F457010

General Info

Members Datasets Scaffolds Average Seq Length
509 219 1018 167

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0099851|Ga0395899_0099851_892_1452
Length 186
Sequence MKLSYLIKGLPGHPLHPPLTDATIGIYTGASVFGVLSAFGVSESNTATAWWLALILGLIVTGPTALTGFIDWLGITWGTPLWRTASFHPLSMLTATVFFLLSAIFGHGGYVDNEVTGGSLALTLIGFVFLTLGGWLGGTVVFVHGMRVLNLVEEPALRAAAPVPTAEKEAAAGERPPSEEQRRGSV

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
94 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
112 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
115 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
118 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
122 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
125 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
126 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
131 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
132 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
136 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
140 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
151 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
152 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
198 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.04
Metatranscriptomes 1.96
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.47
Rhizosphere 92.34
Stem 0
Stem Tuber 0
Unclassified 7.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0099851 3300037312 Bacteria 2096
2 JGI25406J46586_10035509 3300003203 Unclassified 1819
3 JGI25407J50210_10010018 3300003373 Bacteria 2408
4 Ga0070683_100037221 3300005329 Bacteria 4454
5 Ga0070683_100689996 3300005329 Bacteria 978
6 Ga0068868_100015386 3300005338 Bacteria 5656
7 Ga0070660_100084579 3300005339 Bacteria 2494
8 Ga0070660_100353222 3300005339 Bacteria 1211
9 Ga0070689_101005631 3300005340 Bacteria 742
10 Ga0070691_10017970 3300005341 Bacteria 3256
11 Ga0070671_100036854 3300005355 Bacteria 4055
12 Ga0070674_100205413 3300005356 Bacteria 1524
13 Ga0070673_100103109 3300005364 Bacteria 2353
14 Ga0070673_100505110 3300005364 Unclassified 1094
15 Ga0070673_101253305 3300005364 Bacteria 696
16 Ga0070659_100345443 3300005366 Unclassified 1247
17 Ga0070714_100091088 3300005435 Bacteria 2671
18 Ga0070714_100276921 3300005435 Bacteria 1558
19 Ga0070710_10962638 3300005437 Bacteria 620
20 Ga0070662_100183988 3300005457 Bacteria 1649
21 Ga0070662_100722228 3300005457 Unclassified 844
22 Ga0070685_10414444 3300005466 Bacteria 936
23 Ga0070707_100177503 3300005468 Unclassified 2076
24 Ga0070707_100303715 3300005468 Bacteria 1551
25 Ga0070698_100489808 3300005471 Bacteria 1167
26 Ga0070699_100299592 3300005518 Bacteria 1442
27 Ga0070684_100079288 3300005535 Bacteria 2903
28 Ga0070684_100680361 3300005535 Bacteria 959
29 Ga0070697_100813085 3300005536 Bacteria 827
30 Ga0070695_100206586 3300005545 Unclassified 1407
31 Ga0068855_100267856 3300005563 Bacteria 1900
32 Ga0068855_100345921 3300005563 Bacteria 1639
33 Ga0068857_100866678 3300005577 Bacteria 865
34 Ga0068854_100546762 3300005578 Bacteria 982
35 Ga0068856_101145261 3300005614 Bacteria 795
36 Ga0081455_10028265 3300005937 Bacteria 5126
37 Ga0081455_10186520 3300005937 Bacteria 1566
38 Ga0081538_10002571 3300005981 Bacteria 17618
39 Ga0081539_10000599 3300005985 Bacteria 73432
40 Ga0081539_10002641 3300005985 Bacteria 24476
41 Ga0081539_10004046 3300005985 Bacteria 16803
42 Ga0070717_10187612 3300006028 Bacteria 1805
43 Ga0070717_10822606 3300006028 Bacteria 845
44 Ga0070712_100056453 3300006175 Bacteria 2754
45 Ga0075428_100839403 3300006844 Bacteria 976
46 Ga0075430_100099406 3300006846 Bacteria 2430
47 Ga0075431_100036605 3300006847 Bacteria 5054
48 Ga0075433_10007855 3300006852 Bacteria 8482
49 Ga0075433_10553464 3300006852 Bacteria 1011
50 Ga0075434_100024229 3300006871 Bacteria 5931
51 Ga0075434_100024298 3300006871 Bacteria 5924
52 Ga0075434_100128507 3300006871 Bacteria 2551
53 Ga0075429_100031626 3300006880 Bacteria 4599
54 Ga0075436_100004405 3300006914 Bacteria 9671
55 Ga0075436_100018008 3300006914 Bacteria 4837
56 Ga0075435_100019341 3300007076 Bacteria 5200
57 Ga0075435_100039454 3300007076 Bacteria 3768
58 Ga0075435_100039985 3300007076 Bacteria 3744
59 Ga0099794_10529606 3300007265 Unclassified 621
60 Ga0105240_10063966 3300009093 Bacteria 4573
61 Ga0111539_10018517 3300009094 Bacteria 8626
62 Ga0111539_10090268 3300009094 Bacteria 3600
63 Ga0111539_10289339 3300009094 Bacteria 1906
64 Ga0111539_10319060 3300009094 Bacteria 1808
65 Ga0111539_10464151 3300009094 Bacteria 1474
66 Ga0105245_10002728 3300009098 Bacteria 15889
67 Ga0105245_10043266 3300009098 Bacteria 4017
68 Ga0114129_10067892 3300009147 Bacteria 4972
69 Ga0114129_10071069 3300009147 Bacteria 4853
70 Ga0114129_10136629 3300009147 Bacteria 3363
71 Ga0114129_10284493 3300009147 Bacteria 2208
72 Ga0114129_10518049 3300009147 Bacteria 1555
