F457037
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 509 | 178 | 502 | 382 |
Family's Representative Sequence
| Representative Sequence | 3300046557|Ga0495622_0000155|Ga0495622_0000155_15809_17059 |
| Length | 416 |
| Sequence | MAEPSTQRTASMTLSKRIADLKPLATTAMHGRVEAMHARGEPVIDFSIAISHFPAPAAVLDAVRLGLEQPTLPYTAVPGALAVRQRLATKVRNENGIDAGADDILVTNGAKQALYQALFALADPGDAVIIFKPHWPAYVATCRVLGLKPVLVDLPPRFSAAFLDNLPPARILILNNPHNPTGAVLAADEIGHIAAWLARSGTRAIVDESYEKLIFDGSHVSLAARCEWRGAGVVTIFSCSQSYAMMGWRAGFAVASADLVAAMETLQGPITAAAPALTQLALDAAFASGEPRALVEDYRMRRDLVLAMTAQVPWLRMACPASGPYLWADISALTMDGVDFSERLLATSAVAVMPGEALGVPGHIRIGYICDDVATLRRGVDAIIRFGDAWQRAPATAAAGGRAGGHVAASPAEATF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 2 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 3 | 2821131069 | Duganella sp. 1224 | Isolate | Unclassified |
| 4 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 5 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 6 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 10 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 13 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 19 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 22 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 23 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 24 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 29 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 30 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 31 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 32 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 33 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 34 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 35 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 38 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 40 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 53 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 54 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 55 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 56 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 57 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 58 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 59 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 60 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 61 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 62 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 63 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 64 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 65 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 66 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 67 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 68 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 69 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 70 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 71 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 72 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 73 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 74 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 75 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 76 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 77 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 78 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 79 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 80 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 81 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 82 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 151 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 152 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 153 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 154 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 155 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 156 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 159 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 160 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 161 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 162 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 163 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 164 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 165 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 166 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 167 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 168 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 172 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 175 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 176 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 177 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 178 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.23 |
| Metatranscriptomes | 0.39 |
| Isolates | 1.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.14 |
| Nodule | 0.79 |
| Rhizoplane | 4.52 |
| Rhizosphere | 88.02 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10004116 | 3300003322 | Bacteria | 9095 |
| 2 | rootL2_10005136 | 3300003322 | Bacteria | 3835 |
| 3 | rootL2_10005137 | 3300003322 | Bacteria | 4090 |
| 4 | rootL2_10141073 | 3300003322 | Bacteria | 2771 |
| 5 | Ga0007409J51694_1007381 | 3300003575 | Bacteria | 2057 |
| 6 | Ga0055525_1000001 | 3300003759 | Bacteria | 1016948 |
| 7 | Ga0055529_1000515 | 3300003763 | Bacteria | 33927 |
| 8 | Ga0055526_1000023 | 3300003771 | Bacteria | 163444 |
| 9 | Ga0055524_1000008 | 3300003775 | Bacteria | 297761 |
| 10 | Ga0065165_1000515 | 3300005262 | Bacteria | 59374 |
| 11 | Ga0070658_10059124 | 3300005327 | Bacteria | 3121 |
| 12 | Ga0070658_10082666 | 3300005327 | Bacteria | 2639 |
| 13 | Ga0070660_100150125 | 3300005339 | Bacteria | 1873 |
| 14 | Ga0070661_100042283 | 3300005344 | Bacteria | 3326 |
| 15 | Ga0070659_100015104 | 3300005366 | Bacteria | 5776 |
| 16 | Ga0070659_100132558 | 3300005366 | Bacteria | 2025 |
| 17 | Ga0068855_100043778 | 3300005563 | Bacteria | 5300 |
| 18 | Ga0068855_100318833 | 3300005563 | Bacteria | 1718 |
| 19 | Ga0070664_100089318 | 3300005564 | Bacteria | 2666 |
| 20 | Ga0097621_100160574 | 3300006237 | Bacteria | 1932 |
| 21 | Ga0068865_100120341 | 3300006881 | Bacteria | 1951 |
| 22 | Ga0079104_1003520 | 3300006946 | Bacteria | 7213 |
| 23 | Ga0099826_10000001 | 3300006948 | Bacteria | 1155201 |
| 24 | Ga0105244_10012633 | 3300009036 | Bacteria | 4979 |
| 25 | Ga0105243_10022079 | 3300009148 | Bacteria | 4835 |
| 26 | Ga0105241_10040325 | 3300009174 | Bacteria | 3525 |
| 27 | Ga0157372_10432848 | 3300013307 | Bacteria | 1533 |
| 28 | Ga0182006_1000008 | 3300015261 | Bacteria | 449652 |
| 29 | Ga0182005_1000008 | 3300015265 | Bacteria | 471394 |
| 30 | Ga0213872_10000087 | 3300021361 | Bacteria | 84858 |
| 31 | Ga0213872_10000157 | 3300021361 | Bacteria | 62892 |
| 32 | Ga0213872_10000518 | 3300021361 | Bacteria | 30402 |
| 33 | Ga0213872_10013864 | 3300021361 | Bacteria | 3767 |
| 34 | Ga0213872_10041879 | 3300021361 | Bacteria | 2089 |
| 35 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 36 | Ga0207425_1000464 | 3300025245 | Bacteria | 25952 |
| 37 | Ga0209646_1000049 | 3300025246 | Bacteria | 301924 |
| 38 | Ga0209148_1001036 | 3300025254 | Bacteria | 17336 |
| 39 | Ga0209455_1000026 | 3300025272 | Bacteria | 653778 |
| 40 | Ga0209025_1002606 | 3300025294 | Bacteria | 18585 |
| 41 | Ga0209564_1000002 | 3300025295 | Bacteria | 1636803 |
| 42 | Ga0209564_1016008 | 3300025295 | Bacteria | 3016 |
| 43 | Ga0209758_1001071 | 3300025297 | Bacteria | 35617 |
| 44 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 45 | Ga0207705_10004043 | 3300025909 | Bacteria | 11151 |
| 46 | Ga0207705_10093682 | 3300025909 | Bacteria | 2202 |
| 47 | Ga0207654_10005595 | 3300025911 | Bacteria | 6356 |
| 48 | Ga0207657_10004452 | 3300025919 | Bacteria | 14820 |
| 49 | Ga0207657_10107214 | 3300025919 | Bacteria | 2311 |
| 50 | Ga0207687_10020985 | 3300025927 | Bacteria | 4336 |
| 51 | Ga0207690_10025996 | 3300025932 | Bacteria | 3684 |
| 52 | Ga0207690_10154725 | 3300025932 | Bacteria | 1703 |
| 53 | Ga0207706_10187893 | 3300025933 | Bacteria | 1814 |
| 54 | Ga0207706_10188792 | 3300025933 | Bacteria | 1809 |
| 55 | Ga0207686_10003111 | 3300025934 | Bacteria | 8933 |
| 56 | Ga0207709_10030286 | 3300025935 | Bacteria | 3147 |
| 57 | Ga0207704_10089829 | 3300025938 | Bacteria | 2014 |
| 58 | Ga0207679_10126530 | 3300025945 | Bacteria | 2043 |
| 59 | Ga0207667_10007077 | 3300025949 | Bacteria | 13550 |
| 60 | Ga0207698_10064417 | 3300026142 | Bacteria | 2873 |
| 61 | Ga0209281_1002837 | 3300027111 | Bacteria | 6346 |
| 62 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 63 | Ga0395899_0000127 | 3300037312 | Bacteria | 119435 |
| 64 | Ga0395899_0002391 | 3300037312 | Bacteria | 15241 |
| 65 | Ga0395899_0069941 | 3300037312 | Bacteria | 2569 |
| 66 | Ga0395899_0082771 | 3300037312 | Bacteria | 2334 |
| 67 | Ga0395899_0108705 | 3300037312 | Bacteria | 1995 |
| 68 | Ga0395900_0000489 | 3300037418 | Bacteria | 56052 |
| 69 | Ga0395900_0057172 | 3300037418 | Bacteria | 4015 |
| 70 | Ga0395900_0094071 | 3300037418 | Bacteria | 3078 |
| 71 | Ga0395900_0127411 | 3300037418 | Bacteria | 2610 |
| 72 | Ga0395900_0459905 | 3300037418 | Bacteria | 1227 |
| 73 | Ga0395898_0072917 | 3300037466 | Bacteria | 3316 |
| 74 | Ga0395898_0186468 | 3300037466 | Bacteria | 1982 |
| 75 | Ga0395905_0033711 | 3300037471 | Bacteria | 4809 |
