F456975

General Info

Members Datasets Scaffolds Average Seq Length
509 318 509 93

Family's Representative Sequence

Representative Sequence 3300009177|Ga0105248_11352713|Ga0105248_113527132
Length 102
Sequence MSQAVNSSEIIMYSTTWCPYCDRARALLKAKGATFSEVKIDEDPAQRDIMLKRSGGRRTVPQIFIGERHVGGFDDLYALDRKGELDGLLRDAAAANSAKVLP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
183 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
186 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
187 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
188 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
193 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
194 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
200 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
201 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
202 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
204 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
209 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
210 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
211 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
212 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
213 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
223 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
224 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
227 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
228 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
229 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
233 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
234 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
235 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
236 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
248 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
257 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
258 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
259 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
260 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
263 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
264 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
265 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
269 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
270 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
271 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
272 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
273 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
274 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
275 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
276 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
279 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
280 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
283 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
284 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
285 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
286 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
287 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
288 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
289 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
295 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
296 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
297 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
298 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
299 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
306 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
307 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
309 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
310 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
311 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
312 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
313 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
314 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
315 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
316 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
317 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.57
Nodule 0
Rhizoplane 3.93
Rhizosphere 92.73
Stem 0
Stem Tuber 0
Unclassified 1.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1270333 2162886007 Bacteria 1321
2 SwRhRL2b_contig_1635463 2162886007 Bacteria 1378
3 JGI24747J21853_1048555 3300001978 Bacteria 514
4 rootL2_10014067 3300003322 Bacteria 13138
5 Ga0070658_11064003 3300005327 Bacteria 704
6 Ga0070676_10121496 3300005328 Bacteria 1640
7 Ga0070683_100055831 3300005329 Bacteria 3665
8 Ga0070690_100003078 3300005330 Bacteria 9067
9 Ga0070670_100020490 3300005331 Bacteria 5685
10 Ga0070670_100343403 3300005331 Bacteria 1311
11 Ga0068869_100023785 3300005334 Bacteria 4238
12 Ga0068869_100537084 3300005334 Bacteria 981
13 Ga0070666_10004746 3300005335 Bacteria 8304
14 Ga0070666_11338461 3300005335 Bacteria 535
15 Ga0070680_100011375 3300005336 Bacteria 6882
16 Ga0070680_100382310 3300005336 Unclassified 1199
17 Ga0070682_100013128 3300005337 Bacteria 4757
18 Ga0068868_100015847 3300005338 Bacteria 5585
19 Ga0068868_102122145 3300005338 Bacteria 535
20 Ga0070660_100022673 3300005339 Bacteria 4647
21 Ga0070660_100044088 3300005339 Bacteria 3410
22 Ga0070660_100467982 3300005339 Bacteria 1047
23 Ga0070689_100006592 3300005340 Bacteria 8055
24 Ga0070691_10289101 3300005341 Bacteria 892
25 Ga0070687_100191436 3300005343 Bacteria 1233
26 Ga0070661_100015818 3300005344 Bacteria 5325
27 Ga0070661_100094025 3300005344 Bacteria 2221
28 Ga0070692_10004689 3300005345 Bacteria 5731
29 Ga0070692_10234915 3300005345 Unclassified 1090
30 Ga0070671_100206171 3300005355 Bacteria 1667
31 Ga0070674_100220166 3300005356 Bacteria 1476
32 Ga0070673_100002265 3300005364 Bacteria 11663
33 Ga0070673_101722328 3300005364 Bacteria 593
34 Ga0070688_100012315 3300005365 Bacteria 4789
35 Ga0070659_100068867 3300005366 Bacteria 2808
36 Ga0070659_100394320 3300005366 Unclassified 1168
37 Ga0070667_100259151 3300005367 Bacteria 1556
38 Ga0070667_100428652 3300005367 Bacteria 1206
39 Ga0070703_10374871 3300005406 Bacteria 613
40 Ga0070709_10182557 3300005434 Bacteria 1474
41 Ga0070709_10461581 3300005434 Bacteria 958
42 Ga0070714_101033293 3300005435 Bacteria 800
43 Ga0070714_101175214 3300005435 Bacteria 748
44 Ga0070714_101211618 3300005435 Bacteria 736
45 Ga0070713_100000191 3300005436 Bacteria 40649
46 Ga0070713_100000621 3300005436 Bacteria 22637
47 Ga0070713_100009875 3300005436 Bacteria 6867
48 Ga0070713_100394131 3300005436 Unclassified 1292
49 Ga0070710_10006664 3300005437 Bacteria 5559
50 Ga0070701_10167642 3300005438 Unclassified 1277
51 Ga0070701_10258040 3300005438 Bacteria 1055
52 Ga0070711_100000562 3300005439 Bacteria 19387
53 Ga0070711_100141071 3300005439 Bacteria 1807
54 Ga0070711_101009756 3300005439 Unclassified 714
55 Ga0070711_101561825 3300005439 Bacteria 576
56 Ga0070705_100044643 3300005440 Bacteria 2546
57 Ga0070708_100039815 3300005445 Bacteria 4114
58 Ga0070663_100052970 3300005455 Bacteria 2896
59 Ga0070663_100415218 3300005455 Bacteria 1103
60 Ga0070678_100002847 3300005456 Bacteria 9574