73 Ga0105243_10074993 3300009148 Bacteria 2745
74 Ga0105242_10400112 3300009176 Unclassified 1281
75 Ga0105248_10246582 3300009177 Bacteria 2011
76 Ga0105238_12848018 3300009551 Archaea 520
77 Ga0105249_10020928 3300009553 Bacteria 5850
78 Ga0105249_10221584 3300009553 Bacteria 1861
79 Ga0105239_10045318 3300010375 Bacteria 4820
80 Ga0157370_10029510 3300013104 Bacteria 5379
81 Ga0157378_11097002 3300013297 Bacteria 833
82 Ga0163162_12746859 3300013306 Bacteria 567
83 Ga0157372_10068402 3300013307 Bacteria 3993
84 Ga0157380_10037316 3300014326 Bacteria 3765
85 Ga0182008_10098409 3300014497 Bacteria 1444
86 Ga0182008_10253332 3300014497 Bacteria 909
87 Ga0182008_10260796 3300014497 Bacteria 896
88 Ga0157376_10155419 3300014969 Bacteria 2068
89 Ga0206356_10794617 3300020070 Bacteria 591
90 Ga0206350_11205335 3300020080 Unclassified 1067
91 Ga0206353_10781369 3300020082 Bacteria 1593
92 Ga0224712_10200533 3300022467 Bacteria 907
93 Ga0224712_10388873 3300022467 Unclassified 664
94 Ga0207692_10612800 3300025898 Bacteria 701
95 Ga0207688_10111696 3300025901 Bacteria 1587
96 Ga0207699_10003006 3300025906 Bacteria 8016
97 Ga0207693_10012894 3300025915 Bacteria 6745
98 Ga0207693_10192525 3300025915 Bacteria 1605
99 Ga0207663_10294094 3300025916 Bacteria 1211
100 Ga0207657_10122147 3300025919 Bacteria 2142
101 Ga0207657_10302977 3300025919 Bacteria 1266
102 Ga0207652_10775428 3300025921 Bacteria 852
103 Ga0207652_10800936 3300025921 Unclassified 837
104 Ga0207646_10167231 3300025922 Bacteria 1985
105 Ga0207646_10331276 3300025922 Bacteria 1375
106 Ga0207646_10364737 3300025922 Bacteria 1305
107 Ga0207646_10824768 3300025922 Bacteria 825
108 Ga0207681_10659777 3300025923 Bacteria 868
109 Ga0207687_10006730 3300025927 Bacteria 7579
110 Ga0207687_10182963 3300025927 Bacteria 1625
111 Ga0207687_10221591 3300025927 Bacteria 1490
112 Ga0207700_10000002 3300025928 Bacteria 775978
113 Ga0207700_10883993 3300025928 Bacteria 799
114 Ga0207664_10067680 3300025929 Bacteria 2867
115 Ga0207664_10133371 3300025929 Bacteria 2093
116 Ga0207664_10211284 3300025929 Bacteria 1679
117 Ga0207644_10191478 3300025931 Bacteria 1608
118 Ga0207706_10055832 3300025933 Bacteria 3482
119 Ga0207706_10267419 3300025933 Bacteria 1492
120 Ga0207670_11430284 3300025936 Bacteria 587
121 Ga0207669_10424606 3300025937 Bacteria 1047
122 Ga0207691_11042120 3300025940 Bacteria 682
123 Ga0207711_10511092 3300025941 Bacteria 1120
124 Ga0207661_10405963 3300025944 Bacteria 1236
125 Ga0207661_11063992 3300025944 Bacteria 745
126 Ga0207679_10415547 3300025945 Bacteria 1186
127 Ga0207667_10114235 3300025949 Bacteria 2783
128 Ga0207667_10123143 3300025949 Bacteria 2672
129 Ga0207651_10853995 3300025960 Unclassified 809
130 Ga0207712_10015440 3300025961 Bacteria 4928
131 Ga0207668_10027893 3300025972 Bacteria 3685
132 Ga0207677_11072778 3300026023 Bacteria 733
133 Ga0207639_10396170 3300026041 Bacteria 1243
134 Ga0207678_10419072 3300026067 Bacteria 1161
135 Ga0207678_10710362 3300026067 Bacteria 885
136 Ga0207708_10105294 3300026075 Bacteria 2186
137 Ga0207702_10348010 3300026078 Bacteria 1417
138 Ga0207702_11029964 3300026078 Bacteria 817
139 Ga0207702_11657158 3300026078 Bacteria 633
140 Ga0207675_100161511 3300026118 Bacteria 2137
141 Ga0207675_100243629 3300026118 Bacteria 1738
142 Ga0207428_10379217 3300027907 Bacteria 1037
143 Ga0307408_100141444 3300031548 Bacteria 1889
144 Ga0307405_10392281 3300031731 Bacteria 1084
145 Ga0307405_10623566 3300031731 Unclassified 883
146 Ga0307410_10429643 3300031852 Bacteria 1073
147 Ga0307406_10253178 3300031901 Unclassified 1328
148 Ga0307406_10360072 3300031901 Bacteria 1140
149 Ga0307406_10670453 3300031901 Bacteria 863
150 Ga0307407_10692631 3300031903 Unclassified 767
151 Ga0307407_10959918 3300031903 Bacteria 659
152 Ga0307412_10588952 3300031911 Bacteria 940
153 Ga0307412_11028615 3300031911 Bacteria 729
154 Ga0307409_100030199 3300031995 Bacteria 3891
155 Ga0307409_100148725 3300031995 Bacteria 2030
156 Ga0307416_100017495 3300032002 Bacteria 5020
157 Ga0307416_100031605 3300032002 Bacteria 3988
158 Ga0307416_100238370 3300032002 Bacteria 1760
159 Ga0307416_100330630 3300032002 Bacteria 1531
160 Ga0307416_100494760 3300032002 Bacteria 1286
161 Ga0307416_101179687 3300032002 Archaea 871
162 Ga0307415_100034892 3300032126 Bacteria 3280
163 Ga0307415_100336500 3300032126 Unclassified 1265
164 Ga0307415_100493770 3300032126 Bacteria 1068
165 Ga0373926_0310516 3300035083 Bacteria 616
166 Ga0373945_0003705 3300035116 Bacteria 4819
167 Ga0373943_0004489 3300035170 Bacteria 6313
168 Ga0373947_0013047 3300035725 Bacteria 4764
169 Ga0373925_0106026 3300037068 Bacteria 2166
170 Ga0395899_0001105 3300037312 Bacteria 24169
171 Ga0395899_0008115 3300037312 Bacteria 8089
172 Ga0395899_0013324 3300037312 Bacteria 6290
173 Ga0395899_0038647 3300037312 Bacteria 3574