| 76 | Ga0395905_0084134 | 3300037471 | Bacteria | 2980 |
| 77 | Ga0395905_0136531 | 3300037471 | Bacteria | 2307 |
| 78 | Ga0395905_0137329 | 3300037471 | Bacteria | 2300 |
| 79 | Ga0395905_0200800 | 3300037471 | Bacteria | 1869 |
| 80 | Ga0395905_0235545 | 3300037471 | Bacteria | 1711 |
| 81 | Ga0395901_0000033 | 3300038443 | Bacteria | 232357 |
| 82 | Ga0395901_0005206 | 3300038443 | Bacteria | 13126 |
| 83 | Ga0395901_0286162 | 3300038443 | Bacteria | 1711 |
| 84 | Ga0395901_0378412 | 3300038443 | Bacteria | 1457 |
| 85 | Ga0436361_0006435 | 3300039447 | Bacteria | 21805 |
| 86 | Ga0436361_0052289 | 3300039447 | Bacteria | 11756 |
| 87 | Ga0436361_0595316 | 3300039447 | Bacteria | 75842 |
| 88 | Ga0436361_0998063 | 3300039447 | Bacteria | 37334 |
| 89 | Ga0436361_1217285 | 3300039447 | Bacteria | 9496 |
| 90 | Ga0439448_0002394 | 3300042005 | Bacteria | 5089 |
| 91 | Ga0439448_0026739 | 3300042005 | Bacteria | 1815 |
| 92 | Ga0439450_002496 | 3300042008 | Bacteria | 2902 |
| 93 | Ga0439455_0003235 | 3300042012 | Bacteria | 3084 |
| 94 | Ga0439455_0013859 | 3300042012 | Bacteria | 1833 |
| 95 | Ga0450911_005624 | 3300042115 | Bacteria | 1926 |
| 96 | Ga0450904_000788 | 3300042139 | Bacteria | 5405 |
| 97 | Ga0439458_0009764 | 3300042157 | Bacteria | 2137 |
| 98 | Ga0466969_0062861 | 3300044656 | Bacteria | 1800 |
| 99 | Ga0466972_0004344 | 3300044658 | Bacteria | 7084 |
| 100 | Ga0466965_0002454 | 3300044683 | Bacteria | 7877 |
| 101 | Ga0466965_0004129 | 3300044683 | Bacteria | 6456 |
| 102 | Ga0466965_0007515 | 3300044683 | Bacteria | 5007 |
| 103 | Ga0466965_0026405 | 3300044683 | Bacteria | 2815 |
| 104 | Ga0466965_0029064 | 3300044683 | Bacteria | 2688 |
| 105 | Ga0466966_0032144 | 3300044684 | Bacteria | 3402 |
| 106 | Ga0466966_0055201 | 3300044684 | Bacteria | 2515 |
| 107 | Ga0466966_0110746 | 3300044684 | Bacteria | 1692 |
| 108 | Ga0466964_0000168 | 3300044706 | Bacteria | 17921 |
| 109 | Ga0466964_0021185 | 3300044706 | Bacteria | 2512 |
| 110 | Ga0466968_0008645 | 3300044735 | Bacteria | 3902 |
| 111 | Ga0466970_0142366 | 3300044765 | Bacteria | 1321 |
| 112 | Ga0466957_0000127 | 3300044842 | Bacteria | 32392 |
| 113 | Ga0466957_0017698 | 3300044842 | Bacteria | 4179 |
| 114 | Ga0466957_0031094 | 3300044842 | Bacteria | 3189 |
| 115 | Ga0466957_0045291 | 3300044842 | Bacteria | 2668 |
| 116 | Ga0466957_0085266 | 3300044842 | Bacteria | 1972 |
| 117 | Ga0466959_0008598 | 3300045049 | Bacteria | 7226 |
| 118 | Ga0466958_0077211 | 3300045836 | Bacteria | 2045 |
| 119 | Ga0466967_0024222 | 3300045976 | Bacteria | 4987 |
| 120 | Ga0466967_0032225 | 3300045976 | Bacteria | 4422 |
| 121 | Ga0466967_0106575 | 3300045976 | Bacteria | 2569 |
| 122 | Ga0495617_000391 | 3300046452 | Bacteria | 24263 |
| 123 | Ga0495627_000610 | 3300046453 | Bacteria | 28427 |
| 124 | Ga0495590_0000013 | 3300046457 | Bacteria | 271977 |
| 125 | Ga0495590_0000016 | 3300046457 | Bacteria | 225874 |
| 126 | Ga0495590_0001412 | 3300046457 | Bacteria | 10424 |
| 127 | Ga0495591_000093 | 3300046458 | Bacteria | 101289 |
| 128 | Ga0495629_0067568 | 3300046459 | Bacteria | 2494 |
| 129 | Ga0495638_0000057 | 3300046460 | Bacteria | 193690 |
| 130 | Ga0495638_0017591 | 3300046460 | Bacteria | 4763 |
| 131 | Ga0495638_0030938 | 3300046460 | Bacteria | 3442 |
| 132 | Ga0495638_0089124 | 3300046460 | Bacteria | 1861 |
| 133 | Ga0495653_0006122 | 3300046463 | Bacteria | 9863 |
| 134 | Ga0495653_0016217 | 3300046463 | Bacteria | 6069 |
| 135 | Ga0495653_0018344 | 3300046463 | Bacteria | 5684 |
| 136 | Ga0495650_0000317 | 3300046471 | Bacteria | 86483 |
| 137 | Ga0495650_0001087 | 3300046471 | Bacteria | 29856 |
| 138 | Ga0495650_0017993 | 3300046471 | Bacteria | 3526 |
| 139 | Ga0495582_0021534 | 3300046473 | Bacteria | 3528 |
| 140 | Ga0495582_0103306 | 3300046473 | Bacteria | 1597 |
| 141 | Ga0495605_0000035 | 3300046474 | Bacteria | 208069 |
| 142 | Ga0495605_0000332 | 3300046474 | Bacteria | 47384 |
| 143 | Ga0495605_0007848 | 3300046474 | Bacteria | 6046 |
| 144 | Ga0495605_0008895 | 3300046474 | Bacteria | 5662 |
| 145 | Ga0495605_0011465 | 3300046474 | Bacteria | 4937 |
| 146 | Ga0495639_0014849 | 3300046475 | Bacteria | 3375 |
| 147 | Ga0495584_0000021 | 3300046491 | Bacteria | 130377 |
| 148 | Ga0495584_0000032 | 3300046491 | Bacteria | 99595 |
| 149 | Ga0495584_0000159 | 3300046491 | Bacteria | 47242 |
| 150 | Ga0495584_0000245 | 3300046491 | Bacteria | 39368 |
| 151 | Ga0495584_0007256 | 3300046491 | Bacteria | 5784 |
| 152 | Ga0495584_0009673 | 3300046491 | Bacteria | 4961 |
| 153 | Ga0495585_0000005 | 3300046492 | Bacteria | 328103 |
| 154 | Ga0495585_0000049 | 3300046492 | Bacteria | 119546 |
| 155 | Ga0495585_0000162 | 3300046492 | Bacteria | 71606 |
| 156 | Ga0495585_0002689 | 3300046492 | Bacteria | 12466 |
| 157 | Ga0495585_0006101 | 3300046492 | Bacteria | 7528 |
| 158 | Ga0495585_0041734 | 3300046492 | Bacteria | 2572 |
| 159 | Ga0495585_0050474 | 3300046492 | Bacteria | 2308 |
| 160 | Ga0495585_0085435 | 3300046492 | Bacteria | 1705 |
| 161 | Ga0495585_0141332 | 3300046492 | Bacteria | 1260 |
| 162 | Ga0495594_0005201 | 3300046499 | Bacteria | 6687 |
| 163 | Ga0495594_0011793 | 3300046499 | Bacteria | 4544 |
| 164 | Ga0495596_0000013 | 3300046500 | Bacteria | 125228 |
| 165 | Ga0495596_0001380 | 3300046500 | Bacteria | 13935 |
| 166 | Ga0495596_0006046 | 3300046500 | Bacteria | 5642 |
| 167 | Ga0495596_0008801 | 3300046500 | Bacteria | 4469 |
| 168 | Ga0495596_0011993 | 3300046500 | Bacteria | 3720 |
| 169 | Ga0495596_0013885 | 3300046500 | Bacteria | 3402 |
| 170 | Ga0495596_0046988 | 3300046500 | Bacteria | 1694 |
| 171 | Ga0495596_0052114 | 3300046500 | Bacteria | 1602 |
| 172 | Ga0495607_0002124 | 3300046501 | Bacteria | 16544 |
| 173 | Ga0495607_0002706 | 3300046501 | Bacteria | 14144 |
| 174 | Ga0495607_0002930 | 3300046501 | Bacteria | 13432 |
| 175 | Ga0495607_0007123 | 3300046501 | Bacteria | 7774 |
| 176 | Ga0495607_0029967 | 3300046501 | Bacteria | 3345 |
| 177 | Ga0495607_0039934 | 3300046501 | Bacteria | 2798 |
| 178 | Ga0495607_0043022 | 3300046501 | Bacteria | 2674 |
| 179 | Ga0495607_0069351 | 3300046501 | Bacteria | 1973 |
| 180 | Ga0495607_0069657 | 3300046501 | Bacteria | 1968 |
| 181 | Ga0495583_0000060 | 3300046506 | Bacteria | 199091 |
| 182 | Ga0495583_0000178 | 3300046506 | Bacteria | 108556 |
| 183 | Ga0495583_0000388 | 3300046506 | Bacteria | 67604 |
| 184 | Ga0495583_0000480 | 3300046506 | Bacteria | 58370 |
| 185 | Ga0495583_0001054 | 3300046506 | Bacteria | 30925 |
| 186 | Ga0495583_0004800 | 3300046506 | Bacteria | 9478 |
| 187 | Ga0495583_0050961 | 3300046506 | Bacteria | 1889 |
| 188 | Ga0495583_0078273 | 3300046506 | Bacteria | 1440 |
| 189 | Ga0495606_0000058 | 3300046507 | Bacteria | 194187 |
| 190 | Ga0495606_0000066 | 3300046507 | Bacteria | 181028 |
| 191 | Ga0495606_0000573 | 3300046507 | Bacteria | 58366 |
| 192 | Ga0495606_0001333 | 3300046507 | Bacteria | 33638 |
| 193 | Ga0495606_0002184 | 3300046507 | Bacteria | 23486 |
| 194 | Ga0495606_0003168 | 3300046507 | Bacteria | 17788 |
| 195 | Ga0495606_0016553 | 3300046507 | Bacteria | 5615 |
| 196 | Ga0495606_0037010 | 3300046507 | Bacteria | 3317 |
| 197 | Ga0495606_0038256 | 3300046507 | Bacteria | 3248 |
| 198 | Ga0495606_0136911 | 3300046507 | Bacteria | 1449 |
| 199 | Ga0495610_0000326 | 3300046512 | Bacteria | 50713 |
| 200 | Ga0495610_0000411 | 3300046512 | Bacteria | 43910 |
| 201 | Ga0495610_0005343 | 3300046512 | Bacteria | 9165 |
| 202 | Ga0495610_0006951 | 3300046512 | Bacteria | 7657 |
| 203 | Ga0495610_0011075 | 3300046512 | Bacteria | 5539 |
| 204 | Ga0495616_0000148 | 3300046513 | Bacteria | 61405 |
| 205 | Ga0495616_0000445 | 3300046513 | Bacteria | 31542 |
| 206 | Ga0495616_0000736 | 3300046513 | Bacteria | 24068 |
| 207 | Ga0495616_0000881 | 3300046513 | Bacteria | 21790 |
| 208 | Ga0495616_0008503 | 3300046513 | Bacteria | 6071 |
| 209 | Ga0495616_0012583 | 3300046513 | Bacteria | 4796 |
| 210 | Ga0495616_0037698 | 3300046513 | Bacteria | 2485 |
| 211 | Ga0495620_0001714 | 3300046515 | Bacteria | 12947 |
| 212 | Ga0495631_0001299 | 3300046518 | Bacteria | 15314 |
| 213 | Ga0495631_0001448 | 3300046518 | Bacteria | 14400 |
| 214 | Ga0495631_0002938 | 3300046518 | Bacteria | 9439 |
| 215 | Ga0495631_0006058 | 3300046518 | Bacteria | 6281 |
| 216 | Ga0495631_0006317 | 3300046518 | Bacteria | 6131 |
| 217 | Ga0495631_0006733 | 3300046518 | Bacteria | 5898 |
| 218 | Ga0495631_0039858 | 3300046518 | Bacteria | 2082 |
| 219 | Ga0495632_0000029 | 3300046519 | Bacteria | 171022 |
| 220 | Ga0495632_0000034 | 3300046519 | Bacteria | 162850 |
| 221 | Ga0495632_0001315 | 3300046519 | Bacteria | 20983 |
| 222 | Ga0495632_0001378 | 3300046519 | Bacteria | 20371 |
| 223 | Ga0495632_0017538 | 3300046519 | Bacteria | 3948 |
| 224 | Ga0495632_0106131 | 3300046519 | Bacteria | 1321 |
| 225 | Ga0495637_0000008 | 3300046520 | Bacteria | 404658 |
| 226 | Ga0495637_0007939 | 3300046520 | Bacteria | 5229 |
| 227 | Ga0495637_0008045 | 3300046520 | Bacteria | 5192 |
| 228 | Ga0495643_0000236 | 3300046522 | Bacteria | 83225 |
| 229 | Ga0495643_0000259 | 3300046522 | Bacteria | 77609 |
| 230 | Ga0495643_0000289 | 3300046522 | Bacteria | 71822 |
| 231 | Ga0495643_0000355 | 3300046522 | Bacteria | 62412 |
| 232 | Ga0495643_0004247 | 3300046522 | Bacteria | 10121 |
| 233 | Ga0495643_0011506 | 3300046522 | Bacteria | 5386 |
| 234 | Ga0495643_0012005 | 3300046522 | Bacteria | 5242 |