61 Ga0070662_100015044 3300005457 Bacteria 5176
62 Ga0070662_100034161 3300005457 Bacteria 3585
63 Ga0070662_100382651 3300005457 Bacteria 1158
64 Ga0070662_101244287 3300005457 Bacteria 640
65 Ga0070681_10053935 3300005458 Bacteria 4006
66 Ga0068867_100303648 3300005459 Bacteria 1317
67 Ga0070685_10001706 3300005466 Bacteria 11541
68 Ga0070706_100025279 3300005467 Bacteria 5465
69 Ga0070698_100156612 3300005471 Bacteria 2224
70 Ga0070699_100461878 3300005518 Bacteria 1151
71 Ga0070699_100718938 3300005518 Bacteria 913
72 Ga0070679_100027431 3300005530 Bacteria 5605
73 Ga0070679_100159685 3300005530 Bacteria 2229
74 Ga0070684_100020647 3300005535 Bacteria 5463
75 Ga0070684_100070714 3300005535 Bacteria 3071
76 Ga0070697_100011036 3300005536 Bacteria 7058
77 Ga0068853_100012925 3300005539 Bacteria 6805
78 Ga0068853_100199306 3300005539 Bacteria 1821
79 Ga0070672_100347514 3300005543 Bacteria 1264
80 Ga0070686_100232324 3300005544 Unclassified 1339
81 Ga0070686_100885840 3300005544 Bacteria 725
82 Ga0070695_100383240 3300005545 Bacteria 1061
83 Ga0070695_100780801 3300005545 Bacteria 764
84 Ga0070696_100016947 3300005546 Bacteria 4914
85 Ga0070696_100221773 3300005546 Bacteria 1419
86 Ga0070693_100018809 3300005547 Bacteria 3613
87 Ga0070693_100031585 3300005547 Bacteria 2904
88 Ga0070665_100130301 3300005548 Bacteria 2517
89 Ga0070704_100012707 3300005549 Bacteria 5209
90 Ga0068855_100007194 3300005563 Bacteria 13506
91 Ga0068855_100737398 3300005563 Bacteria 1051
92 Ga0070664_100000658 3300005564 Bacteria 26393
93 Ga0070664_100161415 3300005564 Bacteria 1983
94 Ga0070664_100453622 3300005564 Bacteria 1177
95 Ga0068857_100005799 3300005577 Bacteria 10556
96 Ga0068854_100049776 3300005578 Bacteria 2995
97 Ga0068854_100282114 3300005578 Bacteria 1338
98 Ga0068854_100373954 3300005578 Bacteria 1172
99 Ga0068856_100021309 3300005614 Bacteria 6298
100 Ga0068856_100032074 3300005614 Bacteria 5142
101 Ga0070702_100014764 3300005615 Bacteria 3970
102 Ga0070702_100094519 3300005615 Bacteria 1820
103 Ga0068852_100177379 3300005616 Bacteria 2001
104 Ga0068852_100224103 3300005616 Bacteria 1789
105 Ga0068852_100241207 3300005616 Bacteria 1727
106 Ga0068859_100001741 3300005617 Bacteria 22164
107 Ga0068864_100027331 3300005618 Bacteria 4818
108 Ga0068866_10001140 3300005718 Bacteria 11673
109 Ga0068866_11436845 3300005718 Bacteria 505
110 Ga0068861_101437426 3300005719 Bacteria 675
111 Ga0068851_10015536 3300005834 Bacteria 3629
112 Ga0068851_10018491 3300005834 Bacteria 3357
113 Ga0068870_10017607 3300005840 Bacteria 3435
114 Ga0068863_100007778 3300005841 Bacteria 10479
115 Ga0068858_100025618 3300005842 Bacteria 5488
116 Ga0068860_100595725 3300005843 Bacteria 1110
117 Ga0068860_101642551 3300005843 Bacteria 664
118 Ga0075363_100257489 3300006048 Bacteria 1006
119 Ga0070715_10110736 3300006163 Bacteria 1295
120 Ga0070716_100808323 3300006173 Bacteria 726
121 Ga0070712_100003612 3300006175 Bacteria 9538
122 Ga0070712_100004881 3300006175 Bacteria 8295
123 Ga0070712_101277988 3300006175 Bacteria 639
124 Ga0070712_101489584 3300006175 Bacteria 591
125 Ga0075362_10587777 3300006177 Bacteria 575
126 Ga0075362_10712405 3300006177 Bacteria 524
127 Ga0075367_10492742 3300006178 Unclassified 777
128 Ga0097621_100227817 3300006237 Bacteria 1626
129 Ga0097621_102096495 3300006237 Bacteria 541
130 Ga0068871_100225108 3300006358 Bacteria 1626
131 Ga0068871_100499180 3300006358 Unclassified 1096
132 Ga0068871_101098175 3300006358 Bacteria 744
133 Ga0075428_102348913 3300006844 Bacteria 548
134 Ga0075430_100457452 3300006846 Bacteria 1053
135 Ga0075430_100905016 3300006846 Bacteria 727
136 Ga0075433_10879135 3300006852 Bacteria 782
137 Ga0075434_100243253 3300006871 Bacteria 1819
138 Ga0075434_100369726 3300006871 Unclassified 1455
139 Ga0075434_102488385 3300006871 Bacteria 519
140 Ga0068865_100147061 3300006881 Bacteria 1783
141 Ga0075436_100220249 3300006914 Bacteria 1346
142 Ga0097620_100001741 3300006931 Bacteria 22164
143 Ga0105250_10535957 3300009092 Bacteria 535
144 Ga0105240_10001889 3300009093 Bacteria 34824
145 Ga0105240_10087092 3300009093 Bacteria 3825
146 Ga0105245_10009343 3300009098 Bacteria 8553
147 Ga0105245_10009415 3300009098 Bacteria 8519
148 Ga0105245_10046677 3300009098 Bacteria 3871
149 Ga0105245_10238348 3300009098 Bacteria 1762
150 Ga0105247_10014436 3300009101 Bacteria 4739
151 Ga0105243_10119280 3300009148 Bacteria 2221
152 Ga0105243_12548382 3300009148 Bacteria 551
153 Ga0105241_10011046 3300009174 Bacteria 6625
154 Ga0105241_10027934 3300009174 Bacteria 4201
155 Ga0105242_10008131 3300009176 Bacteria 8072
156 Ga0105242_10115527 3300009176 Bacteria 2294
157 Ga0105248_10013308 3300009177 Bacteria 9056
158 Ga0105248_10111798 3300009177 Bacteria 3081
159 Ga0105248_10818849 3300009177 Bacteria 1051
160 Ga0105248_11352713 3300009177 Bacteria 806
161 Ga0105237_11313250 3300009545 Bacteria 730
162 Ga0105238_10009503 3300009551 Bacteria 9731
163 Ga0105238_10086589 3300009551 Bacteria 3120
164 Ga0105238_10884733 3300009551 Bacteria 911
165 Ga0105249_11647019 3300009553 Bacteria 714
166 Ga0105246_10082186 3300011119 Bacteria 2298
167 Ga0105246_10566276 3300011119 Bacteria 976
168 Ga0157373_10013745 3300013100 Bacteria 5935
169 Ga0157373_10164214 3300013100 Bacteria 1562
170 Ga0157371_10036382 3300013102 Bacteria 3525
171 Ga0157370_10046754 3300013104 Bacteria 4150
172 Ga0157370_10221282 3300013104 Bacteria 1753
173 Ga0157369_10042059 3300013105 Bacteria 4986
174 Ga0157374_10001809 3300013296 Bacteria 18004
175 Ga0157374_10261469 3300013296 Bacteria 1705
176 Ga0157378_10009283 3300013297 Bacteria 8568
177 Ga0157378_10009954 3300013297 Bacteria 8288
178 Ga0157378_11205903 3300013297 Bacteria 796
179 Ga0163162_10011811 3300013306 Bacteria 8518
180 Ga0163162_10078481 3300013306 Bacteria 3367
181 Ga0163162_10343668 3300013306 Bacteria 1625
182 Ga0157372_10006706 3300013307 Bacteria 12248
183 Ga0157372_10543483 3300013307 Unclassified 1354
184 Ga0157372_10924433 3300013307 Bacteria 1012
185 Ga0157375_10008616 3300013308 Bacteria 8929
186 Ga0163163_10001352 3300014325 Bacteria 20693
187 Ga0157380_10376579 3300014326 Bacteria 1338
188 Ga0157380_12382496 3300014326 Bacteria 594
189 Ga0182008_10319443 3300014497 Bacteria 817
190 Ga0157377_10005762 3300014745 Bacteria 5846
191 Ga0157377_10336930 3300014745 Bacteria 1007
192 Ga0157377_10488912 3300014745 Bacteria 858
193 Ga0157379_10006078 3300014968 Bacteria 10396
194 Ga0157379_12065483 3300014968 Bacteria 564
195 Ga0157376_10005980 3300014969 Bacteria 8550
196 Ga0157376_10006034 3300014969 Bacteria 8519
197 Ga0163161_10085588 3300017792 Bacteria 2326
198 Ga0206356_10597502 3300020070 Bacteria 529
199 Ga0213874_10189473 3300021377 Bacteria 735
200 Ga0207656_10036142 3300025321 Bacteria 2072
201 Ga0207656_10058146 3300025321 Bacteria 1688
202 Ga0207653_10044574 3300025885 Bacteria 1463
203 Ga0207692_10033157 3300025898 Bacteria 2488
204 Ga0207692_10062830 3300025898 Bacteria 1928
205 Ga0207642_10000592 3300025899 Bacteria 11152
206 Ga0207680_10002576 3300025903 Bacteria 8460
207 Ga0207680_10353120 3300025903 Bacteria 1033
208 Ga0207685_10002717 3300025905 Bacteria 4120
209 Ga0207699_10166127 3300025906 Bacteria 1473
210 Ga0207699_10918925 3300025906 Bacteria 646
211 Ga0207645_10020446 3300025907 Bacteria 4333
212 Ga0207643_10011278 3300025908 Bacteria 4826
213 Ga0207705_10452506 3300025909 Bacteria 996
214 Ga0207684_10448098 3300025910 Bacteria 1108
215 Ga0207654_10013929 3300025911 Bacteria 4145
216 Ga0207654_10208034 3300025911 Bacteria 1292
217 Ga0207654_10475349 3300025911 Bacteria 880
218 Ga0207707_10076043 3300025912 Bacteria 2930
219 Ga0207707_10746854 3300025912 Unclassified 818
220 Ga0207695_10061236 3300025913 Bacteria 3891
221 Ga0207695_10434844 3300025913 Bacteria 1196
222 Ga0207671_10196135 3300025914 Bacteria 1576
223 Ga0207693_10000652 3300025915 Bacteria 31091
224 Ga0207693_10260850 3300025915 Bacteria 1359
225 Ga0207663_10002608 3300025916 Bacteria 8679
226 Ga0207663_10218515 3300025916 Bacteria 1385
227 Ga0207663_10485671 3300025916 Bacteria 958
228 Ga0207663_10762508 3300025916 Unclassified 769
229 Ga0207660_10098203 3300025917 Bacteria 2184
230 Ga0207660_10347569 3300025917 Bacteria 1188
231 Ga0207662_10118900 3300025918 Bacteria 1655
232 Ga0207662_10323975 3300025918 Bacteria 1029
233 Ga0207657_10007901 3300025919 Bacteria 10850
234 Ga0207657_10032956 3300025919 Bacteria 4674
235 Ga0207657_10234531 3300025919 Bacteria 1467
236 Ga0207649_10011486 3300025920 Bacteria 4884
237 Ga0207649_10175581 3300025920 Bacteria 1496
238 Ga0207652_10043014 3300025921 Bacteria 3846
239 Ga0207652_10140590 3300025921 Bacteria 2158
240 Ga0207646_10107936 3300025922 Bacteria 2497
241 Ga0207681_10202779 3300025923 Bacteria 1524
242 Ga0207694_10005853 3300025924 Bacteria 9423
243 Ga0207694_10173787 3300025924 Unclassified 1745
244 Ga0207650_10033734 3300025925 Bacteria 3709
245 Ga0207650_10841056 3300025925 Bacteria 778
246 Ga0207687_10002403 3300025927 Bacteria 12697
247 Ga0207687_10009624 3300025927 Bacteria 6317
248 Ga0207687_10073134 3300025927 Bacteria 2454
249 Ga0207687_10241647 3300025927 Bacteria 1431
250 Ga0207700_10000073 3300025928 Bacteria 61784
251 Ga0207700_10006059 3300025928 Bacteria 7282
252 Ga0207700_10006798 3300025928 Bacteria 6950
253 Ga0207700_10954223 3300025928 Unclassified 768
254 Ga0207664_10047118 3300025929 Bacteria 3385
255 Ga0207664_10049165 3300025929 Bacteria 3319
256 Ga0207664_10889759 3300025929 Bacteria 800
257 Ga0207664_11417614 3300025929 Unclassified 615
258 Ga0207644_10001544 3300025931 Bacteria 14840
259 Ga0207644_10123185 3300025931 Bacteria 1976
260 Ga0207690_10192769 3300025932 Bacteria 1542
261 Ga0207706_10008050 3300025933 Bacteria 9728
262 Ga0207706_10045117 3300025933 Bacteria 3906
263 Ga0207706_10094807 3300025933 Bacteria 2625
264 Ga0207686_10016224 3300025934 Bacteria 4176
265 Ga0207686_10334010 3300025934 Bacteria 1136
266 Ga0207670_10042018 3300025936 Bacteria 3010
267 Ga0207669_10074261 3300025937 Bacteria 2149
268 Ga0207669_10109132 3300025937 Bacteria 1850
269 Ga0207704_10036269 3300025938 Bacteria 2836
270 Ga0207704_10524026 3300025938 Bacteria 959
271 Ga0207665_10006908 3300025939 Bacteria 7511
272 Ga0207665_10013379 3300025939 Bacteria 5394
273 Ga0207691_10046844 3300025940 Bacteria 3971
274 Ga0207711_10000087 3300025941 Bacteria 98302
275 Ga0207711_11734469 3300025941 Bacteria 568
276 Ga0207711_11975819 3300025941 Bacteria 526
277 Ga0207689_10092657 3300025942 Bacteria 2482
278 Ga0207689_10140083 3300025942 Bacteria 1992
279 Ga0207689_10498412 3300025942 Bacteria 1020
280 Ga0207661_10009752 3300025944 Bacteria 6897
281 Ga0207661_10080276 3300025944 Bacteria 2691
282 Ga0207679_10003953 3300025945 Bacteria 9205
283 Ga0207679_10033839 3300025945 Bacteria 3600
284 Ga0207679_10876885 3300025945 Bacteria 820
285 Ga0207667_10020237 3300025949 Bacteria 7405
286 Ga0207667_10388603 3300025949 Bacteria 1421
287 Ga0207651_10004718 3300025960 Bacteria 6922
288 Ga0207668_10494937 3300025972 Bacteria 1051
289 Ga0207640_10004420 3300025981 Bacteria 7627
290 Ga0207640_10265846 3300025981 Bacteria 1339
291 Ga0207640_10807485 3300025981 Bacteria 813
292 Ga0207640_11794150 3300025981 Bacteria 554
293 Ga0207658_10034077 3300025986 Bacteria 3636
294 Ga0207658_10187491 3300025986 Bacteria 1716
295 Ga0207658_11685132 3300025986 Bacteria 579
296 Ga0207677_10003281 3300026023 Bacteria 8554
297 Ga0207677_10041797 3300026023 Bacteria 3034
298 Ga0207703_10003435 3300026035 Bacteria 13293
299 Ga0207639_10129456 3300026041 Bacteria 2087
300 Ga0207639_10334991 3300026041 Bacteria 1347
301 Ga0207639_11936637 3300026041 Bacteria 550
302 Ga0207639_12076710 3300026041 Bacteria 529
303 Ga0207678_10007957 3300026067 Bacteria 9349
304 Ga0207678_10207610 3300026067 Bacteria 1675
305 Ga0207708_10623523 3300026075 Bacteria 915
306 Ga0207702_10007712 3300026078 Bacteria 9141
307 Ga0207702_10089970 3300026078 Bacteria 2685
308 Ga0207702_10141546 3300026078 Bacteria 2177
309 Ga0207702_11193922 3300026078 Bacteria 755
310 Ga0207702_11426675 3300026078 Bacteria 686
311 Ga0207641_10008086 3300026088 Bacteria 8714
312 Ga0207648_10010002 3300026089 Bacteria 9024
313 Ga0207676_10000294 3300026095 Bacteria 43081
314 Ga0207674_10000140 3300026116 Bacteria 84173
315 Ga0207674_10002122 3300026116 Bacteria 25063
316 Ga0207675_100195812 3300026118 Bacteria 1940
317 Ga0207683_10000355 3300026121 Bacteria 42024
318 Ga0207698_10016336 3300026142 Bacteria 5000
319 Ga0207698_10016903 3300026142 Bacteria 4933
320 Ga0207698_10061360 3300026142 Bacteria 2929
321 Ga0268266_10027032 3300028379 Bacteria 4882
322 Ga0268264_10007222 3300028381 Bacteria 9303
323 Ga0268264_10014173 3300028381 Bacteria 6556
324 Ga0307515_10700302 3300028794 Bacteria 629
325 Ga0265762_1091070 3300030760 Bacteria 665
326 Ga0265760_10112625 3300031090 Bacteria 868
327 Ga0265325_10017881 3300031241 Bacteria 3937
328 Ga0265339_10092815 3300031249 Bacteria 1580
329 Ga0307509_10981369 3300031507 Bacteria 511
330 Ga0307408_100001498 3300031548 Bacteria 17329
331 Ga0307408_100849822 3300031548 Bacteria 832
332 Ga0265342_10200524 3300031712 Bacteria 1084
333 Ga0316576_10132045 3300031727 Bacteria 1878
334 Ga0316578_10037032 3300031728 Bacteria 2809
335 Ga0307516_10000674 3300031730 Bacteria 46280
336 Ga0307405_10001138 3300031731 Bacteria 10916
337 Ga0316577_10015985 3300031733 Bacteria 4130
338 Ga0307413_10003003 3300031824 Bacteria 6998
339 Ga0307410_10001643 3300031852 Bacteria 10280
340 Ga0307406_10002738 3300031901 Bacteria 9617
341 Ga0307407_10006282 3300031903 Bacteria 5255
342 Ga0307412_10032795 3300031911 Bacteria 3295
343 Ga0307412_10737151 3300031911 Bacteria 849
344 Ga0307409_100014130 3300031995 Bacteria 5176
345 Ga0307416_100007511 3300032002 Bacteria 6941
346 Ga0307416_102881183 3300032002 Bacteria 575
347 Ga0307414_10033734 3300032004 Bacteria 3386
348 Ga0307414_10327583 3300032004 Bacteria 1306
349 Ga0307411_10018866 3300032005 Bacteria 3969
350 Ga0307411_11720146 3300032005 Bacteria 581
351 Ga0307415_100001765 3300032126 Bacteria 10567
352 Ga0316580_10131388 3300032139 Bacteria 767
353 Ga0316588_1113511 3300033528 Bacteria 683
354 Ga0373926_0097590 3300035083 Bacteria 1096
355 Ga0373926_0281458 3300035083 Bacteria 647
356 Ga0373926_0293307 3300035083 Bacteria 634
357 Ga0373934_0001028 3300035086 Bacteria 10066
358 Ga0373944_0099832 3300035089 Bacteria 979
359 Ga0373944_0127025 3300035089 Bacteria 883
360 Ga0373923_0000349 3300035111 Bacteria 10443
361 Ga0373932_0118639 3300035112 Bacteria 880
362 Ga0373936_0062980 3300035113 Unclassified 1517
363 Ga0373945_0063880 3300035116 Bacteria 1379
364 Ga0373953_0006544 3300035117 Bacteria 3845
365 Ga0373954_0001030 3300035118 Bacteria 11058
366 Ga0373956_0002915 3300035119 Bacteria 6921
367 Ga0373956_0084820 3300035119 Bacteria 1456
368 Ga0373957_0000571 3300035120 Bacteria 9332
369 Ga0373943_0061726 3300035170 Bacteria 1874
370 Ga0373943_0061733 3300035170 Bacteria 1874
371 Ga0373943_0220810 3300035170 Bacteria 1055
372 Ga0373946_0044870 3300035171 Bacteria 1826
373 Ga0373946_0319524 3300035171 Bacteria 771
374 Ga0373955_0046454 3300035172 Bacteria 2347
375 Ga0373962_0177309 3300035242 Bacteria 711
376 Ga0316574_0000470 3300035398 Bacteria 16292
377 Ga0373924_0003473 3300035410 Bacteria 5426
378 Ga0373931_0140471 3300035691 Unclassified 1398
379 Ga0373935_0059111 3300035692 Bacteria 2449
380 Ga0373935_0104218 3300035692 Bacteria 1874
381 Ga0373935_0329319 3300035692 Bacteria 1085
382 Ga0373927_0009005 3300035695 Bacteria 6701
383 Ga0373927_0220995 3300035695 Bacteria 1244
384 Ga0373927_0717627 3300035695 Bacteria 660
385 Ga0373933_0004932 3300035724 Bacteria 7279
386 Ga0373933_0139582 3300035724 Bacteria 1529
387 Ga0373947_0031091 3300035725 Bacteria 3140
388 Ga0373947_0081985 3300035725 Bacteria 1998
389 Ga0373947_0130745 3300035725 Bacteria 1602
390 Ga0373937_0001093 3300036401 Bacteria 22840
391 Ga0373937_0056352 3300036401 Bacteria 3609
392 Ga0373937_0467075 3300036401 Bacteria 1198
393 Ga0373937_0670776 3300036401 Bacteria 983
394 Ga0316582_0001306 3300036647 Bacteria 10788
395 Ga0316584_0006760 3300036712 Bacteria 7780
396 Ga0373925_0013694 3300037068 Bacteria 5872
397 Ga0373925_0087135 3300037068 Bacteria 2383
398 Ga0373925_0410320 3300037068 Bacteria 1105
399 Ga0373925_0483835 3300037068 Bacteria 1015
400 Ga0395905_0444831 3300037471 Bacteria 1193
401 Ga0436360_0649202 3300039438 Unclassified 832
402 Ga0436361_0784397 3300039447 Bacteria 600
403 Ga0436363_0720287 3300039450 Bacteria 919
404 Ga0436362_0139994 3300039453 Bacteria 500
405 Ga0451798_0126328 3300041458 Bacteria 1470
406 Ga0451800_1285167 3300041459 Bacteria 932
407 Ga0451851_1060694 3300041507 Bacteria 1147
408 Ga0451853_0980077 3300041512 Bacteria 1236
409 Ga0439448_0112418 3300042005 Bacteria 931
410 Ga0451577_0023224 3300042876 Bacteria 5657
411 Ga0451577_0174985 3300042876 Bacteria 1934
412 Ga0466961_0058801 3300044693 Bacteria 2445
413 Ga0453684_0031880 3300044712 Bacteria 7391
414 Ga0466957_0545307 3300044842 Bacteria 808
415 Ga0466959_0035337 3300045049 Bacteria 3697
416 Ga0451576_0037379 3300045051 Bacteria 5143
417 Ga0451576_0457900 3300045051 Bacteria 1339
418 Ga0451576_1325122 3300045051 Bacteria 750
419 Ga0451576_2535605 3300045051 Bacteria 523
420 Ga0495629_0809823 3300046459 Bacteria 618
421 Ga0495651_0537135 3300046462 Bacteria 744
422 Ga0495653_0098730 3300046463 Bacteria 2120
423 Ga0495650_0167688 3300046471 Bacteria 779
424 Ga0495580_0039176 3300046472 Bacteria 3390
425 Ga0495580_0168775 3300046472 Unclassified 1513
426 Ga0495582_0063949 3300046473 Bacteria 2031
427 Ga0495582_0511366 3300046473 Unclassified 694
428 Ga0495639_0028687 3300046475 Bacteria 2466
429 Ga0495662_0045115 3300046476 Bacteria 2127
430 Ga0495664_0148810 3300046477 Bacteria 1420
431 Ga0495608_0391091 3300046511 Unclassified 851
432 Ga0495628_0145364 3300046516 Bacteria 1808
433 Ga0495630_0066871 3300046517 Bacteria 2702
434 Ga0495630_0823938 3300046517 Bacteria 708
435 Ga0495652_0125994 3300046529 Bacteria 2035
436 Ga0495665_0032779 3300046531 Bacteria 2779
437 Ga0495640_0271769 3300046533 Bacteria 1057
438 Ga0495586_0168991 3300046535 Unclassified 1235
439 Ga0495587_0092653 3300046536 Bacteria 1745
440 Ga0495621_0046416 3300046539 Bacteria 1541
441 Ga0495645_0026388 3300046543 Bacteria 4217
442 Ga0495645_0670707 3300046543 Bacteria 632
443 Ga0495667_0224935 3300046559 Bacteria 1197
444 Ga0495634_0377834 3300046642 Bacteria 845
445 Ga0495635_0012559 3300046663 Bacteria 5935
446 Ga0495659_0066223 3300046664 Bacteria 1345
447 Ga0495588_0100292 3300046674 Bacteria 1521
448 Ga0495657_0132288 3300046675 Bacteria 1562
449 Ga0495623_0016408 3300046679 Bacteria 4785
450 Ga0495623_0353962 3300046679 Bacteria 799
451 Ga0495647_0004099 3300046681 Bacteria 4710
452 Ga0495658_0052947 3300046683 Bacteria 2303
453 Ga0495669_0382083 3300046684 Bacteria 682
454 Ga0495613_0036154 3300046689 Bacteria 3662
455 Ga0495600_0060078 3300046809 Bacteria 2482
456 Ga0495581_0007795 3300047315 Bacteria 6200
457 Ga0495674_0134572 3300047319 Bacteria 2081
458 Ga0495674_1243084 3300047319 Bacteria 561
459 Ga0495680_0058477 3300047322 Bacteria 2979
460 Ga0495675_0063091 3300047444 Bacteria 2345
461 Ga0495684_0010531 3300047471 Bacteria 7149
462 Ga0495686_0051074 3300047472 Unclassified 2596
463 Ga0495593_0103076 3300047673 Bacteria 1462
464 Ga0495602_0134711 3300048088 Bacteria 1965
465 Ga0495602_0777646 3300048088 Bacteria 644
466 Ga0496100_0491507 3300048903 Bacteria 945
467 Ga0496100_1309431 3300048903 Bacteria 572
468 Ga0496101_0062991 3300048904 Bacteria 2698
469 Ga0496102_0028779 3300048905 Bacteria 4967
470 Ga0496102_0467056 3300048905 Bacteria 1183
471 Ga0496103_0132828 3300048906 Bacteria 1590
472 Ga0496104_0015746 3300048907 Bacteria 6859
473 Ga0496105_0004395 3300048908 Bacteria 10614
474 Ga0496107_0243964 3300048910 Bacteria 1337
475 Ga0496107_0619921 3300048910 Unclassified 799
476 Ga0496108_0028601 3300048911 Bacteria 4612
477 Ga0496109_0004450 3300048912 Bacteria 11702
478 Ga0496109_2007126 3300048912 Bacteria 510
479 Ga0496110_0187003 3300048913 Bacteria 1881
480 Ga0496112_0003789 3300048915 Bacteria 12634
481 Ga0496112_0066831 3300048915 Bacteria 3548
482 Ga0496114_0127683 3300048917 Bacteria 2193
483 Ga0496115_0066673 3300048918 Bacteria 2909
484 Ga0496124_0108369 3300048927 Bacteria 2240
485 Ga0501298_147672 3300049521 Bacteria 573
486 Ga0501040_0206737 3300049576 Bacteria 1395
487 Ga0501070_0815932 3300049586 Bacteria 732
488 Ga0501071_0496397 3300049587 Bacteria 936
489 Ga0501072_1069288 3300049588 Bacteria 628
490 Ga0501074_0933249 3300049590 Bacteria 611
491 Ga0501075_0198057 3300049591 Bacteria 1532
492 Ga0501257_030857 3300049686 Bacteria 1291
493 Ga0501219_025902 3300049703 Bacteria 532
494 Ga0501045_0423135 3300049824 Bacteria 991
495 Ga0501204_042288 3300049850 Bacteria 672
496 nmdc:mga0k408_868337_c1 3300050493 Bacteria 524
497 nmdc:mga06z11_443174_c1 3300050494 Unclassified 784
498 nmdc:mga06z11_911794_c1 3300050494 Bacteria 535
499 nmdc:mga0n895_365840_c1 3300050512 Unclassified 1460
500 nmdc:mga08x19_372126_c1 3300050514 Bacteria 1000
501 Ga0495601_0017347 3300053077 Bacteria 4369
502 Ga0495601_0150133 3300053077 Bacteria 1521
503 Ga0495612_0029135 3300053078 Bacteria 2223
504 Ga0495612_0082889 3300053078 Bacteria 1349
505 Ga0495595_0024784 3300053084 Bacteria 2652
506 Ga0495619_0169917 3300053085 Bacteria 1507
507 Ga0495619_0347338 3300053085 Bacteria 1026
508 Ga0500627_0505794 3300053158 Bacteria 502
509 Ga0501084_0313078 3300054114 Bacteria 1326

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047319 Ga0495674_1243084 Ga0495674_1243084_12_257 69
2 3300006852 Ga0075433_10879135 Ga0075433_108791352 78
3 3300006846 Ga0075430_100905016 Ga0075430_1009050162 79
4 3300032002 Ga0307416_102881183 Ga0307416_1028811832 79
5 3300049521 Ga0501298_147672 Ga0501298_147672_242_502 79
6 3300049587 Ga0501071_0496397 Ga0501071_0496397_75_317 79
7 3300049703 Ga0501219_025902 Ga0501219_025902_242_499 79
8 3300049824 Ga0501045_0423135 Ga0501045_0423135_341_583 79
9 3300054114 Ga0501084_0313078 Ga0501084_0313078_944_1186 79
10 3300005434 Ga0070709_10182557 Ga0070709_101825573 80
11 3300005435 Ga0070714_101175214 Ga0070714_1011752142 80
12 3300005436 Ga0070713_100000191 Ga0070713_10000019118 80
13 3300005436 Ga0070713_100009875 Ga0070713_1000098753 80
14 3300005471 Ga0070698_100156612 Ga0070698_1001566123 80
15 3300005563 Ga0068855_100737398 Ga0068855_1007373982 80
16 3300005616 Ga0068852_100177379 Ga0068852_1001773792 80
17 3300006175 Ga0070712_101277988 Ga0070712_1012779882 80
18 3300006914 Ga0075436_100220249 Ga0075436_1002202491 80
19 3300009093 Ga0105240_10087092 Ga0105240_100870924 80
20 3300009148 Ga0105243_12548382 Ga0105243_125483822 80
21 3300009177 Ga0105248_10111798 Ga0105248_101117982 80
22 3300009551 Ga0105238_10086589 Ga0105238_100865894 80
23 3300011119 Ga0105246_10082186 Ga0105246_100821863 80
24 3300013100 Ga0157373_10164214 Ga0157373_101642141 80
25 3300013102 Ga0157371_10036382 Ga0157371_100363821 80
26 3300014497 Ga0182008_10319443 Ga0182008_103194432 80
27 3300025321 Ga0207656_10058146 Ga0207656_100581461 80
28 3300025898 Ga0207692_10062830 Ga0207692_100628302 80
29 3300025906 Ga0207699_10166127 Ga0207699_101661272 80
30 3300025913 Ga0207695_10434844 Ga0207695_104348442 80
31 3300025914 Ga0207671_10196135 Ga0207671_101961353 80
32 3300025915 Ga0207693_10260850 Ga0207693_102608502 80
33 3300025917 Ga0207660_10347569 Ga0207660_103475691 80
34 3300025918 Ga0207662_10323975 Ga0207662_103239753 80
35 3300025921 Ga0207652_10140590 Ga0207652_101405903 80
36 3300025923 Ga0207681_10202779 Ga0207681_102027791 80
37 3300025925 Ga0207650_10841056 Ga0207650_108410562 80
38 3300025928 Ga0207700_10000073 Ga0207700_1000007316 80
39 3300025928 Ga0207700_10006798 Ga0207700_100067987 80
40 3300025929 Ga0207664_10047118 Ga0207664_100471182 80
41 3300025932 Ga0207690_10192769 Ga0207690_101927691 80
42 3300025939 Ga0207665_10013379 Ga0207665_100133794 80
43 3300025944 Ga0207661_10080276 Ga0207661_100802763 80
44 3300025949 Ga0207667_10388603 Ga0207667_103886033 80
45 3300025986 Ga0207658_11685132 Ga0207658_116851322 80
46 3300026041 Ga0207639_10129456 Ga0207639_101294563 80
47 3300026118 Ga0207675_100195812 Ga0207675_1001958123 80
48 3300035116 Ga0373945_0063880 Ga0373945_0063880_996_1274 80
49 3300035695 Ga0373927_0220995 Ga0373927_0220995_634_912 80
50 3300037068 Ga0373925_0013694 Ga0373925_0013694_1321_1599 80
51 3300042005 Ga0439448_0112418 Ga0439448_0112418_183_461 80
52 3300045051 Ga0451576_0457900 Ga0451576_0457900_313_561 80
53 3300045051 Ga0451576_2535605 Ga0451576_2535605_121_369 80
54 3300046472 Ga0495580_0039176 Ga0495580_0039176_1812_2090 80
55 3300046473 Ga0495582_0063949 Ga0495582_0063949_1323_1601 80
56 3300046475 Ga0495639_0028687 Ga0495639_0028687_2005_2283 80
57 3300046517 Ga0495630_0066871 Ga0495630_0066871_593_871 80
58 3300046531 Ga0495665_0032779 Ga0495665_0032779_212_490 80
59 3300046663 Ga0495635_0012559 Ga0495635_0012559_1138_1416 80
60 3300046679 Ga0495623_0353962 Ga0495623_0353962_511_789 80
61 3300046683 Ga0495658_0052947 Ga0495658_0052947_171_449 80
62 3300046689 Ga0495613_0036154 Ga0495613_0036154_1213_1491 80
63 3300047471 Ga0495684_0010531 Ga0495684_0010531_6441_6719 80
64 3300047673 Ga0495593_0103076 Ga0495593_0103076_32_310 80
65 3300048905 Ga0496102_0028779 Ga0496102_0028779_3994_4272 80
66 3300048915 Ga0496112_0066831 Ga0496112_0066831_175_453 80
67 3300050514 nmdc:mga08x19_372126_c1 nmdc:mga08x19_372126_c1_340_618 80
68 3300005356 Ga0070674_100220166 Ga0070674_1002201662 84
69 3300005364 Ga0070673_101722328 Ga0070673_1017223281 84
70 3300005438 Ga0070701_10258040 Ga0070701_102580402 84
71 3300005457 Ga0070662_100382651 Ga0070662_1003826512 84
72 3300005457 Ga0070662_101244287 Ga0070662_1012442872 84
73 3300005544 Ga0070686_100885840 Ga0070686_1008858402 84
74 3300005718 Ga0068866_11436845 Ga0068866_114368452 84
75 3300009092 Ga0105250_10535957 Ga0105250_105359572 84
76 3300009098 Ga0105245_10238348 Ga0105245_102383482 84
77 3300013306 Ga0163162_10343668 Ga0163162_103436683 84
78 3300014745 Ga0157377_10488912 Ga0157377_104889122 84
79 3300014968 Ga0157379_12065483 Ga0157379_120654832 84
80 3300025927 Ga0207687_10241647 Ga0207687_102416472 84
81 3300025933 Ga0207706_10094807 Ga0207706_100948072 84
82 3300025937 Ga0207669_10109132 Ga0207669_101091323 84
83 3300025938 Ga0207704_10524026 Ga0207704_105240261 84
84 3300025972 Ga0207668_10494937 Ga0207668_104949372 84
85 3300025981 Ga0207640_11794150 Ga0207640_117941502 84
86 3300048903 Ga0496100_1309431 Ga0496100_1309431_25_279 84
87 3300048912 Ga0496109_2007126 Ga0496109_2007126_197_451 84
88 3300049686 Ga0501257_030857 Ga0501257_030857_552_824 84
89 3300049850 Ga0501204_042288 Ga0501204_042288_217_489 84
90 3300001978 JGI24747J21853_1048555 JGI24747J21853_10485552 85
91 3300005327 Ga0070658_11064003 Ga0070658_110640032 85
92 3300005328 Ga0070676_10121496 Ga0070676_101214963 85
93 3300005329 Ga0070683_100055831 Ga0070683_1000558313 85
94 3300005330 Ga0070690_100003078 Ga0070690_1000030783 85
95 3300005331 Ga0070670_100020490 Ga0070670_1000204907 85
96 3300005331 Ga0070670_100343403 Ga0070670_1003434033 85
97 3300005334 Ga0068869_100023785 Ga0068869_1000237856 85
98 3300005334 Ga0068869_100537084 Ga0068869_1005370842 85
99 3300005335 Ga0070666_10004746 Ga0070666_1000474611 85
100 3300005335 Ga0070666_11338461 Ga0070666_113384612 85
101 3300005336 Ga0070680_100011375 Ga0070680_1000113754 85
102 3300005336 Ga0070680_100382310 Ga0070680_1003823103 85
103 3300005337 Ga0070682_100013128 Ga0070682_1000131282 85
104 3300005338 Ga0068868_100015847 Ga0068868_1000158478 85
105 3300005338 Ga0068868_102122145 Ga0068868_1021221452 85
106 3300005339 Ga0070660_100022673 Ga0070660_1000226732 85
107 3300005339 Ga0070660_100044088 Ga0070660_1000440883 85
108 3300005339 Ga0070660_100467982 Ga0070660_1004679822 85
109 3300005340 Ga0070689_100006592 Ga0070689_1000065922 85
110 3300005341 Ga0070691_10289101 Ga0070691_102891011 85
111 3300005343 Ga0070687_100191436 Ga0070687_1001914363 85
112 3300005344 Ga0070661_100015818 Ga0070661_1000158183 85
113 3300005344 Ga0070661_100094025 Ga0070661_1000940253 85
114 3300005345 Ga0070692_10004689 Ga0070692_100046896 85
115 3300005345 Ga0070692_10234915 Ga0070692_102349152 85
116 3300005355 Ga0070671_100206171 Ga0070671_1002061714 85
117 3300005364 Ga0070673_100002265 Ga0070673_1000022657 85
118 3300005365 Ga0070688_100012315 Ga0070688_1000123151 85
119 3300005366 Ga0070659_100068867 Ga0070659_1000688673 85
120 3300005366 Ga0070659_100394320 Ga0070659_1003943202 85
121 3300005367 Ga0070667_100259151 Ga0070667_1002591511 85
122 3300005367 Ga0070667_100428652 Ga0070667_1004286521 85
123 3300005406 Ga0070703_10374871 Ga0070703_103748712 85
124 3300005434 Ga0070709_10461581 Ga0070709_104615812 85
125 3300005435 Ga0070714_101033293 Ga0070714_1010332931 85
126 3300005435 Ga0070714_101211618 Ga0070714_1012116182 85
127 3300005436 Ga0070713_100000621 Ga0070713_1000006215 85
128 3300005436 Ga0070713_100394131 Ga0070713_1003941312 85
129 3300005437 Ga0070710_10006664 Ga0070710_100066643 85
130 3300005438 Ga0070701_10167642 Ga0070701_101676422 85
131 3300005439 Ga0070711_100000562 Ga0070711_10000056213 85
132 3300005439 Ga0070711_100141071 Ga0070711_1001410714 85
133 3300005439 Ga0070711_101009756 Ga0070711_1010097562 85
134 3300005439 Ga0070711_101561825 Ga0070711_1015618251 85
135 3300005440 Ga0070705_100044643 Ga0070705_1000446432 85
136 3300005445 Ga0070708_100039815 Ga0070708_1000398151 85
137 3300005455 Ga0070663_100052970 Ga0070663_1000529704 85
138 3300005455 Ga0070663_100415218 Ga0070663_1004152182 85
139 3300005456 Ga0070678_100002847 Ga0070678_1000028472 85
140 3300005457 Ga0070662_100015044 Ga0070662_1000150443 85
141 3300005457 Ga0070662_100034161 Ga0070662_1000341613 85
142 3300005458 Ga0070681_10053935 Ga0070681_100539356 85
143 3300005459 Ga0068867_100303648 Ga0068867_1003036482 85
144 3300005466 Ga0070685_10001706 Ga0070685_100017065 85
145 3300005467 Ga0070706_100025279 Ga0070706_1000252795 85
146 3300005518 Ga0070699_100461878 Ga0070699_1004618782 85
147 3300005518 Ga0070699_100718938 Ga0070699_1007189382 85
148 3300005530 Ga0070679_100159685 Ga0070679_1001596852 85
149 3300005535 Ga0070684_100020647 Ga0070684_1000206474 85
150 3300005535 Ga0070684_100070714 Ga0070684_1000707144 85
151 3300005536 Ga0070697_100011036 Ga0070697_1000110368 85
152 3300005539 Ga0068853_100012925 Ga0068853_1000129255 85
153 3300005539 Ga0068853_100199306 Ga0068853_1001993062 85
154 3300005543 Ga0070672_100347514 Ga0070672_1003475141 85
155 3300005544 Ga0070686_100232324 Ga0070686_1002323242 85
156 3300005545 Ga0070695_100383240 Ga0070695_1003832401 85
157 3300005545 Ga0070695_100780801 Ga0070695_1007808011 85
158 3300005546 Ga0070696_100016947 Ga0070696_1000169477 85
159 3300005546 Ga0070696_100221773 Ga0070696_1002217733 85
160 3300005547 Ga0070693_100018809 Ga0070693_1000188094 85
161 3300005547 Ga0070693_100031585 Ga0070693_1000315854 85
162 3300005548 Ga0070665_100130301 Ga0070665_1001303013 85
163 3300005549 Ga0070704_100012707 Ga0070704_1000127074 85
164 3300005563 Ga0068855_100007194 Ga0068855_10000719411 85
165 3300005564 Ga0070664_100000658 Ga0070664_10000065829 85
166 3300005564 Ga0070664_100161415 Ga0070664_1001614152 85
167 3300005564 Ga0070664_100453622 Ga0070664_1004536222 85
168 3300005577 Ga0068857_100005799 Ga0068857_1000057995 85
169 3300005578 Ga0068854_100049776 Ga0068854_1000497765 85
170 3300005578 Ga0068854_100282114 Ga0068854_1002821142 85
171 3300005578 Ga0068854_100373954 Ga0068854_1003739543 85
172 3300005614 Ga0068856_100021309 Ga0068856_1000213096 85
173 3300005614 Ga0068856_100032074 Ga0068856_1000320746 85
174 3300005615 Ga0070702_100014764 Ga0070702_1000147646 85
175 3300005615 Ga0070702_100094519 Ga0070702_1000945194 85
176 3300005616 Ga0068852_100224103 Ga0068852_1002241032 85
177 3300005616 Ga0068852_100241207 Ga0068852_1002412072 85
178 3300005617 Ga0068859_100001741 Ga0068859_10000174119 85
179 3300005618 Ga0068864_100027331 Ga0068864_1000273312 85
180 3300005718 Ga0068866_10001140 Ga0068866_1000114012 85
181 3300005719 Ga0068861_101437426 Ga0068861_1014374261 85
182 3300005834 Ga0068851_10015536 Ga0068851_100155366 85
183 3300005834 Ga0068851_10018491 Ga0068851_100184914 85
184 3300005840 Ga0068870_10017607 Ga0068870_100176073 85
185 3300005841 Ga0068863_100007778 Ga0068863_1000077788 85
186 3300005842 Ga0068858_100025618 Ga0068858_1000256187 85
187 3300005843 Ga0068860_100595725 Ga0068860_1005957252 85
188 3300005843 Ga0068860_101642551 Ga0068860_1016425512 85
189 3300006048 Ga0075363_100257489 Ga0075363_1002574892 85
190 3300006163 Ga0070715_10110736 Ga0070715_101107362 85
191 3300006173 Ga0070716_100808323 Ga0070716_1008083231 85
192 3300006175 Ga0070712_100003612 Ga0070712_1000036123 85
193 3300006175 Ga0070712_100004881 Ga0070712_1000048819 85
194 3300006175 Ga0070712_101489584 Ga0070712_1014895842 85
195 3300006177 Ga0075362_10587777 Ga0075362_105877772 85
196 3300006177 Ga0075362_10712405 Ga0075362_107124051 85
197 3300006237 Ga0097621_100227817 Ga0097621_1002278173 85
198 3300006237 Ga0097621_102096495 Ga0097621_1020964952 85
199 3300006358 Ga0068871_100225108 Ga0068871_1002251083 85
200 3300006358 Ga0068871_100499180 Ga0068871_1004991803 85
201 3300006358 Ga0068871_101098175 Ga0068871_1010981752 85
202 3300006844 Ga0075428_102348913 Ga0075428_1023489131 85
203 3300006871 Ga0075434_100243253 Ga0075434_1002432533 85
204 3300006871 Ga0075434_100369726 Ga0075434_1003697263 85
205 3300006871 Ga0075434_102488385 Ga0075434_1024883853 85
206 3300006881 Ga0068865_100147061 Ga0068865_1001470612 85
207 3300006931 Ga0097620_100001741 Ga0097620_10000174111 85
208 3300009093 Ga0105240_10001889 Ga0105240_1000188938 85
209 3300009098 Ga0105245_10009343 Ga0105245_100093433 85
210 3300009098 Ga0105245_10009415 Ga0105245_100094153 85
211 3300009098 Ga0105245_10046677 Ga0105245_100466774 85
212 3300009101 Ga0105247_10014436 Ga0105247_100144364 85
213 3300009148 Ga0105243_10119280 Ga0105243_101192803 85
214 3300009174 Ga0105241_10011046 Ga0105241_100110469 85
215 3300009174 Ga0105241_10027934 Ga0105241_100279344 85
216 3300009176 Ga0105242_10008131 Ga0105242_1000813111 85
217 3300009176 Ga0105242_10115527 Ga0105242_101155274 85
218 3300009177 Ga0105248_10013308 Ga0105248_100133083 85
219 3300009177 Ga0105248_10818849 Ga0105248_108188492 85
220 3300009545 Ga0105237_11313250 Ga0105237_113132502 85
221 3300009551 Ga0105238_10009503 Ga0105238_100095034 85
222 3300009551 Ga0105238_10884733 Ga0105238_108847332 85
223 3300009553 Ga0105249_11647019 Ga0105249_116470192 85
224 3300011119 Ga0105246_10566276 Ga0105246_105662762 85
225 3300013100 Ga0157373_10013745 Ga0157373_100137457 85
226 3300013104 Ga0157370_10046754 Ga0157370_100467546 85
227 3300013104 Ga0157370_10221282 Ga0157370_102212822 85
228 3300013105 Ga0157369_10042059 Ga0157369_100420592 85
229 3300013296 Ga0157374_10001809 Ga0157374_100018099 85
230 3300013296 Ga0157374_10261469 Ga0157374_102614692 85
231 3300013297 Ga0157378_10009283 Ga0157378_100092833 85
232 3300013297 Ga0157378_10009954 Ga0157378_100099542 85
233 3300013297 Ga0157378_11205903 Ga0157378_112059032 85
234 3300013306 Ga0163162_10011811 Ga0163162_100118113 85
235 3300013306 Ga0163162_10078481 Ga0163162_100784813 85
236 3300013307 Ga0157372_10006706 Ga0157372_100067063 85
237 3300013307 Ga0157372_10543483 Ga0157372_105434833 85
238 3300013307 Ga0157372_10924433 Ga0157372_109244332 85
239 3300013308 Ga0157375_10008616 Ga0157375_100086163 85
240 3300014325 Ga0163163_10001352 Ga0163163_1000135217 85
241 3300014326 Ga0157380_10376579 Ga0157380_103765793 85
242 3300014326 Ga0157380_12382496 Ga0157380_123824962 85
243 3300014745 Ga0157377_10005762 Ga0157377_100057623 85
244 3300014745 Ga0157377_10336930 Ga0157377_103369302 85
245 3300014968 Ga0157379_10006078 Ga0157379_100060783 85
246 3300014969 Ga0157376_10005980 Ga0157376_100059803 85
247 3300014969 Ga0157376_10006034 Ga0157376_100060343 85
248 3300017792 Ga0163161_10085588 Ga0163161_100855883 85
249 3300020070 Ga0206356_10597502 Ga0206356_105975022 85
250 3300021377 Ga0213874_10189473 Ga0213874_101894732 85
251 3300025321 Ga0207656_10036142 Ga0207656_100361423 85
252 3300025885 Ga0207653_10044574 Ga0207653_100445742 85
253 3300025898 Ga0207692_10033157 Ga0207692_100331573 85
254 3300025899 Ga0207642_10000592 Ga0207642_100005925 85
255 3300025903 Ga0207680_10002576 Ga0207680_100025765 85
256 3300025903 Ga0207680_10353120 Ga0207680_103531203 85
257 3300025905 Ga0207685_10002717 Ga0207685_100027174 85
258 3300025906 Ga0207699_10918925 Ga0207699_109189252 85
259 3300025907 Ga0207645_10020446 Ga0207645_100204464 85
260 3300025908 Ga0207643_10011278 Ga0207643_100112785 85
261 3300025909 Ga0207705_10452506 Ga0207705_104525062 85
262 3300025910 Ga0207684_10448098 Ga0207684_104480982 85
263 3300025911 Ga0207654_10013929 Ga0207654_100139293 85
264 3300025911 Ga0207654_10208034 Ga0207654_102080341 85
265 3300025911 Ga0207654_10475349 Ga0207654_104753491 85
266 3300025912 Ga0207707_10076043 Ga0207707_100760433 85
267 3300025912 Ga0207707_10746854 Ga0207707_107468542 85
268 3300025913 Ga0207695_10061236 Ga0207695_100612361 85
269 3300025915 Ga0207693_10000652 Ga0207693_1000065216 85
270 3300025916 Ga0207663_10002608 Ga0207663_100026085 85
271 3300025916 Ga0207663_10218515 Ga0207663_102185152 85
272 3300025916 Ga0207663_10485671 Ga0207663_104856711 85
273 3300025916 Ga0207663_10762508 Ga0207663_107625082 85
274 3300025917 Ga0207660_10098203 Ga0207660_100982033 85
275 3300025918 Ga0207662_10118900 Ga0207662_101189003 85
276 3300025919 Ga0207657_10007901 Ga0207657_1000790114 85
277 3300025919 Ga0207657_10032956 Ga0207657_100329562 85
278 3300025919 Ga0207657_10234531 Ga0207657_102345312 85
279 3300025920 Ga0207649_10011486 Ga0207649_100114867 85
280 3300025920 Ga0207649_10175581 Ga0207649_101755813 85
281 3300025921 Ga0207652_10043014 Ga0207652_100430144 85
282 3300025922 Ga0207646_10107936 Ga0207646_101079364 85
283 3300025924 Ga0207694_10005853 Ga0207694_100058539 85
284 3300025924 Ga0207694_10173787 Ga0207694_101737874 85
285 3300025925 Ga0207650_10033734 Ga0207650_100337343 85
286 3300025927 Ga0207687_10002403 Ga0207687_100024036 85
287 3300025927 Ga0207687_10009624 Ga0207687_100096249 85
288 3300025927 Ga0207687_10073134 Ga0207687_100731344 85
289 3300025928 Ga0207700_10006059 Ga0207700_100060598 85
290 3300025928 Ga0207700_10954223 Ga0207700_109542231 85
291 3300025929 Ga0207664_10049165 Ga0207664_100491655 85
292 3300025929 Ga0207664_10889759 Ga0207664_108897592 85
293 3300025929 Ga0207664_11417614 Ga0207664_114176142 85
294 3300025931 Ga0207644_10001544 Ga0207644_1000154411 85
295 3300025931 Ga0207644_10123185 Ga0207644_101231852 85
296 3300025933 Ga0207706_10008050 Ga0207706_100080507 85
297 3300025933 Ga0207706_10045117 Ga0207706_100451173 85
298 3300025934 Ga0207686_10016224 Ga0207686_100162246 85
299 3300025934 Ga0207686_10334010 Ga0207686_103340103 85
300 3300025936 Ga0207670_10042018 Ga0207670_100420183 85
301 3300025937 Ga0207669_10074261 Ga0207669_100742613 85
302 3300025938 Ga0207704_10036269 Ga0207704_100362694 85
303 3300025939 Ga0207665_10006908 Ga0207665_1000690810 85
304 3300025940 Ga0207691_10046844 Ga0207691_100468443 85
305 3300025941 Ga0207711_10000087 Ga0207711_1000008778 85
306 3300025941 Ga0207711_11975819 Ga0207711_119758192 85
307 3300025942 Ga0207689_10092657 Ga0207689_100926574 85
308 3300025942 Ga0207689_10140083 Ga0207689_101400834 85
309 3300025942 Ga0207689_10498412 Ga0207689_104984122 85
310 3300025944 Ga0207661_10009752 Ga0207661_100097527 85
311 3300025945 Ga0207679_10003953 Ga0207679_100039539 85
312 3300025945 Ga0207679_10033839 Ga0207679_100338392 85
313 3300025945 Ga0207679_10876885 Ga0207679_108768851 85
314 3300025949 Ga0207667_10020237 Ga0207667_100202374 85
315 3300025960 Ga0207651_10004718 Ga0207651_100047187 85
316 3300025981 Ga0207640_10004420 Ga0207640_100044204 85
317 3300025981 Ga0207640_10265846 Ga0207640_102658463 85
318 3300025981 Ga0207640_10807485 Ga0207640_108074851 85
319 3300025986 Ga0207658_10034077 Ga0207658_100340776 85
320 3300025986 Ga0207658_10187491 Ga0207658_101874912 85
321 3300026023 Ga0207677_10003281 Ga0207677_1000328112 85
322 3300026023 Ga0207677_10041797 Ga0207677_100417975 85
323 3300026035 Ga0207703_10003435 Ga0207703_1000343515 85
324 3300026041 Ga0207639_10334991 Ga0207639_103349913 85
325 3300026041 Ga0207639_11936637 Ga0207639_119366372 85
326 3300026041 Ga0207639_12076710 Ga0207639_120767102 85
327 3300026067 Ga0207678_10007957 Ga0207678_100079574 85
328 3300026067 Ga0207678_10207610 Ga0207678_102076103 85
329 3300026075 Ga0207708_10623523 Ga0207708_106235231 85
330 3300026078 Ga0207702_10007712 Ga0207702_100077128 85
331 3300026078 Ga0207702_10089970 Ga0207702_100899702 85
332 3300026078 Ga0207702_10141546 Ga0207702_101415463 85
333 3300026078 Ga0207702_11193922 Ga0207702_111939222 85
334 3300026078 Ga0207702_11426675 Ga0207702_114266752 85
335 3300026088 Ga0207641_10008086 Ga0207641_100080865 85
336 3300026089 Ga0207648_10010002 Ga0207648_100100022 85
337 3300026095 Ga0207676_10000294 Ga0207676_1000029422 85
338 3300026116 Ga0207674_10000140 Ga0207674_1000014048 85
339 3300026116 Ga0207674_10002122 Ga0207674_1000212213 85
340 3300026121 Ga0207683_10000355 Ga0207683_1000035530 85
341 3300026142 Ga0207698_10016336 Ga0207698_100163366 85
342 3300026142 Ga0207698_10016903 Ga0207698_100169032 85
343 3300026142 Ga0207698_10061360 Ga0207698_100613602 85
344 3300028379 Ga0268266_10027032 Ga0268266_100270324 85
345 3300028381 Ga0268264_10007222 Ga0268264_1000722212 85
346 3300028381 Ga0268264_10014173 Ga0268264_100141739 85
347 3300028794 Ga0307515_10700302 Ga0307515_107003021 85
348 3300031241 Ga0265325_10017881 Ga0265325_100178815 85
349 3300031507 Ga0307509_10981369 Ga0307509_109813691 85
350 3300031548 Ga0307408_100849822 Ga0307408_1008498222 85
351 3300031712 Ga0265342_10200524 Ga0265342_102005242 85
352 3300031730 Ga0307516_10000674 Ga0307516_100006743 85
353 3300031911 Ga0307412_10737151 Ga0307412_107371512 85
354 3300032005 Ga0307411_11720146 Ga0307411_117201462 85
355 3300035083 Ga0373926_0097590 Ga0373926_0097590_613_906 85
356 3300035083 Ga0373926_0281458 Ga0373926_0281458_124_417 85
357 3300035083 Ga0373926_0293307 Ga0373926_0293307_247_540 85
358 3300035086 Ga0373934_0001028 Ga0373934_0001028_5370_5663 85
359 3300035089 Ga0373944_0099832 Ga0373944_0099832_238_531 85
360 3300035089 Ga0373944_0127025 Ga0373944_0127025_446_739 85
361 3300035111 Ga0373923_0000349 Ga0373923_0000349_8075_8368 85
362 3300035112 Ga0373932_0118639 Ga0373932_0118639_549_812 85
363 3300035113 Ga0373936_0062980 Ga0373936_0062980_252_545 85
364 3300035117 Ga0373953_0006544 Ga0373953_0006544_2691_2984 85
365 3300035118 Ga0373954_0001030 Ga0373954_0001030_5362_5655 85
366 3300035119 Ga0373956_0002915 Ga0373956_0002915_2220_2513 85
367 3300035119 Ga0373956_0084820 Ga0373956_0084820_604_897 85
368 3300035120 Ga0373957_0000571 Ga0373957_0000571_3758_4051 85
369 3300035170 Ga0373943_0061726 Ga0373943_0061726_1362_1655 85
370 3300035170 Ga0373943_0061733 Ga0373943_0061733_716_1009 85
371 3300035170 Ga0373943_0220810 Ga0373943_0220810_135_428 85
372 3300035171 Ga0373946_0044870 Ga0373946_0044870_1119_1412 85
373 3300035171 Ga0373946_0319524 Ga0373946_0319524_93_386 85
374 3300035172 Ga0373955_0046454 Ga0373955_0046454_376_669 85
375 3300035242 Ga0373962_0177309 Ga0373962_0177309_49_312 85
376 3300035410 Ga0373924_0003473 Ga0373924_0003473_1598_1891 85
377 3300035691 Ga0373931_0140471 Ga0373931_0140471_575_868 85
378 3300035692 Ga0373935_0059111 Ga0373935_0059111_1569_1862 85
379 3300035692 Ga0373935_0104218 Ga0373935_0104218_1170_1463 85
380 3300035692 Ga0373935_0329319 Ga0373935_0329319_218_511 85
381 3300035695 Ga0373927_0009005 Ga0373927_0009005_6105_6398 85
382 3300035695 Ga0373927_0717627 Ga0373927_0717627_158_451 85
383 3300035724 Ga0373933_0004932 Ga0373933_0004932_107_400 85
384 3300035724 Ga0373933_0139582 Ga0373933_0139582_1089_1382 85
385 3300035725 Ga0373947_0031091 Ga0373947_0031091_690_983 85
386 3300035725 Ga0373947_0081985 Ga0373947_0081985_615_908 85
387 3300035725 Ga0373947_0130745 Ga0373947_0130745_1214_1507 85
388 3300036401 Ga0373937_0001093 Ga0373937_0001093_10151_10444 85
389 3300036401 Ga0373937_0056352 Ga0373937_0056352_2447_2740 85
390 3300036401 Ga0373937_0467075 Ga0373937_0467075_114_407 85
391 3300036401 Ga0373937_0670776 Ga0373937_0670776_596_853 85
392 3300037068 Ga0373925_0087135 Ga0373925_0087135_887_1180 85
393 3300037068 Ga0373925_0410320 Ga0373925_0410320_430_723 85
394 3300037068 Ga0373925_0483835 Ga0373925_0483835_635_928 85
395 3300037471 Ga0395905_0444831 Ga0395905_0444831_197_457 85
396 3300039438 Ga0436360_0649202 Ga0436360_0649202_406_663 85
397 3300039450 Ga0436363_0720287 Ga0436363_0720287_452_709 85
398 3300041459 Ga0451800_1285167 Ga0451800_1285167_333_593 85
399 3300041507 Ga0451851_1060694 Ga0451851_1060694_868_1128 85
400 3300041512 Ga0451853_0980077 Ga0451853_0980077_563_856 85
401 3300046459 Ga0495629_0809823 Ga0495629_0809823_236_529 85
402 3300046462 Ga0495651_0537135 Ga0495651_0537135_97_390 85
403 3300046463 Ga0495653_0098730 Ga0495653_0098730_577_870 85
404 3300046472 Ga0495580_0168775 Ga0495580_0168775_964_1257 85
405 3300046476 Ga0495662_0045115 Ga0495662_0045115_1089_1382 85
406 3300046477 Ga0495664_0148810 Ga0495664_0148810_917_1210 85
407 3300046511 Ga0495608_0391091 Ga0495608_0391091_262_555 85
408 3300046516 Ga0495628_0145364 Ga0495628_0145364_13_306 85
409 3300046517 Ga0495630_0823938 Ga0495630_0823938_352_645 85
410 3300046529 Ga0495652_0125994 Ga0495652_0125994_772_1065 85
411 3300046533 Ga0495640_0271769 Ga0495640_0271769_231_524 85
412 3300046535 Ga0495586_0168991 Ga0495586_0168991_240_533 85
413 3300046536 Ga0495587_0092653 Ga0495587_0092653_448_741 85
414 3300046539 Ga0495621_0046416 Ga0495621_0046416_58_351 85
415 3300046543 Ga0495645_0026388 Ga0495645_0026388_262_555 85
416 3300046543 Ga0495645_0670707 Ga0495645_0670707_147_440 85
417 3300046559 Ga0495667_0224935 Ga0495667_0224935_519_812 85
418 3300046642 Ga0495634_0377834 Ga0495634_0377834_313_606 85
419 3300046664 Ga0495659_0066223 Ga0495659_0066223_38_331 85
420 3300046674 Ga0495588_0100292 Ga0495588_0100292_652_945 85
421 3300046675 Ga0495657_0132288 Ga0495657_0132288_205_498 85
422 3300046679 Ga0495623_0016408 Ga0495623_0016408_2619_2912 85
423 3300046681 Ga0495647_0004099 Ga0495647_0004099_1579_1872 85
424 3300046684 Ga0495669_0382083 Ga0495669_0382083_274_567 85
425 3300046809 Ga0495600_0060078 Ga0495600_0060078_1652_1945 85
426 3300047315 Ga0495581_0007795 Ga0495581_0007795_2896_3189 85
427 3300047319 Ga0495674_0134572 Ga0495674_0134572_417_710 85
428 3300047322 Ga0495680_0058477 Ga0495680_0058477_1557_1850 85
429 3300047444 Ga0495675_0063091 Ga0495675_0063091_781_1074 85
430 3300048088 Ga0495602_0134711 Ga0495602_0134711_1567_1860 85
431 3300048088 Ga0495602_0777646 Ga0495602_0777646_113_406 85
432 3300048903 Ga0496100_0491507 Ga0496100_0491507_226_519 85
433 3300048904 Ga0496101_0062991 Ga0496101_0062991_2202_2495 85
434 3300048905 Ga0496102_0467056 Ga0496102_0467056_837_1130 85
435 3300048906 Ga0496103_0132828 Ga0496103_0132828_1243_1536 85
436 3300048907 Ga0496104_0015746 Ga0496104_0015746_887_1180 85
437 3300048908 Ga0496105_0004395 Ga0496105_0004395_1237_1530 85
438 3300048910 Ga0496107_0243964 Ga0496107_0243964_385_678 85
439 3300048910 Ga0496107_0619921 Ga0496107_0619921_157_423 85
440 3300048911 Ga0496108_0028601 Ga0496108_0028601_3741_4034 85
441 3300048912 Ga0496109_0004450 Ga0496109_0004450_6485_6778 85
442 3300048913 Ga0496110_0187003 Ga0496110_0187003_441_734 85
443 3300048915 Ga0496112_0003789 Ga0496112_0003789_5072_5365 85
444 3300048917 Ga0496114_0127683 Ga0496114_0127683_1835_2128 85
445 3300048918 Ga0496115_0066673 Ga0496115_0066673_1076_1369 85
446 3300048927 Ga0496124_0108369 Ga0496124_0108369_412_672 85
447 3300049586 Ga0501070_0815932 Ga0501070_0815932_373_630 85
448 3300050493 nmdc:mga0k408_868337_c1 nmdc:mga0k408_868337_c1_243_503 85
449 3300050494 nmdc:mga06z11_911794_c1 nmdc:mga06z11_911794_c1_70_330 85
450 3300050512 nmdc:mga0n895_365840_c1 nmdc:mga0n895_365840_c1_857_1150 85
451 3300053077 Ga0495601_0017347 Ga0495601_0017347_1643_1936 85
452 3300053077 Ga0495601_0150133 Ga0495601_0150133_538_831 85
453 3300053078 Ga0495612_0029135 Ga0495612_0029135_312_605 85
454 3300053078 Ga0495612_0082889 Ga0495612_0082889_463_756 85
455 3300053084 Ga0495595_0024784 Ga0495595_0024784_1630_1923 85
456 3300053085 Ga0495619_0169917 Ga0495619_0169917_361_654 85
457 3300053085 Ga0495619_0347338 Ga0495619_0347338_381_674 85
458 3300053158 Ga0500627_0505794 Ga0500627_0505794_76_336 85
459 3300039447 Ga0436361_0784397 Ga0436361_0784397_144_407 86
460 3300044693 Ga0466961_0058801 Ga0466961_0058801_1818_2081 86
461 3300044842 Ga0466957_0545307 Ga0466957_0545307_45_308 86
462 3300045049 Ga0466959_0035337 Ga0466959_0035337_478_741 86
463 3300006846 Ga0075430_100457452 Ga0075430_1004574522 87
464 3300030760 Ga0265762_1091070 Ga0265762_10910702 87
465 3300031090 Ga0265760_10112625 Ga0265760_101126252 87
466 3300031249 Ga0265339_10092815 Ga0265339_100928153 87
467 3300039453 Ga0436362_0139994 Ga0436362_0139994_48_317 87
468 3300003322 rootL2_10014067 rootL2_1001406715 88
469 3300046473 Ga0495582_0511366 Ga0495582_0511366_258_527 88
470 3300005530 Ga0070679_100027431 Ga0070679_1000274313 89
471 3300006178 Ga0075367_10492742 Ga0075367_104927422 89
472 3300041458 Ga0451798_0126328 Ga0451798_0126328_954_1226 89
473 3300046471 Ga0495650_0167688 Ga0495650_0167688_52_327 89
474 3300047472 Ga0495686_0051074 Ga0495686_0051074_623_898 89
475 3300050494 nmdc:mga06z11_443174_c1 nmdc:mga06z11_443174_c1_449_748 89
476 3300031548 Ga0307408_100001498 Ga0307408_1000014985 90
477 3300031727 Ga0316576_10132045 Ga0316576_101320453 90
478 3300031728 Ga0316578_10037032 Ga0316578_100370323 90
479 3300031731 Ga0307405_10001138 Ga0307405_100011382 90
480 3300031733 Ga0316577_10015985 Ga0316577_100159853 90
481 3300031824 Ga0307413_10003003 Ga0307413_100030033 90
482 3300031852 Ga0307410_10001643 Ga0307410_100016438 90
483 3300031901 Ga0307406_10002738 Ga0307406_100027388 90
484 3300031903 Ga0307407_10006282 Ga0307407_100062825 90
485 3300031911 Ga0307412_10032795 Ga0307412_100327954 90
486 3300031995 Ga0307409_100014130 Ga0307409_1000141304 90
487 3300032002 Ga0307416_100007511 Ga0307416_1000075114 90
488 3300032004 Ga0307414_10033734 Ga0307414_100337344 90
489 3300032005 Ga0307411_10018866 Ga0307411_100188664 90
490 3300032126 Ga0307415_100001765 Ga0307415_1000017655 90
491 3300032139 Ga0316580_10131388 Ga0316580_101313882 90
492 3300033528 Ga0316588_1113511 Ga0316588_11135112 90
493 3300035398 Ga0316574_0000470 Ga0316574_0000470_12020_12292 90
494 3300036647 Ga0316582_0001306 Ga0316582_0001306_6905_7177 90
495 3300036712 Ga0316584_0006760 Ga0316584_0006760_5851_6123 90
496 3300049576 Ga0501040_0206737 Ga0501040_0206737_266_547 90
497 3300049588 Ga0501072_1069288 Ga0501072_1069288_73_354 90
498 3300049590 Ga0501074_0933249 Ga0501074_0933249_284_565 90
499 3300049591 Ga0501075_0198057 Ga0501075_0198057_914_1195 90
500 3300042876 Ga0451577_0023224 Ga0451577_0023224_1853_2128 91
501 3300042876 Ga0451577_0174985 Ga0451577_0174985_1101_1376 91
502 3300044712 Ga0453684_0031880 Ga0453684_0031880_2000_2275 91
503 3300045051 Ga0451576_0037379 Ga0451576_0037379_359_634 91
504 3300045051 Ga0451576_1325122 Ga0451576_1325122_175_450 91
505 3300009177 Ga0105248_11352713 Ga0105248_113527132 92
506 3300025941 Ga0207711_11734469 Ga0207711_117344692 92
507 3300032004 Ga0307414_10327583 Ga0307414_103275832 92
508 2162886007 SwRhRL2b_contig_1270333 SwRhRL2b_0128.00001620 93
509 2162886007 SwRhRL2b_contig_1635463 SwRhRL2b_0742.00005790 93

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

10

70

0.98

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

17

78

0.87

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

12

76

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tr0-assembly2.cif.gz_B crystal structure of gssg-bound cgrx2 0.9546 9 93
4tr1-assembly1.cif.gz_A crystal structure of gsh-bound cgrx2/c15s 0.952 9 93
1fov-assembly1.cif.gz_A glutaredoxin 3 from escherichia coli in the fully oxidized form 0.948 10 90
4tr1-assembly2.cif.gz_B crystal structure of gsh-bound cgrx2/c15s 0.9456 9 91
1nm3-assembly1.cif.gz_B crystal structure of heamophilus influenza hybrid-prx5 0.925 8 81
ID Description Score Start End Superfamily
af_A0A1D6GDU0_1_74_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9627 21 90 3.40.30.10
4tr0B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9536 9 93 3.40.30.10
af_A0A1D6LVM4_243_327_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9503 9 89 3.40.30.10
af_A0A1D6KSR1_221_307_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9324 9 90 3.40.30.10
3grxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9235 10 90 3.40.30.10

Feature Viewer

pLDDT pTM Quality
92.86 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map