174 Ga0395899_0043152 3300037312 Bacteria 3364
175 Ga0395899_0044611 3300037312 Bacteria 3303
176 Ga0395899_0048167 3300037312 Bacteria 3172
177 Ga0395899_0061751 3300037312 Bacteria 2760
178 Ga0395899_0093403 3300037312 Bacteria 2178
179 Ga0395899_0105982 3300037312 Bacteria 2024
180 Ga0395899_0107064 3300037312 Bacteria 2013
181 Ga0395899_0252763 3300037312 Unclassified 1209
182 Ga0395899_0313779 3300037312 Bacteria 1058
183 Ga0395899_0339147 3300037312 Bacteria 1008
184 Ga0395899_0382469 3300037312 Unclassified 935
185 Ga0395899_0394036 3300037312 Unclassified 918
186 Ga0395899_0591968 3300037312 Bacteria 708
187 Ga0395899_0834767 3300037312 Bacteria 567
188 Ga0395900_0001661 3300037418 Bacteria 26033
189 Ga0395900_0003831 3300037418 Bacteria 16073
190 Ga0395900_0003985 3300037418 Bacteria 15767
191 Ga0395900_0004589 3300037418 Bacteria 14581
192 Ga0395900_0008289 3300037418 Bacteria 10697
193 Ga0395900_0011014 3300037418 Bacteria 9243
194 Ga0395900_0018072 3300037418 Bacteria 7197
195 Ga0395900_0018386 3300037418 Bacteria 7128
196 Ga0395900_0026771 3300037418 Bacteria 5902
197 Ga0395900_0029229 3300037418 Bacteria 5653
198 Ga0395900_0029399 3300037418 Bacteria 5638
199 Ga0395900_0065780 3300037418 Bacteria 3724
200 Ga0395900_0083621 3300037418 Bacteria 3279
201 Ga0395900_0110467 3300037418 Bacteria 2824
202 Ga0395900_0260462 3300037418 Bacteria 1732
203 Ga0395900_0274751 3300037418 Bacteria 1679
204 Ga0395900_0277037 3300037418 Unclassified 1671
205 Ga0395900_0713848 3300037418 Bacteria 935
206 Ga0395900_0815872 3300037418 Bacteria 860
207 Ga0395900_1009868 3300037418 Bacteria 751
208 Ga0395898_0002617 3300037466 Bacteria 20930
209 Ga0395898_0003970 3300037466 Bacteria 16287
210 Ga0395898_0004782 3300037466 Bacteria 14738
211 Ga0395898_0006956 3300037466 Bacteria 12021
212 Ga0395898_0015633 3300037466 Bacteria 7779
213 Ga0395898_0020512 3300037466 Bacteria 6712
214 Ga0395898_0028606 3300037466 Bacteria 5584
215 Ga0395898_0029413 3300037466 Bacteria 5503
216 Ga0395898_0050937 3300037466 Bacteria 4050
217 Ga0395898_0065206 3300037466 Bacteria 3531
218 Ga0395898_0073793 3300037466 Bacteria 3296
219 Ga0395898_0088578 3300037466 Bacteria 2979
220 Ga0395898_0093018 3300037466 Bacteria 2899
221 Ga0395898_0102129 3300037466 Bacteria 2753
222 Ga0395898_0118626 3300037466 Bacteria 2535
223 Ga0395898_0152708 3300037466 Bacteria 2209
224 Ga0395898_0162169 3300037466 Bacteria 2138
225 Ga0395898_0180057 3300037466 Bacteria 2020
226 Ga0395898_0233976 3300037466 Bacteria 1752
227 Ga0395898_0255150 3300037466 Bacteria 1672
228 Ga0395898_0347147 3300037466 Bacteria 1415
229 Ga0395898_0425360 3300037466 Bacteria 1265
230 Ga0395898_0759137 3300037466 Bacteria 911
231 Ga0395898_0976505 3300037466 Bacteria 783
232 Ga0395905_0003633 3300037471 Bacteria 16385
233 Ga0395905_0004494 3300037471 Bacteria 14464
234 Ga0395905_0006301 3300037471 Bacteria 11967
235 Ga0395905_0008126 3300037471 Bacteria 10367
236 Ga0395905_0015411 3300037471 Bacteria 7266
237 Ga0395905_0025163 3300037471 Bacteria 5614
238 Ga0395905_0030322 3300037471 Bacteria 5097
239 Ga0395905_0039373 3300037471 Bacteria 4434
240 Ga0395905_0047842 3300037471 Bacteria 4008
241 Ga0395905_0054676 3300037471 Bacteria 3735
242 Ga0395905_0057694 3300037471 Bacteria 3631
243 Ga0395905_0071105 3300037471 Unclassified 3262
244 Ga0395905_0081713 3300037471 Bacteria 3028
245 Ga0395905_0166544 3300037471 Bacteria 2071
246 Ga0395905_0172676 3300037471 Bacteria 2030
247 Ga0395905_0181886 3300037471 Bacteria 1974
248 Ga0395905_0209995 3300037471 Bacteria 1824
249 Ga0395905_0212700 3300037471 Bacteria 1811
250 Ga0395905_0341033 3300037471 Bacteria 1390
251 Ga0395905_0352198 3300037471 Bacteria 1365
252 Ga0395905_0393199 3300037471 Bacteria 1281
253 Ga0395905_0438695 3300037471 Bacteria 1203
254 Ga0395905_0666286 3300037471 Bacteria 943
255 Ga0395905_1115108 3300037471 Bacteria 692
256 Ga0395905_1198303 3300037471 Bacteria 663
257 Ga0395901_0004537 3300038443 Bacteria 14006
258 Ga0395901_0004919 3300038443 Bacteria 13484
259 Ga0395901_0004986 3300038443 Bacteria 13398
260 Ga0395901_0010300 3300038443 Bacteria 9469
261 Ga0395901_0011195 3300038443 Bacteria 9092
262 Ga0395901_0014353 3300038443 Bacteria 8066
263 Ga0395901_0016211 3300038443 Bacteria 7590
264 Ga0395901_0018864 3300038443 Bacteria 7051
265 Ga0395901_0023333 3300038443 Bacteria 6340
266 Ga0395901_0093909 3300038443 Bacteria 3141
267 Ga0395901_0098274 3300038443 Bacteria 3069
268 Ga0395901_0109315 3300038443 Bacteria 2903
269 Ga0395901_0114514 3300038443 Bacteria 2832
270 Ga0395901_0196499 3300038443 Bacteria 2115
271 Ga0395901_0227601 3300038443 Unclassified 1947
272 Ga0395901_0248099 3300038443 Bacteria 1855
273 Ga0395901_0326307 3300038443 Bacteria 1587
274 Ga0395901_0476574 3300038443 Bacteria 1273
275 Ga0395901_0494057 3300038443 Bacteria 1246
276 Ga0395901_0566538 3300038443 Bacteria 1149
277 Ga0395901_0677967 3300038443 Unclassified 1031
278 Ga0395901_1236267 3300038443 Bacteria 711
279 Ga0395901_1273737 3300038443 Bacteria 698
280 Ga0439439_0001204 3300041406 Bacteria 5006
281 Ga0451800_0347212 3300041459 Unclassified 760
282 Ga0451853_0747513 3300041512 Bacteria 1722
283 Ga0439433_0000735 3300041999 Bacteria 6415
284 Ga0439442_003039 3300042002 Bacteria 3317
285 Ga0439449_0013533 3300042007 Bacteria 3070
286 Ga0439451_012502 3300042009 Bacteria 1712
287 Ga0439457_019837 3300042014 Bacteria 1493
288 Ga0439462_0009966 3300042015 Bacteria 2404
289 Ga0439463_028649 3300042016 Bacteria 1404
290 Ga0450920_006123 3300042122 Bacteria 2155
291 Ga0450910_034732 3300042147 Bacteria 801
292 Ga0439446_0000371 3300042156 Bacteria 8629
293 Ga0439434_0004761 3300042435 Bacteria 3976
294 Ga0439459_0023844 3300042438 Bacteria 1196
295 Ga0439440_0075350 3300042993 Bacteria 885
296 Ga0466969_0023786 3300044656 Bacteria 3155
297 Ga0466965_0285174 3300044683 Bacteria 893
298 Ga0466961_0071640 3300044693 Bacteria 2199
299 Ga0466964_0013475 3300044706 Bacteria 3102
300 Ga0466971_0201302 3300044719 Bacteria 940
301 Ga0466968_0097495 3300044735 Bacteria 1309
302 Ga0466957_0095966 3300044842 Bacteria 1863
303 Ga0466960_0045296 3300044901 Bacteria 2101
304 Ga0466960_0082977 3300044901 Bacteria 1619
305 Ga0466959_0008450 3300045049 Bacteria 7281
306 Ga0466959_0160604 3300045049 Bacteria 1580
307 Ga0451576_0089293 3300045051 Bacteria 3205
308 Ga0451576_0708330 3300045051 Unclassified 1058
309 Ga0466958_0250324 3300045836 Bacteria 1133
310 Ga0466967_0025885 3300045976 Bacteria 4847
311 Ga0466967_0186936 3300045976 Bacteria 1956
312 Ga0466967_0268259 3300045976 Bacteria 1635
313 Ga0495641_0402295 3300046461 Bacteria 621
314 Ga0495653_0779853 3300046463 Bacteria 576
315 Ga0495582_0065172 3300046473 Bacteria 2013
316 Ga0495584_0132733 3300046491 Bacteria 1263
317 Ga0495583_0179665 3300046506 Bacteria 867
318 Ga0495620_0071730 3300046515 Bacteria 1415
319 Ga0495630_0276112 3300046517 Bacteria 1284
320 Ga0495642_0049150 3300046528 Bacteria 1732
321 Ga0495586_0620600 3300046535 Bacteria 625
322 Ga0495609_0125594 3300046538 Bacteria 1101
323 Ga0495658_0002343 3300046683 Bacteria 9569
324 Ga0495671_0064091 3300046692 Unclassified 1810
325 Ga0495589_0190057 3300046794 Unclassified 972
326 Ga0495636_0082816 3300047318 Unclassified 1384
327 Ga0495636_0218383 3300047318 Bacteria 874
328 Ga0495676_0048101 3300047321 Bacteria 3442
329 Ga0495593_0343990 3300047673 Bacteria 745
330 Ga0496101_0111565 3300048904 Bacteria 2059
331 Ga0496101_0335979 3300048904 Unclassified 1186
332 Ga0496101_0442171 3300048904 Bacteria 1026
333 Ga0496101_0451479 3300048904 Bacteria 1014
334 Ga0496102_0005346 3300048905 Bacteria 10902
335 Ga0496102_0072829 3300048905 Bacteria 3158
336 Ga0496102_0253231 3300048905 Bacteria 1660
337 Ga0496103_0099313 3300048906 Bacteria 1841
338 Ga0496103_0241919 3300048906 Unclassified 1161
339 Ga0496104_0058410 3300048907 Bacteria 3651
340 Ga0496104_0058878 3300048907 Bacteria 3637
341 Ga0496105_0008480 3300048908 Bacteria 7986
342 Ga0496106_0018818 3300048909 Bacteria 5116
343 Ga0496107_0182045 3300048910 Bacteria 1560
344 Ga0496107_0677544 3300048910 Bacteria 759
345 Ga0496108_0020488 3300048911 Bacteria 5437
346 Ga0496108_0199631 3300048911 Bacteria 1736
347 Ga0496108_0388918 3300048911 Bacteria 1218
348 Ga0496109_0002044 3300048912 Bacteria 16720
349 Ga0496109_0018406 3300048912 Bacteria 6137
350 Ga0496109_0103955 3300048912 Bacteria 2637
351 Ga0496109_0107956 3300048912 Bacteria 2586
352 Ga0496110_0005886 3300048913 Bacteria 9652
353 Ga0496110_0009679 3300048913 Bacteria 7804
354 Ga0496110_0063057 3300048913 Bacteria 3275
355 Ga0496110_0223822 3300048913 Bacteria 1711
356 Ga0496110_0833299 3300048913 Bacteria 827
357 Ga0496111_0004165 3300048914 Bacteria 9099
358 Ga0496111_0005648 3300048914 Bacteria 8051
359 Ga0496111_0134352 3300048914 Bacteria 1832
360 Ga0496112_0010089 3300048915 Bacteria 8554
361 Ga0496112_0014183 3300048915 Bacteria 7385
362 Ga0496112_0260648 3300048915 Bacteria 1683
363 Ga0496112_0456767 3300048915 Bacteria 1215
364 Ga0496112_0520765 3300048915 Bacteria 1124
365 Ga0496113_0004818 3300048916 Bacteria 8344
366 Ga0496114_0709093 3300048917 Bacteria 882
367 Ga0501031_0000716 3300049568 Bacteria 19845
368 Ga0501031_0010144 3300049568 Bacteria 6139
369 Ga0501032_0018558 3300049569 Bacteria 4871
370 Ga0501033_0002860 3300049570 Bacteria 14466
371 Ga0501033_0080761 3300049570 Bacteria 2385
372 Ga0501034_0080725 3300049571 Bacteria 3256
373 Ga0501036_0002492 3300049572 Bacteria 14439
374 Ga0501036_0009487 3300049572 Bacteria 8005
375 Ga0501036_0097283 3300049572 Bacteria 2488
376 Ga0501037_0001411 3300049573 Bacteria 17615
377 Ga0501037_0201588 3300049573 Bacteria 1406
378 Ga0501037_0372762 3300049573 Unclassified 982
379 Ga0501038_0007598 3300049574 Bacteria 9997
380 Ga0501038_0016602 3300049574 Bacteria 6675
381 Ga0501038_0103585 3300049574 Bacteria 2366
382 Ga0501039_0007450 3300049575 Bacteria 8352
383 Ga0501039_0036684 3300049575 Bacteria 3783
384 Ga0501039_0079714 3300049575 Bacteria 2547
385 Ga0501039_0530767 3300049575 Bacteria 924
386 Ga0501040_0002629 3300049576 Bacteria 11585
387 Ga0501040_0009631 3300049576 Bacteria 6305
388 Ga0501040_0170340 3300049576 Bacteria 1541
389 Ga0501040_0551592 3300049576 Unclassified 832
390 Ga0501041_0004885 3300049577 Bacteria 7790
391 Ga0501041_0022753 3300049577 Bacteria 3754
392 Ga0501042_0002574 3300049578 Bacteria 11148
393 Ga0501042_0004415 3300049578 Bacteria 8973
394 Ga0501042_0008115 3300049578 Bacteria 6913
395 Ga0501042_0713386 3300049578 Bacteria 729
396 Ga0501042_0731789 3300049578 Bacteria 719
397 Ga0501043_0002017 3300049579 Bacteria 17338
398 Ga0501046_0006074 3300049580 Bacteria 10746
399 Ga0501046_0010381 3300049580 Bacteria 8003
400 Ga0501046_0051924 3300049580 Bacteria 3233
401 Ga0501046_0590262 3300049580 Bacteria 789
402 Ga0501047_0076023 3300049581 Bacteria 3232
403 Ga0501048_0001523 3300049582 Bacteria 17576
404 Ga0501048_0017719 3300049582 Bacteria 5241
405 Ga0501048_0098014 3300049582 Bacteria 2068
406 Ga0501048_0246284 3300049582 Bacteria 1268
407 Ga0501067_0060173 3300049583 Bacteria 2102
408 Ga0501067_0127431 3300049583 Unclassified 1416
409 Ga0501067_0275766 3300049583 Bacteria 936
410 Ga0501068_0008486 3300049584 Bacteria 5720
411 Ga0501068_0516391 3300049584 Bacteria 775
412 Ga0501069_0000355 3300049585 Bacteria 20569
413 Ga0501069_0026001 3300049585 Bacteria 3204
414 Ga0501069_0058079 3300049585 Bacteria 2158
415 Ga0501070_0000880 3300049586 Bacteria 27241
416 Ga0501070_0001821 3300049586 Bacteria 18773
417 Ga0501070_0051924 3300049586 Bacteria 3403
418 Ga0501070_0171597 3300049586 Bacteria 1786
419 Ga0501071_0002209 3300049587 Bacteria 11709
420 Ga0501071_0014774 3300049587 Bacteria 5345
421 Ga0501071_0254244 3300049587 Bacteria 1326
422 Ga0501071_0777298 3300049587 Bacteria 738
423 Ga0501072_0002455 3300049588 Bacteria 13875
424 Ga0501072_0006103 3300049588 Bacteria 9190
425 Ga0501072_0008774 3300049588 Bacteria 7675
426 Ga0501072_0068952 3300049588 Bacteria 2792
427 Ga0501072_1095098 3300049588 Unclassified 620
428 Ga0501072_1331065 3300049588 Bacteria 556
429 Ga0501073_0004139 3300049589 Bacteria 10884
430 Ga0501073_0089906 3300049589 Bacteria 2135
431 Ga0501074_0002379 3300049590 Bacteria 13109
432 Ga0501074_0012495 3300049590 Bacteria 6172
433 Ga0501074_0047999 3300049590 Bacteria 3085
434 Ga0501074_0372918 3300049590 Bacteria 1012
435 Ga0501075_0007050 3300049591 Bacteria 7766
436 Ga0501075_0060662 3300049591 Bacteria 2849
437 Ga0501075_0159838 3300049591 Bacteria 1718
438 Ga0501076_0006029 3300049592 Bacteria 8764
439 Ga0501076_0073927 3300049592 Bacteria 2729
440 Ga0501076_0339328 3300049592 Bacteria 1233
441 Ga0501077_0012451 3300049593 Bacteria 5326
442 Ga0501077_0020805 3300049593 Bacteria 4152
443 Ga0501077_0029374 3300049593 Bacteria 3495
444 Ga0501079_0022625 3300049741 Bacteria 4821
445 Ga0501079_0035327 3300049741 Bacteria 3847
446 Ga0501079_0062250 3300049741 Bacteria 2879
447 Ga0501080_0021884 3300049742 Bacteria 5921
448 Ga0501080_0029033 3300049742 Bacteria 5149
449 Ga0501080_0085211 3300049742 Bacteria 2936
450 Ga0501080_0116277 3300049742 Bacteria 2479
451 Ga0501080_1110244 3300049742 Bacteria 682
452 Ga0501081_0005847 3300049743 Bacteria 7961
453 Ga0501081_0067306 3300049743 Bacteria 2492
454 Ga0501081_0494969 3300049743 Bacteria 911
455 Ga0501083_0005257 3300049744 Bacteria 9157
456 Ga0501083_0342290 3300049744 Bacteria 972
457 Ga0501035_0012171 3300049822 Bacteria 7957
458 Ga0501035_0035539 3300049822 Bacteria 4521
459 Ga0501035_0162706 3300049822 Bacteria 1931
460 Ga0501035_0678446 3300049822 Bacteria 833
461 Ga0501035_0701079 3300049822 Bacteria 816
462 Ga0501044_0025903 3300049823 Bacteria 6216
463 Ga0501044_1267507 3300049823 Bacteria 604
464 Ga0501045_0010233 3300049824 Bacteria 6567
465 Ga0501045_0013921 3300049824 Bacteria 5690
466 Ga0501045_0167013 3300049824 Bacteria 1639
467 nmdc:mga05p37_156251_c1 3300050507 Bacteria 2787
468 nmdc:mga05p37_21589_c1 3300050507 Bacteria 7800
469 nmdc:mga05p37_2561_c1 3300050507 Bacteria 21145
470 nmdc:mga05p37_68640_c1 3300050507 Bacteria 4359
471 nmdc:mga09592_374939_c1 3300050508 Bacteria 1231
472 nmdc:mga0qj67_532824_c1 3300050509 Bacteria 943
473 nmdc:mga06r32_103372_c1 3300050510 Unclassified 2797
474 nmdc:mga06r32_105440_c1 3300050510 Bacteria 2769
475 nmdc:mga06r32_5294_c1 3300050510 Bacteria 11612
476 nmdc:mga08y16_138391_c1 3300050511 Bacteria 2531
477 nmdc:mga08y16_59758_c1 3300050511 Bacteria 3981
478 nmdc:mga0n895_232372_c1 3300050512 Bacteria 1872
479 nmdc:mga0n895_23755_c1 3300050512 Bacteria 5767
480 nmdc:mga0n895_265018_c1 3300050512 Bacteria 1743
481 nmdc:mga0n895_92146_c1 3300050512 Unclassified 3034
482 nmdc:mga0rr50_22825_c1 3300050513 Bacteria 4302
483 nmdc:mga0rr50_381491_c1 3300050513 Bacteria 1189
484 nmdc:mga0rr50_8434_c1 3300050513 Bacteria 6416
485 nmdc:mga08x19_43955_c1 3300050514 Bacteria 2851
486 nmdc:mga08x19_9907_c1 3300050514 Bacteria 5711
487 nmdc:mga0a205_139087_c1 3300050515 Bacteria 2329
488 nmdc:mga0a205_65460_c1 3300050515 Bacteria 3512
489 Ga0495655_0019978 3300053083 Bacteria 1496
490 Ga0495655_0073925 3300053083 Unclassified 959
491 Ga0495655_0079113 3300053083 Bacteria 936
492 Ga0495655_0175304 3300053083 Bacteria 688
493 Ga0495655_0221842 3300053083 Unclassified 626
494 Ga0501084_0016659 3300054114 Bacteria 6104
495 Ga0501084_0046726 3300054114 Bacteria 3626
496 Ga0501084_0315422 3300054114 Bacteria 1320
497 Ga0587082_069270 3300059504 Unclassified 713
498 Ga0587083_0048607 3300059505 Bacteria 917
499 Ga0587088_051193 3300059508 Bacteria 809
500 Ga0587109_053489 3300059624 Bacteria 833
501 Ga0587067_017919 3300059640 Bacteria 1182
502 Ga0501082_0009854 3300060353 Bacteria 8233
503 Ga0501082_0022365 3300060353 Bacteria 5446
504 Ga0501082_0133759 3300060353 Bacteria 2151
505 Ga0501082_0238738 3300060353 Bacteria 1582
506 Ga0501082_0791113 3300060353 Bacteria 830
507 Ga0530510_0003263 3300061734 Bacteria 11151
508 Ga0530510_0006033 3300061734 Bacteria 8410
509 Ga0530510_0011734 3300061734 Bacteria 6149
510 Ga0395899_0099851
511 JGI25406J46586_10035509
512 JGI25407J50210_10010018
513 Ga0070683_100037221
514 Ga0070683_100689996
515 Ga0068868_100015386
516 Ga0070660_100084579
517 Ga0070660_100353222
518 Ga0070689_101005631
519 Ga0070691_10017970
520 Ga0070671_100036854
521 Ga0070674_100205413
522 Ga0070673_100103109
523 Ga0070673_100505110
524 Ga0070673_101253305
525 Ga0070659_100345443
526 Ga0070714_100091088
527 Ga0070714_100276921
528 Ga0070710_10962638
529 Ga0070662_100183988
530 Ga0070662_100722228
531 Ga0070685_10414444
532 Ga0070707_100177503
533 Ga0070707_100303715
534 Ga0070698_100489808
535 Ga0070699_100299592
536 Ga0070684_100079288
537 Ga0070684_100680361
538 Ga0070697_100813085
539 Ga0070695_100206586
540 Ga0068855_100267856
541 Ga0068855_100345921
542 Ga0068857_100866678
543 Ga0068854_100546762
544 Ga0068856_101145261
545 Ga0081455_10028265
546 Ga0081455_10186520
547 Ga0081538_10002571
548 Ga0081539_10000599
549 Ga0081539_10002641
550 Ga0081539_10004046
551 Ga0070717_10187612
552 Ga0070717_10822606
553 Ga0070712_100056453
554 Ga0075428_100839403
555 Ga0075430_100099406
556 Ga0075431_100036605
557 Ga0075433_10007855
558 Ga0075433_10553464
559 Ga0075434_100024229
560 Ga0075434_100024298
561 Ga0075434_100128507
562 Ga0075429_100031626
563 Ga0075436_100004405
564 Ga0075436_100018008
565 Ga0075435_100019341
566 Ga0075435_100039454
567 Ga0075435_100039985
568 Ga0099794_10529606
569 Ga0105240_10063966
570 Ga0111539_10018517
571 Ga0111539_10090268
572 Ga0111539_10289339
573 Ga0111539_10319060
574 Ga0111539_10464151
575 Ga0105245_10002728
576 Ga0105245_10043266
577 Ga0114129_10067892
578 Ga0114129_10071069
579 Ga0114129_10136629
580 Ga0114129_10284493
581 Ga0114129_10518049
582 Ga0105243_10074993
583 Ga0105242_10400112
584 Ga0105248_10246582
585 Ga0105238_12848018
586 Ga0105249_10020928
587 Ga0105249_10221584
588 Ga0105239_10045318
589 Ga0157370_10029510
590 Ga0157378_11097002
591 Ga0163162_12746859
592 Ga0157372_10068402
593 Ga0157380_10037316
594 Ga0182008_10098409
595 Ga0182008_10253332
596 Ga0182008_10260796
597 Ga0157376_10155419
598 Ga0206356_10794617
599 Ga0206350_11205335
600 Ga0206353_10781369
601 Ga0224712_10200533
602 Ga0224712_10388873
603 Ga0207692_10612800
604 Ga0207688_10111696
605 Ga0207699_10003006
606 Ga0207693_10012894
607 Ga0207693_10192525
608 Ga0207663_10294094
609 Ga0207657_10122147
610 Ga0207657_10302977
611 Ga0207652_10775428
612 Ga0207652_10800936
613 Ga0207646_10167231
614 Ga0207646_10331276
615 Ga0207646_10364737
616 Ga0207646_10824768
617 Ga0207681_10659777
618 Ga0207687_10006730
619 Ga0207687_10182963
620 Ga0207687_10221591
621 Ga0207700_10000002
622 Ga0207700_10883993
623 Ga0207664_10067680
624 Ga0207664_10133371
625 Ga0207664_10211284
626 Ga0207644_10191478
627 Ga0207706_10055832
628 Ga0207706_10267419
629 Ga0207670_11430284
630 Ga0207669_10424606
631 Ga0207691_11042120
632 Ga0207711_10511092
633 Ga0207661_10405963
634 Ga0207661_11063992
635 Ga0207679_10415547
636 Ga0207667_10114235
637 Ga0207667_10123143
638 Ga0207651_10853995
639 Ga0207712_10015440
640 Ga0207668_10027893
641 Ga0207677_11072778
642 Ga0207639_10396170
643 Ga0207678_10419072
644 Ga0207678_10710362
645 Ga0207708_10105294
646 Ga0207702_10348010
647 Ga0207702_11029964
648 Ga0207702_11657158
649 Ga0207675_100161511
650 Ga0207675_100243629
651 Ga0207428_10379217
652 Ga0307408_100141444
653 Ga0307405_10392281
654 Ga0307405_10623566
655 Ga0307410_10429643
656 Ga0307406_10253178
657 Ga0307406_10360072
658 Ga0307406_10670453
659 Ga0307407_10692631
660 Ga0307407_10959918
661 Ga0307412_10588952
662 Ga0307412_11028615
663 Ga0307409_100030199
664 Ga0307409_100148725
665 Ga0307416_100017495
666 Ga0307416_100031605
667 Ga0307416_100238370
668 Ga0307416_100330630
669 Ga0307416_100494760
670 Ga0307416_101179687
671 Ga0307415_100034892
672 Ga0307415_100336500
673 Ga0307415_100493770
674 Ga0373926_0310516
675 Ga0373945_0003705
676 Ga0373943_0004489
677 Ga0373947_0013047
678 Ga0373925_0106026
679 Ga0395899_0001105
680 Ga0395899_0008115
681 Ga0395899_0013324
682 Ga0395899_0038647
683 Ga0395899_0043152
684 Ga0395899_0044611
685 Ga0395899_0048167
686 Ga0395899_0061751
687 Ga0395899_0093403
688 Ga0395899_0105982
689 Ga0395899_0107064
690 Ga0395899_0252763
691 Ga0395899_0313779
692 Ga0395899_0339147
693 Ga0395899_0382469
694 Ga0395899_0394036
695 Ga0395899_0591968
696 Ga0395899_0834767
697 Ga0395900_0001661
698 Ga0395900_0003831
699 Ga0395900_0003985
700 Ga0395900_0004589
701 Ga0395900_0008289
702 Ga0395900_0011014
703 Ga0395900_0018072
704 Ga0395900_0018386
705 Ga0395900_0026771
706 Ga0395900_0029229
707 Ga0395900_0029399
708 Ga0395900_0065780
709 Ga0395900_0083621
710 Ga0395900_0110467
711 Ga0395900_0260462
712 Ga0395900_0274751
713 Ga0395900_0277037
714 Ga0395900_0713848
715 Ga0395900_0815872
716 Ga0395900_1009868
717 Ga0395898_0002617
718 Ga0395898_0003970
719 Ga0395898_0004782
720 Ga0395898_0006956
721 Ga0395898_0015633
722 Ga0395898_0020512
723 Ga0395898_0028606
724 Ga0395898_0029413
725 Ga0395898_0050937
726 Ga0395898_0065206
727 Ga0395898_0073793
728 Ga0395898_0088578
729 Ga0395898_0093018
730 Ga0395898_0102129
731 Ga0395898_0118626
732 Ga0395898_0152708
733 Ga0395898_0162169
734 Ga0395898_0180057
735 Ga0395898_0233976
736 Ga0395898_0255150
737 Ga0395898_0347147
738 Ga0395898_0425360
739 Ga0395898_0759137
740 Ga0395898_0976505
741 Ga0395905_0003633
742 Ga0395905_0004494
743 Ga0395905_0006301
744 Ga0395905_0008126
745 Ga0395905_0015411
746 Ga0395905_0025163
747 Ga0395905_0030322
748 Ga0395905_0039373
749 Ga0395905_0047842
750 Ga0395905_0054676
751 Ga0395905_0057694
752 Ga0395905_0071105
753 Ga0395905_0081713
754 Ga0395905_0166544
755 Ga0395905_0172676
756 Ga0395905_0181886
757 Ga0395905_0209995
758 Ga0395905_0212700
759 Ga0395905_0341033
760 Ga0395905_0352198
761 Ga0395905_0393199
762 Ga0395905_0438695
763 Ga0395905_0666286
764 Ga0395905_1115108
765 Ga0395905_1198303
766 Ga0395901_0004537
767 Ga0395901_0004919
768 Ga0395901_0004986
769 Ga0395901_0010300
770 Ga0395901_0011195
771 Ga0395901_0014353
772 Ga0395901_0016211
773 Ga0395901_0018864
774 Ga0395901_0023333
775 Ga0395901_0093909
776 Ga0395901_0098274
777 Ga0395901_0109315
778 Ga0395901_0114514
779 Ga0395901_0196499
780 Ga0395901_0227601
781 Ga0395901_0248099
782 Ga0395901_0326307
783 Ga0395901_0476574
784 Ga0395901_0494057
785 Ga0395901_0566538
786 Ga0395901_0677967
787 Ga0395901_1236267
788 Ga0395901_1273737
789 Ga0439439_0001204
790 Ga0451800_0347212
791 Ga0451853_0747513
792 Ga0439433_0000735
793 Ga0439442_003039
794 Ga0439449_0013533
795 Ga0439451_012502
796 Ga0439457_019837
797 Ga0439462_0009966
798 Ga0439463_028649
799 Ga0450920_006123
800 Ga0450910_034732
801 Ga0439446_0000371
802 Ga0439434_0004761
803 Ga0439459_0023844
804 Ga0439440_0075350
805 Ga0466969_0023786
806 Ga0466965_0285174
807 Ga0466961_0071640
808 Ga0466964_0013475
809 Ga0466971_0201302
810 Ga0466968_0097495
811 Ga0466957_0095966
812 Ga0466960_0045296
813 Ga0466960_0082977
814 Ga0466959_0008450
815 Ga0466959_0160604
816 Ga0451576_0089293
817 Ga0451576_0708330
818 Ga0466958_0250324
819 Ga0466967_0025885
820 Ga0466967_0186936
821 Ga0466967_0268259
822 Ga0495641_0402295
823 Ga0495653_0779853
824 Ga0495582_0065172
825 Ga0495584_0132733
826 Ga0495583_0179665
827 Ga0495620_0071730
828 Ga0495630_0276112
829 Ga0495642_0049150
830 Ga0495586_0620600
831 Ga0495609_0125594
832 Ga0495658_0002343
833 Ga0495671_0064091
834 Ga0495589_0190057
835 Ga0495636_0082816
836 Ga0495636_0218383
837 Ga0495676_0048101
838 Ga0495593_0343990
839 Ga0496101_0111565
840 Ga0496101_0335979
841 Ga0496101_0442171
842 Ga0496101_0451479
843 Ga0496102_0005346
844 Ga0496102_0072829
845 Ga0496102_0253231
846 Ga0496103_0099313
847 Ga0496103_0241919
848 Ga0496104_0058410
849 Ga0496104_0058878
850 Ga0496105_0008480
851 Ga0496106_0018818
852 Ga0496107_0182045
853 Ga0496107_0677544
854 Ga0496108_0020488
855 Ga0496108_0199631
856 Ga0496108_0388918
857 Ga0496109_0002044
858 Ga0496109_0018406
859 Ga0496109_0103955
860 Ga0496109_0107956
861 Ga0496110_0005886
862 Ga0496110_0009679
863 Ga0496110_0063057
864 Ga0496110_0223822
865 Ga0496110_0833299
866 Ga0496111_0004165
867 Ga0496111_0005648
868 Ga0496111_0134352
869 Ga0496112_0010089
870 Ga0496112_0014183
871 Ga0496112_0260648
872 Ga0496112_0456767
873 Ga0496112_0520765
874 Ga0496113_0004818
875 Ga0496114_0709093
876 Ga0501031_0000716
877 Ga0501031_0010144
878 Ga0501032_0018558
879 Ga0501033_0002860
880 Ga0501033_0080761
881 Ga0501034_0080725
882 Ga0501036_0002492
883 Ga0501036_0009487
884 Ga0501036_0097283
885 Ga0501037_0001411
886 Ga0501037_0201588
887 Ga0501037_0372762
888 Ga0501038_0007598
889 Ga0501038_0016602
890 Ga0501038_0103585
891 Ga0501039_0007450
892 Ga0501039_0036684
893 Ga0501039_0079714
894 Ga0501039_0530767
895 Ga0501040_0002629
896 Ga0501040_0009631
897 Ga0501040_0170340
898 Ga0501040_0551592
899 Ga0501041_0004885
900 Ga0501041_0022753
901 Ga0501042_0002574
902 Ga0501042_0004415
903 Ga0501042_0008115
904 Ga0501042_0713386
905 Ga0501042_0731789
906 Ga0501043_0002017
907 Ga0501046_0006074
908 Ga0501046_0010381
909 Ga0501046_0051924
910 Ga0501046_0590262
911 Ga0501047_0076023
912 Ga0501048_0001523
913 Ga0501048_0017719
914 Ga0501048_0098014
915 Ga0501048_0246284
916 Ga0501067_0060173
917 Ga0501067_0127431
918 Ga0501067_0275766
919 Ga0501068_0008486
920 Ga0501068_0516391
921 Ga0501069_0000355
922 Ga0501069_0026001
923 Ga0501069_0058079
924 Ga0501070_0000880
925 Ga0501070_0001821
926 Ga0501070_0051924
927 Ga0501070_0171597
928 Ga0501071_0002209
929 Ga0501071_0014774
930 Ga0501071_0254244
931 Ga0501071_0777298
932 Ga0501072_0002455
933 Ga0501072_0006103
934 Ga0501072_0008774
935 Ga0501072_0068952
936 Ga0501072_1095098
937 Ga0501072_1331065
938 Ga0501073_0004139
939 Ga0501073_0089906
940 Ga0501074_0002379
941 Ga0501074_0012495
942 Ga0501074_0047999
943 Ga0501074_0372918
944 Ga0501075_0007050
945 Ga0501075_0060662
946 Ga0501075_0159838
947 Ga0501076_0006029
948 Ga0501076_0073927
949 Ga0501076_0339328
950 Ga0501077_0012451
951 Ga0501077_0020805
952 Ga0501077_0029374
953 Ga0501079_0022625
954 Ga0501079_0035327
955 Ga0501079_0062250
956 Ga0501080_0021884
957 Ga0501080_0029033
958 Ga0501080_0085211
959 Ga0501080_0116277
960 Ga0501080_1110244
961 Ga0501081_0005847
962 Ga0501081_0067306
963 Ga0501081_0494969
964 Ga0501083_0005257
965 Ga0501083_0342290
966 Ga0501035_0012171
967 Ga0501035_0035539
968 Ga0501035_0162706
969 Ga0501035_0678446
970 Ga0501035_0701079
971 Ga0501044_0025903
972 Ga0501044_1267507
973 Ga0501045_0010233
974 Ga0501045_0013921
975 Ga0501045_0167013
976 nmdc:mga05p37_156251_c1
977 nmdc:mga05p37_21589_c1
978 nmdc:mga05p37_2561_c1
979 nmdc:mga05p37_68640_c1
980 nmdc:mga09592_374939_c1
981 nmdc:mga0qj67_532824_c1
982 nmdc:mga06r32_103372_c1
983 nmdc:mga06r32_105440_c1
984 nmdc:mga06r32_5294_c1
985 nmdc:mga08y16_138391_c1
986 nmdc:mga08y16_59758_c1
987 nmdc:mga0n895_232372_c1
988 nmdc:mga0n895_23755_c1
989 nmdc:mga0n895_265018_c1
990 nmdc:mga0n895_92146_c1
991 nmdc:mga0rr50_22825_c1
992 nmdc:mga0rr50_381491_c1
993 nmdc:mga0rr50_8434_c1
994 nmdc:mga08x19_43955_c1
995 nmdc:mga08x19_9907_c1
996 nmdc:mga0a205_139087_c1
997 nmdc:mga0a205_65460_c1
998 Ga0495655_0019978
999 Ga0495655_0073925
1000 Ga0495655_0079113
1001 Ga0495655_0175304
1002 Ga0495655_0221842
1003 Ga0501084_0016659
1004 Ga0501084_0046726
1005 Ga0501084_0315422
1006 Ga0587082_069270
1007 Ga0587083_0048607
1008 Ga0587088_051193
1009 Ga0587109_053489
1010 Ga0587067_017919
1011 Ga0501082_0009854
1012 Ga0501082_0022365
1013 Ga0501082_0133759
1014 Ga0501082_0238738
1015 Ga0501082_0791113
1016 Ga0530510_0003263
1017 Ga0530510_0006033
1018 Ga0530510_0011734

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09990

DUF2231

Predicted membrane protein (DUF2231)

12

150

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.704 15 142
7jrp-assembly1.cif.gz_c plant mitochondrial complex sc iii2+iv from vigna radiata 0.7023 9 145
8dt0-assembly2.cif.gz_B scaffolding protein functional sites using deep learning 0.7017 14 142
8dh6-assembly1.cif.gz_c cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs 0.6989 14 142
7oy2-assembly1.cif.gz_C high resolution structure of cytochrome bd-ii oxidase from e. coli 0.6987 15 135
ID Description Score Start End Superfamily
af_A4I3I9_159_313_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7238 71 141 1.20.140.150
af_Q54TU2_879_984_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7189 22 139 1.20.120.230
af_Q9UBT7_169_278_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.7133 49 141 1.20.120.230
af_Q8S8F1_85_256_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6951 3 142 1.20.120.1770
af_Q54TU2_879_984_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.692 22 139 1.20.120.230
ID Description Score Start End GO Terms
AF-Q1AS96-F1-model_v4 Membrane protein-like protein 0.9605 12 141 GO:0016020
AF-A0A538GTH3-F1-model_v4 DUF2231 domain-containing protein 0.9589 1 106 GO:0016020
AF-A0A7W0T7J6-F1-model_v4 DUF2231 domain-containing protein 0.9554 1 126 GO:0016020
AF-A0A1G9S1A0-F1-model_v4 DUF2231 domain-containing protein 0.9412 15 141 GO:0016020
AF-A0A2V5T9N6-F1-model_v4 Rieske domain-containing protein 0.9407 18 141 GO:0016020
GO:0046872
GO:0051537

Map