| 235 | Ga0495643_0015708 | 3300046522 | Bacteria | 4466 |
| 236 | Ga0495643_0020873 | 3300046522 | Bacteria | 3768 |
| 237 | Ga0495644_0002399 | 3300046523 | Bacteria | 7474 |
| 238 | Ga0495644_0008860 | 3300046523 | Bacteria | 3868 |
| 239 | Ga0495644_0009170 | 3300046523 | Bacteria | 3812 |
| 240 | Ga0495644_0019697 | 3300046523 | Bacteria | 2576 |
| 241 | Ga0495648_0000002 | 3300046524 | Bacteria | 593972 |
| 242 | Ga0495648_0000033 | 3300046524 | Bacteria | 199184 |
| 243 | Ga0495648_0005478 | 3300046524 | Bacteria | 10532 |
| 244 | Ga0495648_0006077 | 3300046524 | Bacteria | 9906 |
| 245 | Ga0495648_0007011 | 3300046524 | Bacteria | 9081 |
| 246 | Ga0495648_0016197 | 3300046524 | Bacteria | 5379 |
| 247 | Ga0495648_0032849 | 3300046524 | Bacteria | 3398 |
| 248 | Ga0495648_0114188 | 3300046524 | Bacteria | 1463 |
| 249 | Ga0495666_0006487 | 3300046526 | Bacteria | 5890 |
| 250 | Ga0495666_0024584 | 3300046526 | Bacteria | 2976 |
| 251 | Ga0495666_0057039 | 3300046526 | Bacteria | 1869 |
| 252 | Ga0495642_0000005 | 3300046528 | Bacteria | 176726 |
| 253 | Ga0495642_0000674 | 3300046528 | Bacteria | 16988 |
| 254 | Ga0495642_0001445 | 3300046528 | Bacteria | 10631 |
| 255 | Ga0495642_0002063 | 3300046528 | Bacteria | 8344 |
| 256 | Ga0495642_0004166 | 3300046528 | Bacteria | 5642 |
| 257 | Ga0495642_0007058 | 3300046528 | Bacteria | 4309 |
| 258 | Ga0495642_0011372 | 3300046528 | Bacteria | 3419 |
| 259 | Ga0495642_0011543 | 3300046528 | Bacteria | 3396 |
| 260 | Ga0495642_0016061 | 3300046528 | Bacteria | 2914 |
| 261 | Ga0495642_0043778 | 3300046528 | Bacteria | 1826 |
| 262 | Ga0495642_0046896 | 3300046528 | Bacteria | 1768 |
| 263 | Ga0495642_0070954 | 3300046528 | Bacteria | 1457 |
| 264 | Ga0495652_0019561 | 3300046529 | Bacteria | 6027 |
| 265 | Ga0495652_0042000 | 3300046529 | Bacteria | 3944 |
| 266 | Ga0495654_0022711 | 3300046530 | Bacteria | 3254 |
| 267 | Ga0495654_0073411 | 3300046530 | Bacteria | 1618 |
| 268 | Ga0495665_0012160 | 3300046531 | Bacteria | 4657 |
| 269 | Ga0495665_0026254 | 3300046531 | Bacteria | 3128 |
| 270 | Ga0495586_0016889 | 3300046535 | Bacteria | 3882 |
| 271 | Ga0495586_0029285 | 3300046535 | Bacteria | 2946 |
| 272 | Ga0495586_0077600 | 3300046535 | Bacteria | 1821 |
| 273 | Ga0495587_0062513 | 3300046536 | Bacteria | 2179 |
| 274 | Ga0495609_0000039 | 3300046538 | Bacteria | 179384 |
| 275 | Ga0495609_0000852 | 3300046538 | Bacteria | 22505 |
| 276 | Ga0495609_0004053 | 3300046538 | Bacteria | 8169 |
| 277 | Ga0495609_0004264 | 3300046538 | Bacteria | 7890 |
| 278 | Ga0495609_0014359 | 3300046538 | Bacteria | 3724 |
| 279 | Ga0495609_0019400 | 3300046538 | Bacteria | 3146 |
| 280 | Ga0495609_0025272 | 3300046538 | Bacteria | 2724 |
| 281 | Ga0495597_0000080 | 3300046542 | Bacteria | 84504 |
| 282 | Ga0495597_0000199 | 3300046542 | Bacteria | 55011 |
| 283 | Ga0495597_0000260 | 3300046542 | Bacteria | 48197 |
| 284 | Ga0495597_0000277 | 3300046542 | Bacteria | 46764 |
| 285 | Ga0495597_0001354 | 3300046542 | Bacteria | 17760 |
| 286 | Ga0495597_0004469 | 3300046542 | Bacteria | 7673 |
| 287 | Ga0495597_0007499 | 3300046542 | Bacteria | 5532 |
| 288 | Ga0495597_0013640 | 3300046542 | Bacteria | 3887 |
| 289 | Ga0495622_0000155 | 3300046557 | Bacteria | 58297 |
| 290 | Ga0495622_0000478 | 3300046557 | Bacteria | 25255 |
| 291 | Ga0495622_0009318 | 3300046557 | Bacteria | 4544 |
| 292 | Ga0495622_0014984 | 3300046557 | Bacteria | 3604 |
| 293 | Ga0495622_0072092 | 3300046557 | Bacteria | 1593 |
| 294 | Ga0495633_0000418 | 3300046558 | Bacteria | 44096 |
| 295 | Ga0495633_0000715 | 3300046558 | Bacteria | 30145 |
| 296 | Ga0495633_0001616 | 3300046558 | Bacteria | 17022 |
| 297 | Ga0495633_0001630 | 3300046558 | Bacteria | 16931 |
| 298 | Ga0495633_0006484 | 3300046558 | Bacteria | 6928 |
| 299 | Ga0495633_0014850 | 3300046558 | Bacteria | 4054 |
| 300 | Ga0495633_0032864 | 3300046558 | Bacteria | 2504 |
| 301 | Ga0495633_0063079 | 3300046558 | Bacteria | 1734 |
| 302 | Ga0495633_0069069 | 3300046558 | Bacteria | 1649 |
| 303 | Ga0495633_0073495 | 3300046558 | Bacteria | 1594 |
| 304 | Ga0495633_0132692 | 3300046558 | Bacteria | 1152 |
| 305 | Ga0495656_0001955 | 3300046615 | Bacteria | 6793 |
| 306 | Ga0495656_0084945 | 3300046615 | Bacteria | 1436 |
| 307 | Ga0495668_0000132 | 3300046616 | Bacteria | 112674 |
| 308 | Ga0495668_0000845 | 3300046616 | Bacteria | 34738 |
| 309 | Ga0495668_0001020 | 3300046616 | Bacteria | 29835 |
| 310 | Ga0495668_0013818 | 3300046616 | Bacteria | 4749 |
| 311 | Ga0495668_0034493 | 3300046616 | Bacteria | 2838 |
| 312 | Ga0495634_0077196 | 3300046642 | Bacteria | 2185 |
| 313 | Ga0495611_0000066 | 3300046648 | Bacteria | 74136 |
| 314 | Ga0495611_0014940 | 3300046648 | Bacteria | 3317 |
| 315 | Ga0495611_0015671 | 3300046648 | Bacteria | 3240 |
| 316 | Ga0495611_0018245 | 3300046648 | Bacteria | 3007 |
| 317 | Ga0495611_0018799 | 3300046648 | Bacteria | 2964 |
| 318 | Ga0495611_0028082 | 3300046648 | Bacteria | 2462 |
| 319 | Ga0495625_0000177 | 3300046660 | Bacteria | 98918 |
| 320 | Ga0495625_0008778 | 3300046660 | Bacteria | 8562 |
| 321 | Ga0495625_0049060 | 3300046660 | Bacteria | 3036 |
| 322 | Ga0495625_0053421 | 3300046660 | Bacteria | 2889 |
| 323 | Ga0495625_0059907 | 3300046660 | Bacteria | 2699 |
| 324 | Ga0495661_0000198 | 3300046665 | Bacteria | 69566 |
| 325 | Ga0495661_0000295 | 3300046665 | Bacteria | 56555 |
| 326 | Ga0495661_0001021 | 3300046665 | Bacteria | 24862 |
| 327 | Ga0495661_0001202 | 3300046665 | Bacteria | 22463 |
| 328 | Ga0495661_0014080 | 3300046665 | Bacteria | 5361 |
| 329 | Ga0495661_0015623 | 3300046665 | Bacteria | 5063 |
| 330 | Ga0495661_0017366 | 3300046665 | Bacteria | 4753 |
| 331 | Ga0495661_0021871 | 3300046665 | Bacteria | 4163 |
| 332 | Ga0495661_0046519 | 3300046665 | Bacteria | 2648 |
| 333 | Ga0495661_0054407 | 3300046665 | Bacteria | 2403 |
| 334 | Ga0495661_0059652 | 3300046665 | Bacteria | 2270 |
| 335 | Ga0495661_0103727 | 3300046665 | Bacteria | 1595 |
| 336 | Ga0495588_0000055 | 3300046674 | Bacteria | 280059 |
| 337 | Ga0495588_0016740 | 3300046674 | Bacteria | 3546 |
| 338 | Ga0495588_0059817 | 3300046674 | Bacteria | 1971 |
| 339 | Ga0495623_0016865 | 3300046679 | Bacteria | 4718 |
| 340 | Ga0495623_0026429 | 3300046679 | Bacteria | 3737 |
| 341 | Ga0495669_0001405 | 3300046684 | Bacteria | 9902 |
| 342 | Ga0495669_0013571 | 3300046684 | Bacteria | 3474 |
| 343 | Ga0495624_0015899 | 3300046690 | Bacteria | 5068 |
| 344 | Ga0495670_0002474 | 3300046691 | Bacteria | 9116 |
| 345 | Ga0495670_0013965 | 3300046691 | Bacteria | 3950 |
| 346 | Ga0495670_0033223 | 3300046691 | Bacteria | 2567 |
| 347 | Ga0495670_0057925 | 3300046691 | Bacteria | 1945 |
| 348 | Ga0495671_0007284 | 3300046692 | Bacteria | 6315 |
| 349 | Ga0495671_0013758 | 3300046692 | Bacteria | 4370 |
| 350 | Ga0495671_0013782 | 3300046692 | Bacteria | 4365 |
| 351 | Ga0495671_0050661 | 3300046692 | Bacteria | 2067 |
| 352 | Ga0495649_0000049 | 3300046694 | Bacteria | 113865 |
| 353 | Ga0495649_0000786 | 3300046694 | Bacteria | 25504 |
| 354 | Ga0495649_0015727 | 3300046694 | Bacteria | 4301 |
| 355 | Ga0495649_0071570 | 3300046694 | Bacteria | 1858 |
| 356 | Ga0495649_0073614 | 3300046694 | Bacteria | 1830 |
| 357 | Ga0495589_0000097 | 3300046794 | Bacteria | 84037 |
| 358 | Ga0495589_0000226 | 3300046794 | Bacteria | 47688 |
| 359 | Ga0495589_0000591 | 3300046794 | Bacteria | 24795 |
| 360 | Ga0495589_0005255 | 3300046794 | Bacteria | 6842 |
| 361 | Ga0495589_0007228 | 3300046794 | Bacteria | 5817 |
| 362 | Ga0495589_0009080 | 3300046794 | Bacteria | 5169 |
| 363 | Ga0495589_0013030 | 3300046794 | Bacteria | 4295 |
| 364 | Ga0495589_0042200 | 3300046794 | Bacteria | 2273 |
| 365 | Ga0495589_0088618 | 3300046794 | Bacteria | 1502 |
| 366 | Ga0495600_0019527 | 3300046809 | Bacteria | 4328 |
| 367 | Ga0495660_0000121 | 3300046810 | Bacteria | 85122 |
| 368 | Ga0495660_0000230 | 3300046810 | Bacteria | 55115 |
| 369 | Ga0495660_0010944 | 3300046810 | Bacteria | 5272 |
| 370 | Ga0495660_0028905 | 3300046810 | Bacteria | 3129 |
| 371 | Ga0495660_0043845 | 3300046810 | Bacteria | 2464 |
| 372 | Ga0495660_0047667 | 3300046810 | Bacteria | 2345 |
| 373 | Ga0495660_0085516 | 3300046810 | Bacteria | 1647 |
| 374 | Ga0495660_0124785 | 3300046810 | Bacteria | 1298 |
| 375 | Ga0495581_0084063 | 3300047315 | Bacteria | 1844 |
| 376 | Ga0495581_0093165 | 3300047315 | Bacteria | 1748 |
| 377 | Ga0495604_0032053 | 3300047317 | Bacteria | 4166 |
| 378 | Ga0495604_0153516 | 3300047317 | Bacteria | 1633 |
| 379 | Ga0495636_0055252 | 3300047318 | Bacteria | 1669 |
| 380 | Ga0495674_0010498 | 3300047319 | Bacteria | 8764 |
| 381 | Ga0495672_0000005 | 3300047320 | Bacteria | 593294 |
| 382 | Ga0495672_0000033 | 3300047320 | Bacteria | 291992 |
| 383 | Ga0495672_0000074 | 3300047320 | Bacteria | 179013 |
| 384 | Ga0495672_0000291 | 3300047320 | Bacteria | 69062 |
| 385 | Ga0495672_0008945 | 3300047320 | Bacteria | 7314 |
| 386 | Ga0495672_0022320 | 3300047320 | Bacteria | 4116 |
| 387 | Ga0495676_0041864 | 3300047321 | Bacteria | 3766 |
| 388 | Ga0495676_0052341 | 3300047321 | Bacteria | 3260 |
| 389 | Ga0495676_0082551 | 3300047321 | Bacteria | 2432 |
| 390 | Ga0495683_0000024 | 3300047323 | Bacteria | 156554 |
| 391 | Ga0495683_0000072 | 3300047323 | Bacteria | 104027 |
| 392 | Ga0495683_0006480 | 3300047323 | Bacteria | 6395 |
| 393 | Ga0495683_0019141 | 3300047323 | Bacteria | 3533 |
| 394 | Ga0495683_0023729 | 3300047323 | Bacteria | 3152 |
| 395 | Ga0495687_000002 | 3300047443 | Bacteria | 1085770 |
| 396 | Ga0495687_000059 | 3300047443 | Bacteria | 179357 |
| 397 | Ga0495687_000182 | 3300047443 | Bacteria | 91333 |
| 398 | Ga0495687_000209 | 3300047443 | Bacteria | 83956 |
| 399 | Ga0495687_000949 | 3300047443 | Bacteria | 29869 |
| 400 | Ga0495687_001091 | 3300047443 | Bacteria | 26564 |
| 401 | Ga0495687_001538 | 3300047443 | Bacteria | 20986 |
| 402 | Ga0495687_004288 | 3300047443 | Bacteria | 9739 |
| 403 | Ga0495675_0064618 | 3300047444 | Bacteria | 2314 |
| 404 | Ga0495677_0000006 | 3300047445 | Bacteria | 199230 |
| 405 | Ga0495677_0000078 | 3300047445 | Bacteria | 49500 |
| 406 | Ga0495677_0000175 | 3300047445 | Bacteria | 30531 |
| 407 | Ga0495677_0001405 | 3300047445 | Bacteria | 9658 |
| 408 | Ga0495677_0007166 | 3300047445 | Bacteria | 4175 |
| 409 | Ga0495677_0008807 | 3300047445 | Bacteria | 3738 |
| 410 | Ga0495677_0015090 | 3300047445 | Bacteria | 2807 |
| 411 | Ga0495677_0024129 | 3300047445 | Bacteria | 2206 |
| 412 | Ga0495677_0025761 | 3300047445 | Bacteria | 2133 |
| 413 | Ga0495677_0065416 | 3300047445 | Bacteria | 1351 |
| 414 | Ga0495679_002912 | 3300047446 | Bacteria | 8471 |
| 415 | Ga0495685_002111 | 3300047447 | Bacteria | 6177 |
| 416 | Ga0495685_061604 | 3300047447 | Bacteria | 1263 |
| 417 | Ga0495673_0012454 | 3300047469 | Bacteria | 4508 |
| 418 | Ga0495681_0000021 | 3300047470 | Bacteria | 166534 |
| 419 | Ga0495681_0000105 | 3300047470 | Bacteria | 73364 |
| 420 | Ga0495681_0008645 | 3300047470 | Bacteria | 6357 |
| 421 | Ga0495681_0014006 | 3300047470 | Bacteria | 4623 |
| 422 | Ga0495681_0031020 | 3300047470 | Bacteria | 2713 |
| 423 | Ga0495681_0034064 | 3300047470 | Bacteria | 2541 |
| 424 | Ga0495681_0076080 | 3300047470 | Bacteria | 1509 |
| 425 | Ga0495686_0000062 | 3300047472 | Bacteria | 235234 |
| 426 | Ga0495686_0000357 | 3300047472 | Bacteria | 74707 |
| 427 | Ga0495686_0020745 | 3300047472 | Bacteria | 4379 |
| 428 | Ga0495686_0068779 | 3300047472 | Bacteria | 2185 |
| 429 | Ga0495593_0035360 | 3300047673 | Bacteria | 2713 |
| 430 | Ga0495602_0003141 | 3300048088 | Bacteria | 17000 |
| 431 | Ga0495602_0054483 | 3300048088 | Bacteria | 3530 |
| 432 | Ga0495602_0226261 | 3300048088 | Bacteria | 1408 |
| 433 | Ga0495626_0000004 | 3300048091 | Bacteria | 356599 |
| 434 | Ga0495626_0000121 | 3300048091 | Bacteria | 102193 |
| 435 | Ga0495626_0001106 | 3300048091 | Bacteria | 22796 |
| 436 | Ga0495626_0003308 | 3300048091 | Bacteria | 10410 |
| 437 | Ga0495626_0003661 | 3300048091 | Bacteria | 9757 |
| 438 | Ga0495626_0003734 | 3300048091 | Bacteria | 9617 |
| 439 | Ga0495626_0004849 | 3300048091 | Bacteria | 8100 |
| 440 | Ga0495626_0020912 | 3300048091 | Bacteria | 3255 |
| 441 | Ga0495626_0023697 | 3300048091 | Bacteria | 3018 |
| 442 | Ga0495626_0025239 | 3300048091 | Bacteria | 2907 |
| 443 | Ga0495626_0025465 | 3300048091 | Bacteria | 2893 |
| 444 | Ga0495626_0025787 | 3300048091 | Bacteria | 2871 |
| 445 | Ga0495626_0029847 | 3300048091 | Bacteria | 2634 |
| 446 | Ga0495626_0040558 | 3300048091 | Bacteria | 2198 |
| 447 | Ga0496100_0067688 | 3300048903 | Bacteria | 2372 |
| 448 | Ga0496101_0031465 | 3300048904 | Bacteria | 3730 |
| 449 | Ga0496102_0000952 | 3300048905 | Bacteria | 27286 |
| 450 | Ga0496102_0041205 | 3300048905 | Bacteria | 4180 |
| 451 | Ga0496102_0081325 | 3300048905 | Bacteria | 2986 |
| 452 | Ga0496102_0123275 | 3300048905 | Bacteria | 2421 |
| 453 | Ga0496103_0060431 | 3300048906 | Bacteria | 2355 |
| 454 | Ga0496103_0134014 | 3300048906 | Bacteria | 1583 |
| 455 | Ga0496105_0068629 | 3300048908 | Bacteria | 2929 |
| 456 | Ga0496106_0003119 | 3300048909 | Bacteria | 12370 |
| 457 | Ga0496107_0009829 | 3300048910 | Bacteria | 6635 |
| 458 | Ga0496108_0239898 | 3300048911 | Bacteria | 1577 |
| 459 | Ga0496109_0216274 | 3300048912 | Bacteria | 1802 |
| 460 | Ga0496110_0000016 | 3300048913 | Bacteria | 85281 |
| 461 | Ga0496110_0007662 | 3300048913 | Bacteria | 8639 |
| 462 | Ga0496111_0004425 | 3300048914 | Bacteria | 8882 |
| 463 | Ga0496112_0156255 | 3300048915 | Bacteria | 2248 |
| 464 | Ga0496113_0017627 | 3300048916 | Bacteria | 4962 |
| 465 | Ga0496113_0061841 | 3300048916 | Bacteria | 2826 |
| 466 | Ga0496113_0153724 | 3300048916 | Bacteria | 1816 |
| 467 | Ga0496114_0039580 | 3300048917 | Bacteria | 3901 |
| 468 | Ga0496115_0038438 | 3300048918 | Bacteria | 3797 |
| 469 | Ga0496115_0288414 | 3300048918 | Bacteria | 1347 |
| 470 | Ga0496122_0000263 | 3300048925 | Bacteria | 117762 |
| 471 | Ga0496122_0001691 | 3300048925 | Bacteria | 34211 |
| 472 | Ga0496123_0000156 | 3300048926 | Bacteria | 139362 |
| 473 | Ga0496124_0011177 | 3300048927 | Bacteria | 9002 |
| 474 | Ga0496124_0015139 | 3300048927 | Bacteria | 7410 |
| 475 | Ga0496124_0015495 | 3300048927 | Bacteria | 7303 |
| 476 | Ga0496124_0037791 | 3300048927 | Bacteria | 4196 |
| 477 | Ga0496125_0000669 | 3300048928 | Bacteria | 57185 |
| 478 | Ga0495678_000009 | 3300049459 | Bacteria | 373806 |
| 479 | Ga0495678_000024 | 3300049459 | Bacteria | 229034 |
| 480 | Ga0495678_000069 | 3300049459 | Bacteria | 131739 |
| 481 | Ga0495678_000084 | 3300049459 | Bacteria | 117340 |
| 482 | Ga0495678_000900 | 3300049459 | Bacteria | 26294 |
| 483 | Ga0495678_001772 | 3300049459 | Bacteria | 15984 |
| 484 | Ga0495678_002067 | 3300049459 | Bacteria | 14320 |
| 485 | Ga0495678_004305 | 3300049459 | Bacteria | 8298 |
| 486 | Ga0495678_010078 | 3300049459 | Bacteria | 4613 |
| 487 | Ga0495678_031774 | 3300049459 | Bacteria | 2196 |
| 488 | Ga0495682_0001139 | 3300049460 | Bacteria | 15384 |
| 489 | Ga0495682_0003279 | 3300049460 | Bacteria | 7245 |
| 490 | Ga0495682_0010781 | 3300049460 | Bacteria | 3527 |
| 491 | Ga0495682_0010960 | 3300049460 | Bacteria | 3494 |
| 492 | Ga0495682_0016041 | 3300049460 | Bacteria | 2834 |
| 493 | Ga0495682_0029153 | 3300049460 | Bacteria | 2044 |
| 494 | Ga0501034_0119438 | 3300049571 | Bacteria | 2623 |
| 495 | Ga0501269_000278 | 3300049766 | Bacteria | 14308 |
| 496 | Ga0501035_0000687 | 3300049822 | Bacteria | 36967 |
| 497 | Ga0501044_0137482 | 3300049823 | Bacteria | 2434 |
| 498 | nmdc:mga03683_36291_c1 | 3300050489 | Bacteria | 1507 |
| 499 | Ga0500586_001783 | 3300053145 | Bacteria | 4662 |
| 500 | Ga0587107_005032 | 3300059652 | Bacteria | 1377 |
| 501 | Ga0466962_0022720 | 3300061719 | Bacteria | 3014 |
| 502 | Ga0466962_0038991 | 3300061719 | Bacteria | 2275 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048903 | Ga0496100_0067688 | Ga0496100_0067688_1386_2351 | 321 |
| 2 | 3300046492 | Ga0495585_0141332 | Ga0495585_0141332_247_1236 | 323 |
| 3 | 3300046501 | Ga0495607_0029967 | Ga0495607_0029967_2343_3329 | 328 |
| 4 | 3300046526 | Ga0495666_0057039 | Ga0495666_0057039_77_1099 | 337 |
| 5 | 3300047445 | Ga0495677_0065416 | Ga0495677_0065416_319_1335 | 337 |
| 6 | 3300042115 | Ga0450911_005624 | Ga0450911_005624_40_1068 | 342 |
| 7 | 3300046528 | Ga0495642_0011543 | Ga0495642_0011543_2345_3373 | 342 |
| 8 | 3300046648 | Ga0495611_0014940 | Ga0495611_0014940_2240_3307 | 353 |
| 9 | 3300046535 | Ga0495586_0016889 | Ga0495586_0016889_340_1413 | 357 |
| 10 | 3300038443 | Ga0395901_0286162 | Ga0395901_0286162_621_1697 | 358 |
| 11 | 3300021361 | Ga0213872_10041879 | Ga0213872_100418792 | 360 |
| 12 | 3300046523 | Ga0495644_0009170 | Ga0495644_0009170_2551_3660 | 362 |
| 13 | 3300025245 | Ga0207425_1000464 | Ga0207425_100046412 | 364 |
| 14 | 3300025294 | Ga0209025_1002606 | Ga0209025_100260612 | 364 |
| 15 | 3300025297 | Ga0209758_1001071 | Ga0209758_10010713 | 364 |
| 16 | 3300046507 | Ga0495606_0003168 | Ga0495606_0003168_3125_4225 | 364 |
| 17 | 3300046512 | Ga0495610_0005343 | Ga0495610_0005343_40_1140 | 364 |
| 18 | 3300048088 | Ga0495602_0226261 | Ga0495602_0226261_41_1135 | 364 |
| 19 | 3300048917 | Ga0496114_0039580 | Ga0496114_0039580_450_1550 | 364 |
| 20 | 3300046460 | Ga0495638_0017591 | Ga0495638_0017591_2675_3787 | 365 |
| 21 | 3300046500 | Ga0495596_0052114 | Ga0495596_0052114_137_1234 | 365 |
| 22 | 3300046506 | Ga0495583_0000388 | Ga0495583_0000388_41661_42758 | 365 |
| 23 | 3300046506 | Ga0495583_0004800 | Ga0495583_0004800_4419_5531 | 365 |
| 24 | 3300046507 | Ga0495606_0136911 | Ga0495606_0136911_273_1373 | 365 |
| 25 | 3300046513 | Ga0495616_0037698 | Ga0495616_0037698_1172_2284 | 365 |
| 26 | 3300046518 | Ga0495631_0002938 | Ga0495631_0002938_7932_9029 | 365 |
| 27 | 3300046518 | Ga0495631_0006058 | Ga0495631_0006058_1400_2512 | 365 |
| 28 | 3300046519 | Ga0495632_0000029 | Ga0495632_0000029_162671_163768 | 365 |
| 29 | 3300046520 | Ga0495637_0007939 | Ga0495637_0007939_1274_2386 | 365 |
| 30 | 3300046522 | Ga0495643_0012005 | Ga0495643_0012005_743_1855 | 365 |
| 31 | 3300046524 | Ga0495648_0007011 | Ga0495648_0007011_5644_6756 | 365 |
| 32 | 3300046528 | Ga0495642_0002063 | Ga0495642_0002063_5896_6993 | 365 |
| 33 | 3300046542 | Ga0495597_0000199 | Ga0495597_0000199_7230_8330 | 365 |
| 34 | 3300046558 | Ga0495633_0014850 | Ga0495633_0014850_1304_2401 | 365 |
| 35 | 3300046558 | Ga0495633_0063079 | Ga0495633_0063079_619_1716 | 365 |
| 36 | 3300046615 | Ga0495656_0084945 | Ga0495656_0084945_185_1282 | 365 |
| 37 | 3300046660 | Ga0495625_0053421 | Ga0495625_0053421_1204_2316 | 365 |
| 38 | 3300046665 | Ga0495661_0046519 | Ga0495661_0046519_530_1642 | 365 |
| 39 | 3300046692 | Ga0495671_0007284 | Ga0495671_0007284_5092_6192 | 365 |
| 40 | 3300046692 | Ga0495671_0013782 | Ga0495671_0013782_1052_2164 | 365 |
| 41 | 3300046794 | Ga0495589_0000591 | Ga0495589_0000591_22345_23445 | 365 |
| 42 | 3300046810 | Ga0495660_0047667 | Ga0495660_0047667_921_2018 | 365 |
| 43 | 3300047323 | Ga0495683_0019141 | Ga0495683_0019141_1325_2422 | 365 |
| 44 | 3300047443 | Ga0495687_000182 | Ga0495687_000182_49105_50220 | 365 |
| 45 | 3300047446 | Ga0495679_002912 | Ga0495679_002912_6605_7717 | 365 |
| 46 | 3300047447 | Ga0495685_061604 | Ga0495685_061604_46_1158 | 365 |
| 47 | 3300047470 | Ga0495681_0000105 | Ga0495681_0000105_39261_40358 | 365 |
| 48 | 3300047470 | Ga0495681_0031020 | Ga0495681_0031020_1254_2366 | 365 |
| 49 | 3300048091 | Ga0495626_0040558 | Ga0495626_0040558_931_2043 | 365 |
| 50 | 3300049459 | Ga0495678_000084 | Ga0495678_000084_68657_69769 | 365 |
| 51 | 3300049459 | Ga0495678_002067 | Ga0495678_002067_11980_13077 | 365 |
| 52 | 3300049459 | Ga0495678_004305 | Ga0495678_004305_59_1156 | 365 |
| 53 | 3300049460 | Ga0495682_0001139 | Ga0495682_0001139_4355_5452 | 365 |
| 54 | 3300039447 | Ga0436361_0006435 | Ga0436361_0006435_5173_6282 | 367 |
| 55 | 3300046457 | Ga0495590_0001412 | Ga0495590_0001412_7719_8834 | 367 |
| 56 | 3300046463 | Ga0495653_0016217 | Ga0495653_0016217_4837_5952 | 367 |
| 57 | 3300046473 | Ga0495582_0021534 | Ga0495582_0021534_1835_2950 | 367 |
| 58 | 3300046492 | Ga0495585_0085435 | Ga0495585_0085435_368_1477 | 367 |
| 59 | 3300046499 | Ga0495594_0011793 | Ga0495594_0011793_84_1199 | 367 |
| 60 | 3300046500 | Ga0495596_0001380 | Ga0495596_0001380_4109_5218 | 367 |
| 61 | 3300046506 | Ga0495583_0000480 | Ga0495583_0000480_39315_40424 | 367 |
| 62 | 3300046506 | Ga0495583_0078273 | Ga0495583_0078273_21_1130 | 367 |
| 63 | 3300046518 | Ga0495631_0006733 | Ga0495631_0006733_3348_4457 | 367 |
| 64 | 3300046519 | Ga0495632_0106131 | Ga0495632_0106131_198_1304 | 367 |
| 65 | 3300046522 | Ga0495643_0015708 | Ga0495643_0015708_2091_3200 | 367 |
| 66 | 3300046529 | Ga0495652_0019561 | Ga0495652_0019561_4412_5527 | 367 |
| 67 | 3300046531 | Ga0495665_0012160 | Ga0495665_0012160_1794_2909 | 367 |
| 68 | 3300046536 | Ga0495587_0062513 | Ga0495587_0062513_352_1467 | 367 |
| 69 | 3300046538 | Ga0495609_0004264 | Ga0495609_0004264_5310_6419 | 367 |
| 70 | 3300046542 | Ga0495597_0000277 | Ga0495597_0000277_436_1542 | 367 |
| 71 | 3300046557 | Ga0495622_0009318 | Ga0495622_0009318_1436_2545 | 367 |
| 72 | 3300046558 | Ga0495633_0132692 | Ga0495633_0132692_10_1119 | 367 |
| 73 | 3300046691 | Ga0495670_0002474 | Ga0495670_0002474_2957_4066 | 367 |
| 74 | 3300047317 | Ga0495604_0032053 | Ga0495604_0032053_2483_3598 | 367 |
| 75 | 3300047320 | Ga0495672_0022320 | Ga0495672_0022320_1815_2924 | 367 |
| 76 | 3300047321 | Ga0495676_0052341 | Ga0495676_0052341_227_1339 | 367 |
| 77 | 3300047469 | Ga0495673_0012454 | Ga0495673_0012454_1817_2926 | 367 |
| 78 | 3300048088 | Ga0495602_0003141 | Ga0495602_0003141_1337_2452 | 367 |
| 79 | 3300048091 | Ga0495626_0000004 | Ga0495626_0000004_83670_84791 | 367 |
| 80 | 3300048091 | Ga0495626_0023697 | Ga0495626_0023697_1481_2590 | 367 |
| 81 | 3300048911 | Ga0496108_0239898 | Ga0496108_0239898_130_1251 | 371 |
| 82 | 3300048927 | Ga0496124_0015495 | Ga0496124_0015495_1388_2509 | 371 |
| 83 | 3300003575 | Ga0007409J51694_1007381 | Ga0007409J51694_10073811 | 372 |
| 84 | 3300037418 | Ga0395900_0127411 | Ga0395900_0127411_322_1440 | 372 |
| 85 | 3300037418 | Ga0395900_0459905 | Ga0395900_0459905_44_1162 | 372 |
| 86 | 3300038443 | Ga0395901_0378412 | Ga0395901_0378412_202_1320 | 372 |
| 87 | 3300044656 | Ga0466969_0062861 | Ga0466969_0062861_77_1204 | 372 |
| 88 | 3300044683 | Ga0466965_0002454 | Ga0466965_0002454_5019_6137 | 372 |
| 89 | 3300044683 | Ga0466965_0004129 | Ga0466965_0004129_5113_6240 | 372 |
| 90 | 3300044684 | Ga0466966_0032144 | Ga0466966_0032144_1126_2244 | 372 |
| 91 | 3300044765 | Ga0466970_0142366 | Ga0466970_0142366_153_1271 | 372 |
| 92 | 3300044842 | Ga0466957_0000127 | Ga0466957_0000127_29914_31032 | 372 |
| 93 | 3300045049 | Ga0466959_0008598 | Ga0466959_0008598_2422_3549 | 372 |
| 94 | 3300045836 | Ga0466958_0077211 | Ga0466958_0077211_229_1347 | 372 |
| 95 | 3300046474 | Ga0495605_0000332 | Ga0495605_0000332_10724_11842 | 372 |
| 96 | 3300046501 | Ga0495607_0069351 | Ga0495607_0069351_552_1670 | 372 |
| 97 | 3300046522 | Ga0495643_0004247 | Ga0495643_0004247_7423_8541 | 372 |
| 98 | 3300046794 | Ga0495589_0000226 | Ga0495589_0000226_10724_11842 | 372 |
| 99 | 3300046810 | Ga0495660_0000230 | Ga0495660_0000230_10724_11842 | 372 |
| 100 | 3300047443 | Ga0495687_000949 | Ga0495687_000949_10719_11837 | 372 |
| 101 | 3300047445 | Ga0495677_0001405 | Ga0495677_0001405_8526_9644 | 372 |
| 102 | 3300048091 | Ga0495626_0001106 | Ga0495626_0001106_19363_20481 | 372 |
| 103 | 3300061719 | Ga0466962_0022720 | Ga0466962_0022720_1231_2358 | 372 |
| 104 | 3300037312 | Ga0395899_0002391 | Ga0395899_0002391_12210_13379 | 376 |
| 105 | 3300037466 | Ga0395898_0186468 | Ga0395898_0186468_437_1606 | 376 |
| 106 | 3300037471 | Ga0395905_0235545 | Ga0395905_0235545_263_1432 | 376 |
| 107 | 3300059652 | Ga0587107_005032 | Ga0587107_005032_157_1326 | 376 |
| 108 | iso_pu_bacteria | 2842711865 | 2842718082 | 377 |
| 109 | iso_pu_bacteria | 2857553236 | 2857556978 | 377 |
| 110 | iso_pu_bacteria | 2904424332 | 2904424467 | 377 |
| 111 | 3300037312 | Ga0395899_0108705 | Ga0395899_0108705_211_1380 | 378 |
| 112 | 3300037471 | Ga0395905_0136531 | Ga0395905_0136531_490_1659 | 378 |
| 113 | 3300048918 | Ga0496115_0288414 | Ga0496115_0288414_197_1333 | 378 |
| 114 | 3300046491 | Ga0495584_0000245 | Ga0495584_0000245_36970_38130 | 379 |
| 115 | 3300046492 | Ga0495585_0000162 | Ga0495585_0000162_37253_38413 | 379 |
| 116 | 3300046500 | Ga0495596_0006046 | Ga0495596_0006046_498_1658 | 379 |
| 117 | 3300046513 | Ga0495616_0012583 | Ga0495616_0012583_412_1572 | 379 |
| 118 | 3300046538 | Ga0495609_0014359 | Ga0495609_0014359_2251_3411 | 379 |
| 119 | 3300046558 | Ga0495633_0001630 | Ga0495633_0001630_6118_7278 | 379 |
| 120 | 3300046616 | Ga0495668_0013818 | Ga0495668_0013818_2401_3561 | 379 |
| 121 | 3300047323 | Ga0495683_0000072 | Ga0495683_0000072_62771_63931 | 379 |
| 122 | 3300049460 | Ga0495682_0029153 | Ga0495682_0029153_91_1251 | 379 |
| 123 | 3300046457 | Ga0495590_0000016 | Ga0495590_0000016_100661_101809 | 380 |
| 124 | 3300046460 | Ga0495638_0000057 | Ga0495638_0000057_96913_98061 | 380 |
| 125 | 3300046471 | Ga0495650_0001087 | Ga0495650_0001087_8524_9672 | 380 |
| 126 | 3300046475 | Ga0495639_0014849 | Ga0495639_0014849_537_1685 | 380 |
| 127 | 3300046506 | Ga0495583_0000178 | Ga0495583_0000178_98069_99217 | 380 |
| 128 | 3300046522 | Ga0495643_0000236 | Ga0495643_0000236_19967_21115 | 380 |
| 129 | 3300046524 | Ga0495648_0000002 | Ga0495648_0000002_494571_495719 | 380 |
| 130 | 3300046542 | Ga0495597_0000080 | Ga0495597_0000080_48677_49825 | 380 |
| 131 | 3300046557 | Ga0495622_0000478 | Ga0495622_0000478_9371_10519 | 380 |
| 132 | 3300046558 | Ga0495633_0000418 | Ga0495633_0000418_8605_9753 | 380 |
| 133 | 3300046616 | Ga0495668_0000132 | Ga0495668_0000132_43767_44915 | 380 |
| 134 | 3300046660 | Ga0495625_0000177 | Ga0495625_0000177_54714_55862 | 380 |
| 135 | 3300047443 | Ga0495687_000209 | Ga0495687_000209_67020_68168 | 380 |
| 136 | 3300047443 | Ga0495687_001091 | Ga0495687_001091_15790_16938 | 380 |
| 137 | 3300049459 | Ga0495678_000900 | Ga0495678_000900_24820_25968 | 380 |
| 138 | 3300049459 | Ga0495678_031774 | Ga0495678_031774_46_1194 | 380 |
| 139 | iso_pu_bacteria | 2821131069 | 2821132563 | 380 |
| 140 | 3300003771 | Ga0055526_1000023 | Ga0055526_100002365 | 381 |
| 141 | 3300003775 | Ga0055524_1000008 | Ga0055524_1000008166 | 381 |
| 142 | 3300006946 | Ga0079104_1003520 | Ga0079104_10035203 | 381 |
| 143 | 3300006948 | Ga0099826_10000001 | Ga0099826_10000001436 | 381 |
| 144 | 3300009036 | Ga0105244_10012633 | Ga0105244_100126333 | 381 |
| 145 | 3300015261 | Ga0182006_1000008 | Ga0182006_1000008317 | 381 |
| 146 | 3300015265 | Ga0182005_1000008 | Ga0182005_1000008283 | 381 |
| 147 | 3300025246 | Ga0209646_1000049 | Ga0209646_1000049165 | 381 |
| 148 | 3300025295 | Ga0209564_1000002 | Ga0209564_1000002651 | 381 |
| 149 | 3300025295 | Ga0209564_1016008 | Ga0209564_10160083 | 381 |
| 150 | 3300025299 | Ga0209256_1000005 | Ga0209256_10000051112 | 381 |
| 151 | 3300027111 | Ga0209281_1002837 | Ga0209281_10028374 | 381 |
| 152 | 3300027666 | Ga0209282_1000001 | Ga0209282_10000011574 | 381 |
| 153 | 3300046501 | Ga0495607_0043022 | Ga0495607_0043022_748_1932 | 381 |
| 154 | 3300046507 | Ga0495606_0001333 | Ga0495606_0001333_29211_30362 | 381 |
| 155 | 3300046512 | Ga0495610_0000411 | Ga0495610_0000411_6360_7511 | 381 |
| 156 | 3300046512 | Ga0495610_0006951 | Ga0495610_0006951_3183_4334 | 381 |
| 157 | 3300046512 | Ga0495610_0011075 | Ga0495610_0011075_1387_2538 | 381 |
| 158 | 3300046520 | Ga0495637_0008045 | Ga0495637_0008045_2048_3199 | 381 |
| 159 | 3300046522 | Ga0495643_0000289 | Ga0495643_0000289_64217_65368 | 381 |
| 160 | 3300046524 | Ga0495648_0016197 | Ga0495648_0016197_2814_3965 | 381 |
| 161 | 3300046542 | Ga0495597_0001354 | Ga0495597_0001354_1654_2805 | 381 |
| 162 | 3300046558 | Ga0495633_0001616 | Ga0495633_0001616_13705_14856 | 381 |
| 163 | 3300046660 | Ga0495625_0008778 | Ga0495625_0008778_816_1967 | 381 |
| 164 | 3300046660 | Ga0495625_0049060 | Ga0495625_0049060_864_2015 | 381 |
| 165 | 3300046692 | Ga0495671_0050661 | Ga0495671_0050661_681_1832 | 381 |
| 166 | 3300046694 | Ga0495649_0015727 | Ga0495649_0015727_1547_2695 | 381 |
| 167 | 3300046810 | Ga0495660_0000121 | Ga0495660_0000121_25721_26881 | 381 |
| 168 | 3300047320 | Ga0495672_0000291 | Ga0495672_0000291_6419_7570 | 381 |
| 169 | 3300048927 | Ga0496124_0037791 | Ga0496124_0037791_2212_3372 | 381 |
| 170 | 3300049459 | Ga0495678_000009 | Ga0495678_000009_312343_313503 | 381 |
| 171 | 3300049459 | Ga0495678_000069 | Ga0495678_000069_127552_128703 | 381 |
| 172 | 3300049766 | Ga0501269_000278 | Ga0501269_000278_10394_11545 | 381 |
| 173 | 3300050489 | nmdc:mga03683_36291_c1 | nmdc:mga03683_36291_c1_191_1342 | 381 |
| 174 | 3300053145 | Ga0500586_001783 | Ga0500586_001783_1622_2773 | 381 |
| 175 | 3300046453 | Ga0495627_000610 | Ga0495627_000610_2691_3839 | 382 |
| 176 | 3300046457 | Ga0495590_0000013 | Ga0495590_0000013_94387_95538 | 382 |
| 177 | 3300046458 | Ga0495591_000093 | Ga0495591_000093_5075_6226 | 382 |
| 178 | 3300046460 | Ga0495638_0089124 | Ga0495638_0089124_276_1424 | 382 |
| 179 | 3300046474 | Ga0495605_0008895 | Ga0495605_0008895_1000_2151 | 382 |
| 180 | 3300046491 | Ga0495584_0000032 | Ga0495584_0000032_98120_99271 | 382 |
| 181 | 3300046492 | Ga0495585_0006101 | Ga0495585_0006101_4780_5931 | 382 |
| 182 | 3300046500 | Ga0495596_0008801 | Ga0495596_0008801_454_1605 | 382 |
| 183 | 3300046501 | Ga0495607_0002124 | Ga0495607_0002124_10922_12073 | 382 |
| 184 | 3300046506 | Ga0495583_0001054 | Ga0495583_0001054_25351_26502 | 382 |
| 185 | 3300046512 | Ga0495610_0000326 | Ga0495610_0000326_5074_6225 | 382 |
| 186 | 3300046518 | Ga0495631_0001448 | Ga0495631_0001448_9507_10658 | 382 |
| 187 | 3300046519 | Ga0495632_0000034 | Ga0495632_0000034_20227_21378 | 382 |
| 188 | 3300046520 | Ga0495637_0000008 | Ga0495637_0000008_177222_178373 | 382 |
| 189 | 3300046522 | Ga0495643_0020873 | Ga0495643_0020873_695_1846 | 382 |
| 190 | 3300046524 | Ga0495648_0006077 | Ga0495648_0006077_4462_5610 | 382 |
| 191 | 3300046524 | Ga0495648_0114188 | Ga0495648_0114188_214_1365 | 382 |
| 192 | 3300046528 | Ga0495642_0004166 | Ga0495642_0004166_3957_5108 | 382 |
| 193 | 3300046538 | Ga0495609_0025272 | Ga0495609_0025272_729_1877 | 382 |
| 194 | 3300046542 | Ga0495597_0000260 | Ga0495597_0000260_24739_25890 | 382 |
| 195 | 3300046558 | Ga0495633_0000715 | Ga0495633_0000715_19204_20355 | 382 |
| 196 | 3300046648 | Ga0495611_0000066 | Ga0495611_0000066_71617_72768 | 382 |
| 197 | 3300046665 | Ga0495661_0000198 | Ga0495661_0000198_62964_64112 | 382 |
| 198 | 3300046665 | Ga0495661_0014080 | Ga0495661_0014080_418_1569 | 382 |
| 199 | 3300046665 | Ga0495661_0103727 | Ga0495661_0103727_401_1549 | 382 |
| 200 | 3300046694 | Ga0495649_0000049 | Ga0495649_0000049_78525_79676 | 382 |
| 201 | 3300046794 | Ga0495589_0005255 | Ga0495589_0005255_912_2063 | 382 |
| 202 | 3300046810 | Ga0495660_0028905 | Ga0495660_0028905_618_1769 | 382 |
| 203 | 3300047320 | Ga0495672_0000033 | Ga0495672_0000033_89708_90859 | 382 |
| 204 | 3300047320 | Ga0495672_0000074 | Ga0495672_0000074_147403_148554 | 382 |
| 205 | 3300047323 | Ga0495683_0000024 | Ga0495683_0000024_94595_95746 | 382 |
| 206 | 3300047443 | Ga0495687_000002 | Ga0495687_000002_693467_694615 | 382 |
| 207 | 3300047443 | Ga0495687_004288 | Ga0495687_004288_3521_4669 | 382 |
| 208 | 3300047445 | Ga0495677_0000175 | Ga0495677_0000175_3966_5117 | 382 |
| 209 | 3300047470 | Ga0495681_0014006 | Ga0495681_0014006_3071_4222 | 382 |
| 210 | 3300047472 | Ga0495686_0020745 | Ga0495686_0020745_1843_2994 | 382 |
| 211 | 3300048091 | Ga0495626_0003308 | Ga0495626_0003308_4326_5477 | 382 |
| 212 | 3300048091 | Ga0495626_0003661 | Ga0495626_0003661_5564_6715 | 382 |
| 213 | 3300048904 | Ga0496101_0031465 | Ga0496101_0031465_1197_2345 | 382 |
| 214 | 3300048910 | Ga0496107_0009829 | Ga0496107_0009829_1236_2384 | 382 |
| 215 | 3300048913 | Ga0496110_0007662 | Ga0496110_0007662_2810_3958 | 382 |
| 216 | 3300048914 | Ga0496111_0004425 | Ga0496111_0004425_4301_5449 | 382 |
| 217 | 3300048915 | Ga0496112_0156255 | Ga0496112_0156255_309_1457 | 382 |
| 218 | 3300048916 | Ga0496113_0061841 | Ga0496113_0061841_1186_2334 | 382 |
| 219 | 3300048925 | Ga0496122_0000263 | Ga0496122_0000263_78908_80056 | 382 |
| 220 | 3300048926 | Ga0496123_0000156 | Ga0496123_0000156_63097_64245 | 382 |
| 221 | 3300048928 | Ga0496125_0000669 | Ga0496125_0000669_18105_19253 | 382 |
| 222 | 3300049459 | Ga0495678_000024 | Ga0495678_000024_34500_35651 | 382 |
| 223 | 3300049460 | Ga0495682_0010781 | Ga0495682_0010781_2040_3191 | 382 |
| 224 | 3300003322 | rootL2_10005136 | rootL2_100051363 | 383 |
| 225 | 3300003322 | rootL2_10005137 | rootL2_100051374 | 383 |
| 226 | 3300003763 | Ga0055529_1000515 | Ga0055529_10005155 | 383 |
| 227 | 3300025272 | Ga0209455_1000026 | Ga0209455_1000026195 | 383 |
| 228 | 3300046463 | Ga0495653_0006122 | Ga0495653_0006122_4743_5918 | 383 |
| 229 | 3300046463 | Ga0495653_0018344 | Ga0495653_0018344_644_1807 | 383 |
| 230 | 3300046491 | Ga0495584_0009673 | Ga0495584_0009673_3388_4548 | 383 |
| 231 | 3300046500 | Ga0495596_0011993 | Ga0495596_0011993_2077_3237 | 383 |
| 232 | 3300046501 | Ga0495607_0002706 | Ga0495607_0002706_5151_6311 | 383 |
| 233 | 3300046506 | Ga0495583_0000060 | Ga0495583_0000060_86074_87234 | 383 |
| 234 | 3300046507 | Ga0495606_0000058 | Ga0495606_0000058_94658_95818 | 383 |
| 235 | 3300046513 | Ga0495616_0008503 | Ga0495616_0008503_1500_2660 | 383 |
| 236 | 3300046518 | Ga0495631_0001299 | Ga0495631_0001299_11662_12822 | 383 |
| 237 | 3300046519 | Ga0495632_0001315 | Ga0495632_0001315_10371_11531 | 383 |
| 238 | 3300046522 | Ga0495643_0011506 | Ga0495643_0011506_717_1877 | 383 |
| 239 | 3300046523 | Ga0495644_0008860 | Ga0495644_0008860_389_1549 | 383 |
| 240 | 3300046528 | Ga0495642_0046896 | Ga0495642_0046896_280_1440 | 383 |
| 241 | 3300046558 | Ga0495633_0032864 | Ga0495633_0032864_598_1758 | 383 |
| 242 | 3300046558 | Ga0495633_0073495 | Ga0495633_0073495_343_1494 | 383 |
| 243 | 3300046679 | Ga0495623_0016865 | Ga0495623_0016865_2262_3425 | 383 |
| 244 | 3300046679 | Ga0495623_0026429 | Ga0495623_0026429_2496_3659 | 383 |
| 245 | 3300046691 | Ga0495670_0057925 | Ga0495670_0057925_316_1476 | 383 |
| 246 | 3300046694 | Ga0495649_0000786 | Ga0495649_0000786_20284_21444 | 383 |
| 247 | 3300046794 | Ga0495589_0009080 | Ga0495589_0009080_457_1617 | 383 |
| 248 | 3300046810 | Ga0495660_0085516 | Ga0495660_0085516_345_1505 | 383 |
| 249 | 3300047315 | Ga0495581_0084063 | Ga0495581_0084063_452_1609 | 383 |
| 250 | 3300047320 | Ga0495672_0008945 | Ga0495672_0008945_5309_6469 | 383 |
| 251 | 3300047321 | Ga0495676_0041864 | Ga0495676_0041864_395_1552 | 383 |
| 252 | 3300047323 | Ga0495683_0006480 | Ga0495683_0006480_4993_6153 | 383 |
| 253 | 3300047444 | Ga0495675_0064618 | Ga0495675_0064618_1127_2290 | 383 |
| 254 | 3300047445 | Ga0495677_0000078 | Ga0495677_0000078_1304_2464 | 383 |
| 255 | 3300047445 | Ga0495677_0015090 | Ga0495677_0015090_637_1797 | 383 |
| 256 | 3300047470 | Ga0495681_0008645 | Ga0495681_0008645_3839_4999 | 383 |
| 257 | 3300049459 | Ga0495678_001772 | Ga0495678_001772_11306_12463 | 383 |
| 258 | 3300049459 | Ga0495678_010078 | Ga0495678_010078_2164_3324 | 383 |
| 259 | 3300005262 | Ga0065165_1000515 | Ga0065165_100051521 | 384 |
| 260 | 3300021361 | Ga0213872_10000087 | Ga0213872_1000008740 | 384 |
| 261 | 3300021361 | Ga0213872_10000157 | Ga0213872_1000015733 | 384 |
| 262 | 3300021361 | Ga0213872_10000518 | Ga0213872_1000051822 | 384 |
| 263 | 3300021361 | Ga0213872_10013864 | Ga0213872_100138643 | 384 |
| 264 | 3300037312 | Ga0395899_0000127 | Ga0395899_0000127_72947_74107 | 384 |
| 265 | 3300037312 | Ga0395899_0082771 | Ga0395899_0082771_771_1928 | 384 |
| 266 | 3300037471 | Ga0395905_0200800 | Ga0395905_0200800_479_1636 | 384 |
| 267 | 3300039447 | Ga0436361_0052289 | Ga0436361_0052289_3694_4866 | 384 |
| 268 | 3300039447 | Ga0436361_0595316 | Ga0436361_0595316_34084_35247 | 384 |
| 269 | 3300039447 | Ga0436361_0998063 | Ga0436361_0998063_15915_17087 | 384 |
| 270 | 3300039447 | Ga0436361_1217285 | Ga0436361_1217285_5364_6527 | 384 |
| 271 | 3300042139 | Ga0450904_000788 | Ga0450904_000788_215_1369 | 384 |
| 272 | 3300044842 | Ga0466957_0017698 | Ga0466957_0017698_1360_2532 | 384 |
| 273 | 3300046452 | Ga0495617_000391 | Ga0495617_000391_3469_4629 | 384 |
| 274 | 3300046459 | Ga0495629_0067568 | Ga0495629_0067568_676_1839 | 384 |
| 275 | 3300046460 | Ga0495638_0030938 | Ga0495638_0030938_2057_3217 | 384 |
| 276 | 3300046471 | Ga0495650_0017993 | Ga0495650_0017993_2358_3515 | 384 |
| 277 | 3300046473 | Ga0495582_0103306 | Ga0495582_0103306_54_1214 | 384 |
| 278 | 3300046474 | Ga0495605_0000035 | Ga0495605_0000035_95093_96250 | 384 |
| 279 | 3300046491 | Ga0495584_0000021 | Ga0495584_0000021_26799_27959 | 384 |
| 280 | 3300046492 | Ga0495585_0000005 | Ga0495585_0000005_245288_246448 | 384 |
| 281 | 3300046492 | Ga0495585_0000049 | Ga0495585_0000049_78087_79247 | 384 |
| 282 | 3300046492 | Ga0495585_0002689 | Ga0495585_0002689_9968_11140 | 384 |
| 283 | 3300046492 | Ga0495585_0041734 | Ga0495585_0041734_1233_2393 | 384 |
| 284 | 3300046492 | Ga0495585_0050474 | Ga0495585_0050474_707_1867 | 384 |
| 285 | 3300046499 | Ga0495594_0005201 | Ga0495594_0005201_2678_3835 | 384 |
| 286 | 3300046500 | Ga0495596_0000013 | Ga0495596_0000013_33131_34291 | 384 |
| 287 | 3300046500 | Ga0495596_0013885 | Ga0495596_0013885_1393_2550 | 384 |
| 288 | 3300046500 | Ga0495596_0046988 | Ga0495596_0046988_511_1683 | 384 |
| 289 | 3300046501 | Ga0495607_0002930 | Ga0495607_0002930_6586_7743 | 384 |
| 290 | 3300046501 | Ga0495607_0007123 | Ga0495607_0007123_3763_4926 | 384 |
| 291 | 3300046501 | Ga0495607_0039934 | Ga0495607_0039934_1141_2298 | 384 |
| 292 | 3300046501 | Ga0495607_0069657 | Ga0495607_0069657_461_1621 | 384 |
| 293 | 3300046506 | Ga0495583_0050961 | Ga0495583_0050961_704_1861 | 384 |
| 294 | 3300046507 | Ga0495606_0000573 | Ga0495606_0000573_13843_15006 | 384 |
| 295 | 3300046507 | Ga0495606_0002184 | Ga0495606_0002184_17560_18720 | 384 |
| 296 | 3300046507 | Ga0495606_0037010 | Ga0495606_0037010_1070_2227 | 384 |
| 297 | 3300046507 | Ga0495606_0038256 | Ga0495606_0038256_576_1736 | 384 |
| 298 | 3300046513 | Ga0495616_0000148 | Ga0495616_0000148_23785_24942 | 384 |
| 299 | 3300046513 | Ga0495616_0000445 | Ga0495616_0000445_2465_3619 | 384 |
| 300 | 3300046513 | Ga0495616_0000736 | Ga0495616_0000736_20084_21244 | 384 |
| 301 | 3300046515 | Ga0495620_0001714 | Ga0495620_0001714_5683_6843 | 384 |
| 302 | 3300046518 | Ga0495631_0006317 | Ga0495631_0006317_1234_2391 | 384 |
| 303 | 3300046518 | Ga0495631_0039858 | Ga0495631_0039858_489_1649 | 384 |
| 304 | 3300046519 | Ga0495632_0001378 | Ga0495632_0001378_12862_14025 | 384 |
| 305 | 3300046519 | Ga0495632_0017538 | Ga0495632_0017538_1292_2452 | 384 |
| 306 | 3300046522 | Ga0495643_0000259 | Ga0495643_0000259_31178_32332 | 384 |
| 307 | 3300046522 | Ga0495643_0000355 | Ga0495643_0000355_36374_37537 | 384 |
| 308 | 3300046523 | Ga0495644_0002399 | Ga0495644_0002399_5722_6879 | 384 |
| 309 | 3300046523 | Ga0495644_0019697 | Ga0495644_0019697_282_1442 | 384 |
| 310 | 3300046524 | Ga0495648_0000033 | Ga0495648_0000033_116373_117533 | 384 |
| 311 | 3300046524 | Ga0495648_0005478 | Ga0495648_0005478_5213_6370 | 384 |
| 312 | 3300046524 | Ga0495648_0032849 | Ga0495648_0032849_24_1181 | 384 |
| 313 | 3300046526 | Ga0495666_0006487 | Ga0495666_0006487_631_1794 | 384 |
| 314 | 3300046526 | Ga0495666_0024584 | Ga0495666_0024584_841_2082 | 384 |
| 315 | 3300046528 | Ga0495642_0000005 | Ga0495642_0000005_57240_58397 | 384 |
| 316 | 3300046528 | Ga0495642_0000674 | Ga0495642_0000674_1362_2519 | 384 |
| 317 | 3300046528 | Ga0495642_0007058 | Ga0495642_0007058_1650_2810 | 384 |
| 318 | 3300046528 | Ga0495642_0011372 | Ga0495642_0011372_651_1811 | 384 |
| 319 | 3300046528 | Ga0495642_0016061 | Ga0495642_0016061_23_1183 | 384 |
| 320 | 3300046528 | Ga0495642_0070954 | Ga0495642_0070954_220_1374 | 384 |
| 321 | 3300046529 | Ga0495652_0042000 | Ga0495652_0042000_422_1585 | 384 |
| 322 | 3300046530 | Ga0495654_0022711 | Ga0495654_0022711_1989_3146 | 384 |
| 323 | 3300046530 | Ga0495654_0073411 | Ga0495654_0073411_393_1550 | 384 |
| 324 | 3300046531 | Ga0495665_0026254 | Ga0495665_0026254_679_1842 | 384 |
| 325 | 3300046535 | Ga0495586_0029285 | Ga0495586_0029285_740_1903 | 384 |
| 326 | 3300046535 | Ga0495586_0077600 | Ga0495586_0077600_212_1372 | 384 |
| 327 | 3300046538 | Ga0495609_0000852 | Ga0495609_0000852_11228_12385 | 384 |
| 328 | 3300046538 | Ga0495609_0004053 | Ga0495609_0004053_6618_7775 | 384 |
| 329 | 3300046538 | Ga0495609_0019400 | Ga0495609_0019400_1187_2344 | 384 |
| 330 | 3300046542 | Ga0495597_0004469 | Ga0495597_0004469_5653_6813 | 384 |
| 331 | 3300046542 | Ga0495597_0007499 | Ga0495597_0007499_1155_2315 | 384 |
| 332 | 3300046542 | Ga0495597_0013640 | Ga0495597_0013640_2172_3332 | 384 |
| 333 | 3300046557 | Ga0495622_0014984 | Ga0495622_0014984_1317_2480 | 384 |
| 334 | 3300046557 | Ga0495622_0072092 | Ga0495622_0072092_214_1377 | 384 |
| 335 | 3300046558 | Ga0495633_0006484 | Ga0495633_0006484_4005_5165 | 384 |
| 336 | 3300046558 | Ga0495633_0069069 | Ga0495633_0069069_464_1621 | 384 |
| 337 | 3300046615 | Ga0495656_0001955 | Ga0495656_0001955_2832_3992 | 384 |
| 338 | 3300046616 | Ga0495668_0000845 | Ga0495668_0000845_29682_30839 | 384 |
| 339 | 3300046616 | Ga0495668_0001020 | Ga0495668_0001020_25217_26374 | 384 |
| 340 | 3300046616 | Ga0495668_0034493 | Ga0495668_0034493_662_1822 | 384 |
| 341 | 3300046642 | Ga0495634_0077196 | Ga0495634_0077196_319_1482 | 384 |
| 342 | 3300046648 | Ga0495611_0015671 | Ga0495611_0015671_913_2073 | 384 |
| 343 | 3300046648 | Ga0495611_0018245 | Ga0495611_0018245_931_2088 | 384 |
| 344 | 3300046648 | Ga0495611_0018799 | Ga0495611_0018799_933_2093 | 384 |
| 345 | 3300046648 | Ga0495611_0028082 | Ga0495611_0028082_181_1341 | 384 |
| 346 | 3300046660 | Ga0495625_0059907 | Ga0495625_0059907_470_1630 | 384 |
| 347 | 3300046665 | Ga0495661_0001021 | Ga0495661_0001021_22372_23529 | 384 |
| 348 | 3300046665 | Ga0495661_0001202 | Ga0495661_0001202_12603_13766 | 384 |
| 349 | 3300046665 | Ga0495661_0015623 | Ga0495661_0015623_3794_4954 | 384 |
| 350 | 3300046665 | Ga0495661_0017366 | Ga0495661_0017366_2902_4062 | 384 |
| 351 | 3300046665 | Ga0495661_0021871 | Ga0495661_0021871_1327_2499 | 384 |
| 352 | 3300046665 | Ga0495661_0054407 | Ga0495661_0054407_105_1265 | 384 |
| 353 | 3300046665 | Ga0495661_0059652 | Ga0495661_0059652_953_2107 | 384 |
| 354 | 3300046674 | Ga0495588_0016740 | Ga0495588_0016740_1414_2571 | 384 |
| 355 | 3300046674 | Ga0495588_0059817 | Ga0495588_0059817_302_1459 | 384 |
| 356 | 3300046684 | Ga0495669_0001405 | Ga0495669_0001405_3463_4620 | 384 |
| 357 | 3300046684 | Ga0495669_0013571 | Ga0495669_0013571_2015_3172 | 384 |
| 358 | 3300046690 | Ga0495624_0015899 | Ga0495624_0015899_2559_3722 | 384 |
| 359 | 3300046691 | Ga0495670_0013965 | Ga0495670_0013965_2156_3316 | 384 |
| 360 | 3300046691 | Ga0495670_0033223 | Ga0495670_0033223_1353_2513 | 384 |
| 361 | 3300046692 | Ga0495671_0013758 | Ga0495671_0013758_1006_2166 | 384 |
| 362 | 3300046694 | Ga0495649_0071570 | Ga0495649_0071570_208_1365 | 384 |
| 363 | 3300046794 | Ga0495589_0007228 | Ga0495589_0007228_1976_3133 | 384 |
| 364 | 3300046794 | Ga0495589_0013030 | Ga0495589_0013030_2956_4116 | 384 |
| 365 | 3300046794 | Ga0495589_0042200 | Ga0495589_0042200_490_1650 | 384 |
| 366 | 3300046794 | Ga0495589_0088618 | Ga0495589_0088618_280_1437 | 384 |
| 367 | 3300046809 | Ga0495600_0019527 | Ga0495600_0019527_2029_3192 | 384 |
| 368 | 3300046810 | Ga0495660_0010944 | Ga0495660_0010944_3555_4712 | 384 |
| 369 | 3300046810 | Ga0495660_0124785 | Ga0495660_0124785_11_1171 | 384 |
| 370 | 3300047315 | Ga0495581_0093165 | Ga0495581_0093165_344_1507 | 384 |
| 371 | 3300047317 | Ga0495604_0153516 | Ga0495604_0153516_236_1399 | 384 |
| 372 | 3300047318 | Ga0495636_0055252 | Ga0495636_0055252_490_1650 | 384 |
| 373 | 3300047319 | Ga0495674_0010498 | Ga0495674_0010498_7501_8661 | 384 |
| 374 | 3300047321 | Ga0495676_0082551 | Ga0495676_0082551_1118_2278 | 384 |
| 375 | 3300047323 | Ga0495683_0023729 | Ga0495683_0023729_1293_2453 | 384 |
| 376 | 3300047445 | Ga0495677_0007166 | Ga0495677_0007166_2498_3661 | 384 |
| 377 | 3300047445 | Ga0495677_0008807 | Ga0495677_0008807_1816_2976 | 384 |
| 378 | 3300047445 | Ga0495677_0025761 | Ga0495677_0025761_522_1682 | 384 |
| 379 | 3300047447 | Ga0495685_002111 | Ga0495685_002111_3788_4945 | 384 |
| 380 | 3300047470 | Ga0495681_0000021 | Ga0495681_0000021_26654_27811 | 384 |
| 381 | 3300047470 | Ga0495681_0034064 | Ga0495681_0034064_406_1566 | 384 |
| 382 | 3300047470 | Ga0495681_0076080 | Ga0495681_0076080_195_1355 | 384 |
| 383 | 3300047472 | Ga0495686_0000062 | Ga0495686_0000062_226356_227516 | 384 |
| 384 | 3300047472 | Ga0495686_0000357 | Ga0495686_0000357_38043_39215 | 384 |
| 385 | 3300047673 | Ga0495593_0035360 | Ga0495593_0035360_375_1538 | 384 |
| 386 | 3300048088 | Ga0495602_0054483 | Ga0495602_0054483_2351_3514 | 384 |
| 387 | 3300048091 | Ga0495626_0003734 | Ga0495626_0003734_865_2067 | 384 |
| 388 | 3300048091 | Ga0495626_0004849 | Ga0495626_0004849_4276_5430 | 384 |
| 389 | 3300048091 | Ga0495626_0020912 | Ga0495626_0020912_48_1208 | 384 |
| 390 | 3300048091 | Ga0495626_0025239 | Ga0495626_0025239_1734_2897 | 384 |
| 391 | 3300048091 | Ga0495626_0025465 | Ga0495626_0025465_1421_2578 | 384 |
| 392 | 3300048091 | Ga0495626_0025787 | Ga0495626_0025787_483_1655 | 384 |
| 393 | 3300048091 | Ga0495626_0029847 | Ga0495626_0029847_326_1480 | 384 |
| 394 | 3300048905 | Ga0496102_0000952 | Ga0496102_0000952_711_1868 | 384 |
| 395 | 3300048905 | Ga0496102_0081325 | Ga0496102_0081325_373_1530 | 384 |
| 396 | 3300048906 | Ga0496103_0060431 | Ga0496103_0060431_1157_2314 | 384 |
| 397 | 3300048906 | Ga0496103_0134014 | Ga0496103_0134014_95_1252 | 384 |
| 398 | 3300048908 | Ga0496105_0068629 | Ga0496105_0068629_1338_2495 | 384 |
| 399 | 3300048912 | Ga0496109_0216274 | Ga0496109_0216274_618_1775 | 384 |
| 400 | 3300048913 | Ga0496110_0000016 | Ga0496110_0000016_44309_45472 | 384 |
| 401 | 3300048918 | Ga0496115_0038438 | Ga0496115_0038438_1846_3006 | 384 |
| 402 | 3300049460 | Ga0495682_0003279 | Ga0495682_0003279_5772_6944 | 384 |
| 403 | 3300049460 | Ga0495682_0010960 | Ga0495682_0010960_972_2129 | 384 |
| 404 | 3300049460 | Ga0495682_0016041 | Ga0495682_0016041_1000_2160 | 384 |
| 405 | 3300046471 | Ga0495650_0000317 | Ga0495650_0000317_20989_22158 | 385 |
| 406 | 3300046474 | Ga0495605_0007848 | Ga0495605_0007848_3938_5104 | 385 |
| 407 | 3300046507 | Ga0495606_0000066 | Ga0495606_0000066_149797_150966 | 385 |
| 408 | 3300046528 | Ga0495642_0043778 | Ga0495642_0043778_502_1671 | 385 |
| 409 | 3300046810 | Ga0495660_0043845 | Ga0495660_0043845_1139_2323 | 385 |
| 410 | 3300047320 | Ga0495672_0000005 | Ga0495672_0000005_436202_437386 | 385 |
| 411 | 3300047472 | Ga0495686_0068779 | Ga0495686_0068779_466_1650 | 385 |
| 412 | 3300048927 | Ga0496124_0011177 | Ga0496124_0011177_1320_2483 | 385 |
| 413 | iso_pu_bacteria | 2643221556 | 2643799967 | 385 |
| 414 | iso_pu_bacteria | 2643221684 | 2644474968 | 385 |
| 415 | iso_pu_bacteria | 8047673197 | 8047673479 | 385 |
| 416 | 3300025933 | Ga0207706_10188792 | Ga0207706_101887922 | 386 |
| 417 | 3300026142 | Ga0207698_10064417 | Ga0207698_100644174 | 386 |
| 418 | 3300042008 | Ga0439450_002496 | Ga0439450_002496_507_1709 | 386 |
| 419 | 3300005327 | Ga0070658_10059124 | Ga0070658_100591244 | 387 |
| 420 | 3300005563 | Ga0068855_100043778 | Ga0068855_1000437785 | 387 |
| 421 | 3300009174 | Ga0105241_10040325 | Ga0105241_100403252 | 387 |
| 422 | 3300025909 | Ga0207705_10004043 | Ga0207705_100040435 | 387 |
| 423 | 3300025911 | Ga0207654_10005595 | Ga0207654_100055955 | 387 |
| 424 | 3300025949 | Ga0207667_10007077 | Ga0207667_100070775 | 387 |
| 425 | 3300049571 | Ga0501034_0119438 | Ga0501034_0119438_1124_2287 | 387 |
| 426 | 3300046557 | Ga0495622_0000155 | Ga0495622_0000155_15809_17059 | 388 |
| 427 | 3300048927 | Ga0496124_0015139 | Ga0496124_0015139_4110_5276 | 388 |
| 428 | 3300003322 | rootL2_10004116 | rootL2_100041162 | 389 |
| 429 | 3300003322 | rootL2_10141073 | rootL2_101410732 | 389 |
| 430 | 3300003759 | Ga0055525_1000001 | Ga0055525_1000001701 | 389 |
| 431 | 3300005327 | Ga0070658_10082666 | Ga0070658_100826661 | 389 |
| 432 | 3300005339 | Ga0070660_100150125 | Ga0070660_1001501252 | 389 |
| 433 | 3300005344 | Ga0070661_100042283 | Ga0070661_1000422832 | 389 |
| 434 | 3300005366 | Ga0070659_100015104 | Ga0070659_1000151042 | 389 |
| 435 | 3300005366 | Ga0070659_100132558 | Ga0070659_1001325582 | 389 |
| 436 | 3300005563 | Ga0068855_100318833 | Ga0068855_1003188331 | 389 |
| 437 | 3300005564 | Ga0070664_100089318 | Ga0070664_1000893182 | 389 |
| 438 | 3300006237 | Ga0097621_100160574 | Ga0097621_1001605743 | 389 |
| 439 | 3300006881 | Ga0068865_100120341 | Ga0068865_1001203412 | 389 |
| 440 | 3300009148 | Ga0105243_10022079 | Ga0105243_100220792 | 389 |
| 441 | 3300013307 | Ga0157372_10432848 | Ga0157372_104328482 | 389 |
| 442 | 3300025230 | Ga0209563_100007 | Ga0209563_100007397 | 389 |
| 443 | 3300025254 | Ga0209148_1001036 | Ga0209148_100103610 | 389 |
| 444 | 3300025909 | Ga0207705_10093682 | Ga0207705_100936822 | 389 |
| 445 | 3300025919 | Ga0207657_10004452 | Ga0207657_100044523 | 389 |
| 446 | 3300025919 | Ga0207657_10107214 | Ga0207657_101072142 | 389 |
| 447 | 3300025927 | Ga0207687_10020985 | Ga0207687_100209854 | 389 |
| 448 | 3300025932 | Ga0207690_10025996 | Ga0207690_100259962 | 389 |
| 449 | 3300025932 | Ga0207690_10154725 | Ga0207690_101547252 | 389 |
| 450 | 3300025933 | Ga0207706_10187893 | Ga0207706_101878931 | 389 |
| 451 | 3300025934 | Ga0207686_10003111 | Ga0207686_100031111 | 389 |
| 452 | 3300025935 | Ga0207709_10030286 | Ga0207709_100302862 | 389 |
| 453 | 3300025938 | Ga0207704_10089829 | Ga0207704_100898292 | 389 |
| 454 | 3300025945 | Ga0207679_10126530 | Ga0207679_101265301 | 389 |
| 455 | 3300037312 | Ga0395899_0069941 | Ga0395899_0069941_418_1587 | 389 |
| 456 | 3300037418 | Ga0395900_0000489 | Ga0395900_0000489_28335_29504 | 389 |
| 457 | 3300037418 | Ga0395900_0057172 | Ga0395900_0057172_2427_3596 | 389 |
| 458 | 3300037418 | Ga0395900_0094071 | Ga0395900_0094071_253_1422 | 389 |
| 459 | 3300037466 | Ga0395898_0072917 | Ga0395898_0072917_1788_2957 | 389 |
| 460 | 3300037471 | Ga0395905_0033711 | Ga0395905_0033711_797_1966 | 389 |
| 461 | 3300037471 | Ga0395905_0084134 | Ga0395905_0084134_1669_2838 | 389 |
| 462 | 3300037471 | Ga0395905_0137329 | Ga0395905_0137329_643_1812 | 389 |
| 463 | 3300038443 | Ga0395901_0000033 | Ga0395901_0000033_116473_117642 | 389 |
| 464 | 3300038443 | Ga0395901_0005206 | Ga0395901_0005206_8214_9383 | 389 |
| 465 | 3300042005 | Ga0439448_0002394 | Ga0439448_0002394_1505_2674 | 389 |
| 466 | 3300042005 | Ga0439448_0026739 | Ga0439448_0026739_385_1554 | 389 |
| 467 | 3300042012 | Ga0439455_0003235 | Ga0439455_0003235_1420_2589 | 389 |
| 468 | 3300042012 | Ga0439455_0013859 | Ga0439455_0013859_287_1456 | 389 |
| 469 | 3300042157 | Ga0439458_0009764 | Ga0439458_0009764_92_1261 | 389 |
| 470 | 3300044658 | Ga0466972_0004344 | Ga0466972_0004344_4194_5363 | 389 |
| 471 | 3300044683 | Ga0466965_0007515 | Ga0466965_0007515_519_1688 | 389 |
| 472 | 3300044683 | Ga0466965_0026405 | Ga0466965_0026405_519_1688 | 389 |
| 473 | 3300044683 | Ga0466965_0029064 | Ga0466965_0029064_792_1961 | 389 |
| 474 | 3300044684 | Ga0466966_0055201 | Ga0466966_0055201_922_2091 | 389 |
| 475 | 3300044684 | Ga0466966_0110746 | Ga0466966_0110746_311_1480 | 389 |
| 476 | 3300044706 | Ga0466964_0000168 | Ga0466964_0000168_10930_12099 | 389 |
| 477 | 3300044706 | Ga0466964_0021185 | Ga0466964_0021185_1333_2502 | 389 |
| 478 | 3300044735 | Ga0466968_0008645 | Ga0466968_0008645_1346_2515 | 389 |
| 479 | 3300044842 | Ga0466957_0031094 | Ga0466957_0031094_1456_2625 | 389 |
| 480 | 3300044842 | Ga0466957_0045291 | Ga0466957_0045291_809_1978 | 389 |
| 481 | 3300044842 | Ga0466957_0085266 | Ga0466957_0085266_668_1837 | 389 |
| 482 | 3300045976 | Ga0466967_0024222 | Ga0466967_0024222_1453_2622 | 389 |
| 483 | 3300045976 | Ga0466967_0032225 | Ga0466967_0032225_873_2042 | 389 |
| 484 | 3300045976 | Ga0466967_0106575 | Ga0466967_0106575_513_1682 | 389 |
| 485 | 3300046474 | Ga0495605_0011465 | Ga0495605_0011465_424_1593 | 389 |
| 486 | 3300046491 | Ga0495584_0000159 | Ga0495584_0000159_18143_19312 | 389 |
| 487 | 3300046491 | Ga0495584_0007256 | Ga0495584_0007256_2420_3589 | 389 |
| 488 | 3300046507 | Ga0495606_0016553 | Ga0495606_0016553_2147_3316 | 389 |
| 489 | 3300046513 | Ga0495616_0000881 | Ga0495616_0000881_6137_7306 | 389 |
| 490 | 3300046528 | Ga0495642_0001445 | Ga0495642_0001445_7197_8366 | 389 |
| 491 | 3300046538 | Ga0495609_0000039 | Ga0495609_0000039_17592_18761 | 389 |
| 492 | 3300046665 | Ga0495661_0000295 | Ga0495661_0000295_37795_38964 | 389 |
| 493 | 3300046674 | Ga0495588_0000055 | Ga0495588_0000055_225803_226972 | 389 |
| 494 | 3300046694 | Ga0495649_0073614 | Ga0495649_0073614_65_1234 | 389 |
| 495 | 3300046794 | Ga0495589_0000097 | Ga0495589_0000097_65277_66446 | 389 |
| 496 | 3300047443 | Ga0495687_000059 | Ga0495687_000059_17592_18761 | 389 |
| 497 | 3300047443 | Ga0495687_001538 | Ga0495687_001538_11089_12258 | 389 |
| 498 | 3300047445 | Ga0495677_0000006 | Ga0495677_0000006_180470_181639 | 389 |
| 499 | 3300047445 | Ga0495677_0024129 | Ga0495677_0024129_721_1890 | 389 |
| 500 | 3300048091 | Ga0495626_0000121 | Ga0495626_0000121_36010_37179 | 389 |
| 501 | 3300048905 | Ga0496102_0041205 | Ga0496102_0041205_914_2083 | 389 |
| 502 | 3300048905 | Ga0496102_0123275 | Ga0496102_0123275_16_1185 | 389 |
| 503 | 3300048909 | Ga0496106_0003119 | Ga0496106_0003119_11053_12222 | 389 |
| 504 | 3300048916 | Ga0496113_0017627 | Ga0496113_0017627_1187_2356 | 389 |
| 505 | 3300048916 | Ga0496113_0153724 | Ga0496113_0153724_245_1414 | 389 |
| 506 | 3300048925 | Ga0496122_0001691 | Ga0496122_0001691_6567_7736 | 389 |
| 507 | 3300049822 | Ga0501035_0000687 | Ga0501035_0000687_9605_10774 | 389 |
| 508 | 3300049823 | Ga0501044_0137482 | Ga0501044_0137482_478_1647 | 389 |
| 509 | 3300061719 | Ga0466962_0038991 | Ga0466962_0038991_811_1980 | 389 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wml-assembly1.cif.gz_B | arabidopsis thaliana prephenate aminotransferase mutant- k306a | 0.9457 | 2 | 379 |
| 5wmk-assembly1.cif.gz_A-2 | arabidopsis thaliana prephenate aminotransferase double mutant- t84v k169v | 0.945 | 2 | 379 |
| 8wou-assembly1.cif.gz_B | the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila | 0.9356 | 1 | 376 |
| 8wkj-assembly1.cif.gz_A-2 | the crystal structure of aspartate aminotransferases lpg0070 from legionella pneumophila | 0.9332 | 1 | 377 |
| 5wmi-assembly1.cif.gz_A-2 | arabidopsis thaliana prephenate aminotransferase mutant- t84v | 0.9287 | 1 | 379 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o4sA01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9438 | 281 | 375 | 3.90.1150.10 |
| 1j32B01 | Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 | 0.9356 | 282 | 375 | 3.90.1150.10 |
| 1gd9A02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9333 | 63 | 277 | 3.40.640.10 |
| 6f77C02 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9332 | 63 | 276 | 3.40.640.10 |
| af_A0A0R0HS10_77_301_3.40.640.10 | Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) | 0.9314 | 61 | 277 | 3.40.640.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A523Y6P3-F1-model_v4 | Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme | 0.9644 | 282 | 380 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A2E3WVM9-F1-model_v4 | Aminotransferase (EC 2.6.1.-) | 0.9433 | 2 | 379 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A097IUX3-F1-model_v4 | Aspartate aminotransferase | 0.943 | 2 | 378 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A7V8E587-F1-model_v4 | Aminotransferase (EC 2.6.1.-) | 0.9426 | 3 | 379 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
| AF-A0A3C0ZJM0-F1-model_v4 | Aminotransferase (EC 2.6.1.-) | 0.9418 | 26 | 380 |
GO:0006520
GO:0008483 GO:0009058 GO:0030170 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar