | 160 |
| 263 | 3300013297 | Ga0157378_10120473 | Ga0157378_101204732 | 160 |
| 264 | 3300013306 | Ga0163162_10080403 | Ga0163162_100804033 | 160 |
| 265 | 3300013306 | Ga0163162_10774470 | Ga0163162_107744702 | 160 |
| 266 | 3300013306 | Ga0163162_11063583 | Ga0163162_110635831 | 160 |
| 267 | 3300013306 | Ga0163162_11240843 | Ga0163162_112408432 | 160 |
| 268 | 3300013308 | Ga0157375_10005046 | Ga0157375_100050466 | 160 |
| 269 | 3300013308 | Ga0157375_10082232 | Ga0157375_100822323 | 160 |
| 270 | 3300013308 | Ga0157375_10407230 | Ga0157375_104072302 | 160 |
| 271 | 3300013308 | Ga0157375_10652919 | Ga0157375_106529192 | 160 |
| 272 | 3300014325 | Ga0163163_10012751 | Ga0163163_100127514 | 160 |
| 273 | 3300014325 | Ga0163163_10031311 | Ga0163163_100313113 | 160 |
| 274 | 3300014325 | Ga0163163_10350949 | Ga0163163_103509493 | 160 |
| 275 | 3300014326 | Ga0157380_10009141 | Ga0157380_100091413 | 160 |
| 276 | 3300014326 | Ga0157380_10242903 | Ga0157380_102429033 | 160 |
| 277 | 3300014745 | Ga0157377_10030046 | Ga0157377_100300463 | 160 |
| 278 | 3300014745 | Ga0157377_10055129 | Ga0157377_100551294 | 160 |
| 279 | 3300014968 | Ga0157379_10063954 | Ga0157379_100639543 | 160 |
| 280 | 3300014968 | Ga0157379_10745607 | Ga0157379_107456072 | 160 |
| 281 | 3300014969 | Ga0157376_10284678 | Ga0157376_102846781 | 160 |
| 282 | 3300014969 | Ga0157376_10462285 | Ga0157376_104622853 | 160 |
| 283 | 3300025903 | Ga0207680_10361278 | Ga0207680_103612782 | 160 |
| 284 | 3300025903 | Ga0207680_10468029 | Ga0207680_104680292 | 160 |
| 285 | 3300025906 | Ga0207699_10252557 | Ga0207699_102525571 | 160 |
| 286 | 3300025907 | Ga0207645_10129073 | Ga0207645_101290733 | 160 |
| 287 | 3300025908 | Ga0207643_10021930 | Ga0207643_100219303 | 160 |
| 288 | 3300025908 | Ga0207643_10818658 | Ga0207643_108186582 | 160 |
| 289 | 3300025911 | Ga0207654_10007936 | Ga0207654_100079364 | 160 |
| 290 | 3300025914 | Ga0207671_10046960 | Ga0207671_100469602 | 160 |
| 291 | 3300025917 | Ga0207660_10265018 | Ga0207660_102650182 | 160 |
| 292 | 3300025918 | Ga0207662_10015989 | Ga0207662_100159894 | 160 |
| 293 | 3300025918 | Ga0207662_10145980 | Ga0207662_101459802 | 160 |
| 294 | 3300025920 | Ga0207649_10011382 | Ga0207649_100113825 | 160 |
| 295 | 3300025921 | Ga0207652_10815989 | Ga0207652_108159892 | 160 |
| 296 | 3300025922 | Ga0207646_10678010 | Ga0207646_106780102 | 160 |
| 297 | 3300025923 | Ga0207681_10006926 | Ga0207681_100069265 | 160 |
| 298 | 3300025923 | Ga0207681_10170655 | Ga0207681_101706553 | 160 |
| 299 | 3300025923 | Ga0207681_10205691 | Ga0207681_102056912 | 160 |
| 300 | 3300025925 | Ga0207650_10035621 | Ga0207650_100356212 | 160 |
| 301 | 3300025925 | Ga0207650_10071451 | Ga0207650_100714512 | 160 |
| 302 | 3300025925 | Ga0207650_10122474 | Ga0207650_101224742 | 160 |
| 303 | 3300025925 | Ga0207650_10130150 | Ga0207650_101301503 | 160 |
| 304 | 3300025925 | Ga0207650_10314577 | Ga0207650_103145772 | 160 |
| 305 | 3300025925 | Ga0207650_10892687 | Ga0207650_108926872 | 160 |
| 306 | 3300025926 | Ga0207659_10000770 | Ga0207659_100007706 | 160 |
| 307 | 3300025926 | Ga0207659_10002736 | Ga0207659_100027364 | 160 |
| 308 | 3300025926 | Ga0207659_10012559 | Ga0207659_100125593 | 160 |
| 309 | 3300025926 | Ga0207659_10031252 | Ga0207659_100312525 | 160 |
| 310 | 3300025926 | Ga0207659_10316852 | Ga0207659_103168522 | 160 |
| 311 | 3300025926 | Ga0207659_11180668 | Ga0207659_111806682 | 160 |
| 312 | 3300025933 | Ga0207706_10025310 | Ga0207706_100253103 | 160 |
| 313 | 3300025933 | Ga0207706_10142367 | Ga0207706_101423673 | 160 |
| 314 | 3300025933 | Ga0207706_10350575 | Ga0207706_103505751 | 160 |
| 315 | 3300025935 | Ga0207709_10159481 | Ga0207709_101594812 | 160 |
| 316 | 3300025936 | Ga0207670_10010541 | Ga0207670_100105415 | 160 |
| 317 | 3300025936 | Ga0207670_10060926 | Ga0207670_100609263 | 160 |
| 318 | 3300025936 | Ga0207670_10098152 | Ga0207670_100981523 | 160 |
| 319 | 3300025936 | Ga0207670_10357511 | Ga0207670_103575112 | 160 |
| 320 | 3300025936 | Ga0207670_10564760 | Ga0207670_105647601 | 160 |
| 321 | 3300025936 | Ga0207670_10684772 | Ga0207670_106847721 | 160 |
| 322 | 3300025940 | Ga0207691_10027473 | Ga0207691_100274736 | 160 |
| 323 | 3300025940 | Ga0207691_10134701 | Ga0207691_101347013 | 160 |
| 324 | 3300025941 | Ga0207711_10064517 | Ga0207711_100645173 | 160 |
| 325 | 3300025941 | Ga0207711_10118958 | Ga0207711_101189582 | 160 |
| 326 | 3300025942 | Ga0207689_10485344 | Ga0207689_104853442 | 160 |
| 327 | 3300025945 | Ga0207679_10006534 | Ga0207679_100065342 | 160 |
| 328 | 3300025945 | Ga0207679_10177531 | Ga0207679_101775312 | 160 |
| 329 | 3300025945 | Ga0207679_10497131 | Ga0207679_104971312 | 160 |
| 330 | 3300025945 | Ga0207679_11308111 | Ga0207679_113081111 | 160 |
| 331 | 3300025949 | Ga0207667_10739093 | Ga0207667_107390932 | 160 |
| 332 | 3300025949 | Ga0207667_11117062 | Ga0207667_111170622 | 160 |
| 333 | 3300025960 | Ga0207651_10063719 | Ga0207651_100637195 | 160 |
| 334 | 3300025960 | Ga0207651_10066444 | Ga0207651_100664443 | 160 |
| 335 | 3300025960 | Ga0207651_10181689 | Ga0207651_101816892 | 160 |
| 336 | 3300025960 | Ga0207651_10223885 | Ga0207651_102238853 | 160 |
| 337 | 3300025960 | Ga0207651_10347290 | Ga0207651_103472901 | 160 |
| 338 | 3300025960 | Ga0207651_10684851 | Ga0207651_106848511 | 160 |
| 339 | 3300025960 | Ga0207651_10874895 | Ga0207651_108748952 | 160 |
| 340 | 3300025961 | Ga0207712_10004314 | Ga0207712_100043146 | 160 |
| 341 | 3300025981 | Ga0207640_10343865 | Ga0207640_103438652 | 160 |
| 342 | 3300025986 | Ga0207658_10129666 | Ga0207658_101296664 | 160 |
| 343 | 3300026023 | Ga0207677_10403326 | Ga0207677_104033262 | 160 |
| 344 | 3300026035 | Ga0207703_10019674 | Ga0207703_100196744 | 160 |
| 345 | 3300026035 | Ga0207703_10074719 | Ga0207703_100747191 | 160 |
| 346 | 3300026035 | Ga0207703_10090141 | Ga0207703_100901413 | 160 |
| 347 | 3300026035 | Ga0207703_10181006 | Ga0207703_101810062 | 160 |
| 348 | 3300026035 | Ga0207703_10603746 | Ga0207703_106037462 | 160 |
| 349 | 3300026067 | Ga0207678_10641558 | Ga0207678_106415582 | 160 |
| 350 | 3300026075 | Ga0207708_10012999 | Ga0207708_100129994 | 160 |
| 351 | 3300026075 | Ga0207708_10964025 | Ga0207708_109640251 | 160 |
| 352 | 3300026078 | Ga0207702_10060059 | Ga0207702_100600594 | 160 |
| 353 | 3300026088 | Ga0207641_10005559 | Ga0207641_100055595 | 160 |
| 354 | 3300026088 | Ga0207641_10256554 | Ga0207641_102565543 | 160 |
| 355 | 3300026088 | Ga0207641_10983816 | Ga0207641_109838162 | 160 |
| 356 | 3300026089 | Ga0207648_10000835 | Ga0207648_1000083529 | 160 |
| 357 | 3300026095 | Ga0207676_10005398 | Ga0207676_100053982 | 160 |
| 358 | 3300026095 | Ga0207676_10067593 | Ga0207676_100675934 | 160 |
| 359 | 3300026095 | Ga0207676_10234101 | Ga0207676_102341013 | 160 |
| 360 | 3300026095 | Ga0207676_11333095 | Ga0207676_113330951 | 160 |
| 361 | 3300026116 | Ga0207674_10008418 | Ga0207674_100084185 | 160 |
| 362 | 3300026116 | Ga0207674_10051361 | Ga0207674_100513613 | 160 |
| 363 | 3300026116 | Ga0207674_10074590 | Ga0207674_100745902 | 160 |
| 364 | 3300026116 | Ga0207674_10190424 | Ga0207674_101904243 | 160 |
| 365 | 3300026118 | Ga0207675_100001637 | Ga0207675_10000163714 | 160 |
| 366 | 3300026118 | Ga0207675_100308191 | Ga0207675_1003081913 | 160 |
| 367 | 3300026121 | Ga0207683_10196133 | Ga0207683_101961332 | 160 |
| 368 | 3300026121 | Ga0207683_10250202 | Ga0207683_102502022 | 160 |
| 369 | 3300026121 | Ga0207683_10557739 | Ga0207683_105577392 | 160 |
| 370 | 3300026121 | Ga0207683_10692983 | Ga0207683_106929832 | 160 |
| 371 | 3300026142 | Ga0207698_11263048 | Ga0207698_112630482 | 160 |
| 372 | 3300027695 | Ga0209966_1029147 | Ga0209966_10291472 | 160 |
| 373 | 3300027907 | Ga0207428_10007529 | Ga0207428_100075296 | 160 |
| 374 | 3300027907 | Ga0207428_10017908 | Ga0207428_100179082 | 160 |
| 375 | 3300027907 | Ga0207428_10434271 | Ga0207428_104342712 | 160 |
| 376 | 3300027907 | Ga0207428_10438167 | Ga0207428_104381672 | 160 |
| 377 | 3300028379 | Ga0268266_10702925 | Ga0268266_107029252 | 160 |
| 378 | 3300028380 | Ga0268265_10001817 | Ga0268265_100018176 | 160 |
| 379 | 3300028380 | Ga0268265_10150559 | Ga0268265_101505592 | 160 |
| 380 | 3300028380 | Ga0268265_11326346 | Ga0268265_113263462 | 160 |
| 381 | 3300028381 | Ga0268264_10013880 | Ga0268264_100138804 | 160 |
| 382 | 3300028381 | Ga0268264_10797462 | Ga0268264_107974622 | 160 |
| 383 | 3300032002 | Ga0307416_100480102 | Ga0307416_1004801022 | 160 |
| 384 | 3300032126 | Ga0307415_100820644 | Ga0307415_1008206441 | 160 |
| 385 | 3300034819 | Ga0373958_0103095 | Ga0373958_0103095_176_658 | 160 |
| 386 | 3300035114 | Ga0373939_0034695 | Ga0373939_0034695_249_731 | 160 |
| 387 | 3300035114 | Ga0373939_0037632 | Ga0373939_0037632_436_918 | 160 |
| 388 | 3300035115 | Ga0373941_0121447 | Ga0373941_0121447_436_918 | 160 |
| 389 | 3300035207 | Ga0373942_0115007 | Ga0373942_0115007_57_539 | 160 |
| 390 | 3300035241 | Ga0373961_0107574 | Ga0373961_0107574_396_878 | 160 |
| 391 | 3300035242 | Ga0373962_0266805 | Ga0373962_0266805_43_525 | 160 |
| 392 | 3300035691 | Ga0373931_0471889 | Ga0373931_0471889_268_750 | 160 |
| 393 | 3300035691 | Ga0373931_1115098 | Ga0373931_1115098_25_507 | 160 |
| 394 | 3300035692 | Ga0373935_0828832 | Ga0373935_0828832_161_643 | 160 |
| 395 | 3300035695 | Ga0373927_0054818 | Ga0373927_0054818_1328_1810 | 160 |
| 396 | 3300037068 | Ga0373925_0866208 | Ga0373925_0866208_29_511 | 160 |
| 397 | 3300041408 | Ga0439453_0009502 | Ga0439453_0009502_1085_1567 | 160 |
| 398 | 3300042134 | Ga0450898_107680 | Ga0450898_107680_71_553 | 160 |
| 399 | 3300042436 | Ga0439435_0037185 | Ga0439435_0037185_134_616 | 160 |
| 400 | 3300042876 | Ga0451577_0226523 | Ga0451577_0226523_365_850 | 160 |
| 401 | 3300042876 | Ga0451577_0619416 | Ga0451577_0619416_89_571 | 160 |
| 402 | 3300044673 | Ga0453683_0351423 | Ga0453683_0351423_312_800 | 160 |
| 403 | 3300045051 | Ga0451576_0044829 | Ga0451576_0044829_958_1443 | 160 |
| 404 | 3300045051 | Ga0451576_0070771 | Ga0451576_0070771_1097_1585 | 160 |
| 405 | 3300045051 | Ga0451576_0146163 | Ga0451576_0146163_1660_2142 | 160 |
| 406 | 3300045051 | Ga0451576_0295705 | Ga0451576_0295705_436_924 | 160 |
| 407 | 3300045051 | Ga0451576_0933430 | Ga0451576_0933430_165_647 | 160 |
| 408 | 3300045051 | Ga0451576_1659755 | Ga0451576_1659755_26_508 | 160 |
| 409 | 3300046472 | Ga0495580_0143259 | Ga0495580_0143259_427_909 | 160 |
| 410 | 3300046472 | Ga0495580_0156359 | Ga0495580_0156359_251_733 | 160 |
| 411 | 3300046472 | Ga0495580_0238096 | Ga0495580_0238096_686_1168 | 160 |
| 412 | 3300046473 | Ga0495582_0126677 | Ga0495582_0126677_178_660 | 160 |
| 413 | 3300046473 | Ga0495582_0312448 | Ga0495582_0312448_129_614 | 160 |
| 414 | 3300046491 | Ga0495584_0311074 | Ga0495584_0311074_191_673 | 160 |
| 415 | 3300046491 | Ga0495584_0325433 | Ga0495584_0325433_260_742 | 160 |
| 416 | 3300046499 | Ga0495594_0006593 | Ga0495594_0006593_803_1285 | 160 |
| 417 | 3300046499 | Ga0495594_0534863 | Ga0495594_0534863_75_557 | 160 |
| 418 | 3300046517 | Ga0495630_0787489 | Ga0495630_0787489_93_578 | 160 |
| 419 | 3300046525 | Ga0495663_0018268 | Ga0495663_0018268_109_597 | 160 |
| 420 | 3300046526 | Ga0495666_0240945 | Ga0495666_0240945_72_554 | 160 |
| 421 | 3300046537 | Ga0495598_0104831 | Ga0495598_0104831_381_863 | 160 |
| 422 | 3300046539 | Ga0495621_0003475 | Ga0495621_0003475_2569_3057 | 160 |
| 423 | 3300046539 | Ga0495621_0161414 | Ga0495621_0161414_264_746 | 160 |
| 424 | 3300046558 | Ga0495633_0180091 | Ga0495633_0180091_65_547 | 160 |
| 425 | 3300046616 | Ga0495668_0257533 | Ga0495668_0257533_148_636 | 160 |
| 426 | 3300046663 | Ga0495635_0025402 | Ga0495635_0025402_270_797 | 160 |
| 427 | 3300046664 | Ga0495659_0014502 | Ga0495659_0014502_348_830 | 160 |
| 428 | 3300046664 | Ga0495659_0110240 | Ga0495659_0110240_86_568 | 160 |
| 429 | 3300046664 | Ga0495659_0172628 | Ga0495659_0172628_36_518 | 160 |
| 430 | 3300046683 | Ga0495658_0115588 | Ga0495658_0115588_1016_1501 | 160 |
| 431 | 3300046684 | Ga0495669_0010253 | Ga0495669_0010253_2535_3017 | 160 |
| 432 | 3300046689 | Ga0495613_0008197 | Ga0495613_0008197_1876_2358 | 160 |
| 433 | 3300047315 | Ga0495581_0300358 | Ga0495581_0300358_23_505 | 160 |
| 434 | 3300047318 | Ga0495636_0046342 | Ga0495636_0046342_301_783 | 160 |
| 435 | 3300047318 | Ga0495636_0126588 | Ga0495636_0126588_56_538 | 160 |
| 436 | 3300047471 | Ga0495684_0316687 | Ga0495684_0316687_241_726 | 160 |
| 437 | 3300048089 | Ga0495614_0141589 | Ga0495614_0141589_395_877 | 160 |
| 438 | 3300048090 | Ga0495615_0003580 | Ga0495615_0003580_2111_2599 | 160 |
| 439 | 3300048903 | Ga0496100_1208252 | Ga0496100_1208252_34_516 | 160 |
| 440 | 3300048904 | Ga0496101_0337195 | Ga0496101_0337195_528_1010 | 160 |
| 441 | 3300048905 | Ga0496102_0780644 | Ga0496102_0780644_267_749 | 160 |
| 442 | 3300048907 | Ga0496104_0070351 | Ga0496104_0070351_688_1170 | 160 |
| 443 | 3300048908 | Ga0496105_0018911 | Ga0496105_0018911_1009_1491 | 160 |
| 444 | 3300048908 | Ga0496105_0535813 | Ga0496105_0535813_297_779 | 160 |
| 445 | 3300048909 | Ga0496106_0124214 | Ga0496106_0124214_1179_1661 | 160 |
| 446 | 3300048909 | Ga0496106_0260457 | Ga0496106_0260457_456_938 | 160 |
| 447 | 3300048909 | Ga0496106_0827424 | Ga0496106_0827424_19_501 | 160 |
| 448 | 3300048910 | Ga0496107_0740275 | Ga0496107_0740275_10_492 | 160 |
| 449 | 3300048911 | Ga0496108_0010091 | Ga0496108_0010091_850_1332 | 160 |
| 450 | 3300048911 | Ga0496108_0423589 | Ga0496108_0423589_16_498 | 160 |
| 451 | 3300048911 | Ga0496108_0790263 | Ga0496108_0790263_305_787 | 160 |
| 452 | 3300048912 | Ga0496109_0001912 | Ga0496109_0001912_5225_5707 | 160 |
| 453 | 3300048912 | Ga0496109_0280632 | Ga0496109_0280632_500_982 | 160 |
| 454 | 3300048912 | Ga0496109_1485880 | Ga0496109_1485880_19_501 | 160 |
| 455 | 3300048913 | Ga0496110_0001931 | Ga0496110_0001931_8821_9303 | 160 |
| 456 | 3300048913 | Ga0496110_0049047 | Ga0496110_0049047_1583_2065 | 160 |
| 457 | 3300048914 | Ga0496111_0006720 | Ga0496111_0006720_5119_5601 | 160 |
| 458 | 3300048914 | Ga0496111_0335506 | Ga0496111_0335506_46_528 | 160 |
| 459 | 3300048915 | Ga0496112_0001225 | Ga0496112_0001225_18540_19022 | 160 |
| 460 | 3300048915 | Ga0496112_1417732 | Ga0496112_1417732_22_504 | 160 |
| 461 | 3300048916 | Ga0496113_0474947 | Ga0496113_0474947_79_561 | 160 |
| 462 | 3300048917 | Ga0496114_1211674 | Ga0496114_1211674_113_595 | 160 |
| 463 | 3300048918 | Ga0496115_0102871 | Ga0496115_0102871_1076_1558 | 160 |
| 464 | 3300049576 | Ga0501040_0097927 | Ga0501040_0097927_676_1179 | 160 |
| 465 | 3300049577 | Ga0501041_0285976 | Ga0501041_0285976_63_554 | 160 |
| 466 | 3300049580 | Ga0501046_0655589 | Ga0501046_0655589_68_604 | 160 |
| 467 | 3300049587 | Ga0501071_0221702 | Ga0501071_0221702_426_962 | 160 |
| 468 | 3300049588 | Ga0501072_0167572 | Ga0501072_0167572_443_946 | 160 |
| 469 | 3300049588 | Ga0501072_0180189 | Ga0501072_0180189_24_509 | 160 |
| 470 | 3300049592 | Ga0501076_0940321 | Ga0501076_0940321_118_654 | 160 |
| 471 | 3300049661 | Ga0501217_148994 | Ga0501217_148994_139_621 | 160 |
| 472 | 3300049666 | Ga0501228_013915 | Ga0501228_013915_125_607 | 160 |
| 473 | 3300049679 | Ga0501249_047856 | Ga0501249_047856_165_647 | 160 |
| 474 | 3300049684 | Ga0501255_013500 | Ga0501255_013500_118_600 | 160 |
| 475 | 3300049685 | Ga0501256_010495 | Ga0501256_010495_333_815 | 160 |
| 476 | 3300049743 | Ga0501081_0092720 | Ga0501081_0092720_708_1199 | 160 |
| 477 | 3300049743 | Ga0501081_0518242 | Ga0501081_0518242_46_582 | 160 |
| 478 | 3300049762 | Ga0501265_056374 | Ga0501265_056374_107_589 | 160 |
| 479 | 3300049768 | Ga0501271_033103 | Ga0501271_033103_19_501 | 160 |
| 480 | 3300049773 | Ga0501276_007796 | Ga0501276_007796_102_584 | 160 |
| 481 | 3300049824 | Ga0501045_0796043 | Ga0501045_0796043_130_621 | 160 |
| 482 | 3300050496 | nmdc:mga07m45_652593_c1 | nmdc:mga07m45_652593_c1_13_504 | 160 |
| 483 | 3300050507 | nmdc:mga05p37_1845264_c1 | nmdc:mga05p37_1845264_c1_81_569 | 160 |
| 484 | 3300050507 | nmdc:mga05p37_48_c1 | nmdc:mga05p37_48_c1_62026_62508 | 160 |
| 485 | 3300050507 | nmdc:mga05p37_578625_c1 | nmdc:mga05p37_578625_c1_411_893 | 160 |
| 486 | 3300050508 | nmdc:mga09592_312380_c1 | nmdc:mga09592_312380_c1_280_762 | 160 |
| 487 | 3300050508 | nmdc:mga09592_335156_c1 | nmdc:mga09592_335156_c1_749_1231 | 160 |
| 488 | 3300050508 | nmdc:mga09592_649796_c1 | nmdc:mga09592_649796_c1_193_675 | 160 |
| 489 | 3300050510 | nmdc:mga06r32_317197_c1 | nmdc:mga06r32_317197_c1_502_984 | 160 |
| 490 | 3300050510 | nmdc:mga06r32_660488_c1 | nmdc:mga06r32_660488_c1_39_521 | 160 |
| 491 | 3300050511 | nmdc:mga08y16_14177_c1 | nmdc:mga08y16_14177_c1_331_813 | 160 |
| 492 | 3300050511 | nmdc:mga08y16_41946_c1 | nmdc:mga08y16_41946_c1_2920_3411 | 160 |
| 493 | 3300050511 | nmdc:mga08y16_447573_c1 | nmdc:mga08y16_447573_c1_822_1304 | 160 |
| 494 | 3300050511 | nmdc:mga08y16_509981_c1 | nmdc:mga08y16_509981_c1_400_882 | 160 |
| 495 | 3300050511 | nmdc:mga08y16_815807_c1 | nmdc:mga08y16_815807_c1_238_720 | 160 |
| 496 | 3300050511 | nmdc:mga08y16_825751_c1 | nmdc:mga08y16_825751_c1_405_893 | 160 |
| 497 | 3300050511 | nmdc:mga08y16_9646_c1 | nmdc:mga08y16_9646_c1_6773_7255 | 160 |
| 498 | 3300050512 | nmdc:mga0n895_342004_c1 | nmdc:mga0n895_342004_c1_277_759 | 160 |
| 499 | 3300050512 | nmdc:mga0n895_5270_c1 | nmdc:mga0n895_5270_c1_286_768 | 160 |
| 500 | 3300050512 | nmdc:mga0n895_581688_c1 | nmdc:mga0n895_581688_c1_480_962 | 160 |
| 501 | 3300050512 | nmdc:mga0n895_758334_c1 | nmdc:mga0n895_758334_c1_437_922 | 160 |
| 502 | 3300050513 | nmdc:mga0rr50_17008_c1 | nmdc:mga0rr50_17008_c1_1590_2075 | 160 |
| 503 | 3300050515 | nmdc:mga0a205_24686_c1 | nmdc:mga0a205_24686_c1_2553_3038 | 160 |
| 504 | 3300050515 | nmdc:mga0a205_270454_c1 | nmdc:mga0a205_270454_c1_409_906 | 160 |
| 505 | 3300053077 | Ga0495601_0035163 | Ga0495601_0035163_1696_2178 | 160 |
| 506 | 3300053085 | Ga0495619_0472777 | Ga0495619_0472777_368_850 | 160 |
| 507 | 3300059421 | Ga0590071_000079 | Ga0590071_000079_23898_24380 | 160 |
| 508 | 3300059423 | Ga0590074_000280 | Ga0590074_000280_4015_4497 | 160 |
| 509 | 3300059424 | Ga0590075_000048 | Ga0590075_000048_24507_24989 | 160 |
| 510 | 3300059426 | Ga0590077_000030 | Ga0590077_000030_22344_22826 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y81-assembly1.cif.gz_A | conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus | 0.9052 | 17 | 128 |
| 3q9n-assembly2.cif.gz_B | in silico and in vitro co-evolution of a high affinity complementary protein-protein interface | 0.8951 | 1 | 117 |
| 3q9n-assembly1.cif.gz_A | in silico and in vitro co-evolution of a high affinity complementary protein-protein interface | 0.8926 | 1 | 130 |
| 3q9u-assembly2.cif.gz_B | in silico and in vitro co-evolution of a high affinity complementary protein-protein interface | 0.8857 | 2 | 104 |
| 2d5a-assembly1.cif.gz_A | hypothetical protein from pyrococcus horikoshii ot3 | 0.8629 | 1 | 135 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1y81A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9052 | 17 | 128 | 3.40.50.720 |
| 3q9nB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8951 | 1 | 117 | 3.40.50.720 |
| 1iulA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8562 | 5 | 133 | 3.40.50.720 |
| 3ff4A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8374 | 17 | 142 | 3.40.50.720 |
| 1y81A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.8248 | 17 | 128 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4HC14-F1-model_v4 | CoA-binding protein | 0.9622 | 4 | 156 |
|
| AF-A0A849M667-F1-model_v4 | CoA-binding protein | 0.9605 | 7 | 156 |
|
| AF-A0A660TNN4-F1-model_v4 | CoA-binding protein | 0.9587 | 6 | 138 |
|
| AF-A0A6H9L9M6-F1-model_v4 | CoA-binding protein | 0.9546 | 1 | 160 |
|
| AF-A0A1G0PHE0-F1-model_v4 | CoA-binding domain-containing protein | 0.9533 | 3 | 160 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar