F456975
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 509 | 318 | 509 | 93 |
Family's Representative Sequence
| Representative Sequence | 3300009177|Ga0105248_11352713|Ga0105248_113527132 |
| Length | 102 |
| Sequence | MSQAVNSSEIIMYSTTWCPYCDRARALLKAKGATFSEVKIDEDPAQRDIMLKRSGGRRTVPQIFIGERHVGGFDDLYALDRKGELDGLLRDAAAANSAKVLP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 3 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 56 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 62 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 63 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 64 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 65 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 74 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 75 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 76 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 82 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 83 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 84 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 85 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 110 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 115 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 116 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 179 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 183 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 184 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 185 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 186 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 187 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 188 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 189 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 191 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 192 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 193 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 194 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 200 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 201 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 202 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 204 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 205 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 206 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 208 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 209 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 210 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 212 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 213 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 214 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 217 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 222 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 223 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 224 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 225 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 226 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 227 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 228 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 229 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 233 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 234 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 236 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 240 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 241 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 242 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 243 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 244 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 245 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 287 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 288 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 289 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 290 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 291 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 294 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 295 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 296 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 297 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 298 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 299 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 304 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 306 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 307 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 309 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 310 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 311 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.21 |
| Metatranscriptomes | 0.79 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.57 |
| Nodule | 0 |
| Rhizoplane | 3.93 |
| Rhizosphere | 92.73 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.77 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1270333 | 2162886007 | Bacteria | 1321 |
| 2 | SwRhRL2b_contig_1635463 | 2162886007 | Bacteria | 1378 |
| 3 | JGI24747J21853_1048555 | 3300001978 | Bacteria | 514 |
| 4 | rootL2_10014067 | 3300003322 | Bacteria | 13138 |
| 5 | Ga0070658_11064003 | 3300005327 | Bacteria | 704 |
| 6 | Ga0070676_10121496 | 3300005328 | Bacteria | 1640 |
| 7 | Ga0070683_100055831 | 3300005329 | Bacteria | 3665 |
| 8 | Ga0070690_100003078 | 3300005330 | Bacteria | 9067 |
| 9 | Ga0070670_100020490 | 3300005331 | Bacteria | 5685 |
| 10 | Ga0070670_100343403 | 3300005331 | Bacteria | 1311 |
| 11 | Ga0068869_100023785 | 3300005334 | Bacteria | 4238 |
| 12 | Ga0068869_100537084 | 3300005334 | Bacteria | 981 |
| 13 | Ga0070666_10004746 | 3300005335 | Bacteria | 8304 |
| 14 | Ga0070666_11338461 | 3300005335 | Bacteria | 535 |
| 15 | Ga0070680_100011375 | 3300005336 | Bacteria | 6882 |
| 16 | Ga0070680_100382310 | 3300005336 | Unclassified | 1199 |
| 17 | Ga0070682_100013128 | 3300005337 | Bacteria | 4757 |
| 18 | Ga0068868_100015847 | 3300005338 | Bacteria | 5585 |
| 19 | Ga0068868_102122145 | 3300005338 | Bacteria | 535 |
| 20 | Ga0070660_100022673 | 3300005339 | Bacteria | 4647 |
| 21 | Ga0070660_100044088 | 3300005339 | Bacteria | 3410 |
| 22 | Ga0070660_100467982 | 3300005339 | Bacteria | 1047 |
| 23 | Ga0070689_100006592 | 3300005340 | Bacteria | 8055 |
| 24 | Ga0070691_10289101 | 3300005341 | Bacteria | 892 |
| 25 | Ga0070687_100191436 | 3300005343 | Bacteria | 1233 |
| 26 | Ga0070661_100015818 | 3300005344 | Bacteria | 5325 |
| 27 | Ga0070661_100094025 | 3300005344 | Bacteria | 2221 |
| 28 | Ga0070692_10004689 | 3300005345 | Bacteria | 5731 |
| 29 | Ga0070692_10234915 | 3300005345 | Unclassified | 1090 |
| 30 | Ga0070671_100206171 | 3300005355 | Bacteria | 1667 |
| 31 | Ga0070674_100220166 | 3300005356 | Bacteria | 1476 |
| 32 | Ga0070673_100002265 | 3300005364 | Bacteria | 11663 |
| 33 | Ga0070673_101722328 | 3300005364 | Bacteria | 593 |
| 34 | Ga0070688_100012315 | 3300005365 | Bacteria | 4789 |
| 35 | Ga0070659_100068867 | 3300005366 | Bacteria | 2808 |
| 36 | Ga0070659_100394320 | 3300005366 | Unclassified | 1168 |
| 37 | Ga0070667_100259151 | 3300005367 | Bacteria | 1556 |
| 38 | Ga0070667_100428652 | 3300005367 | Bacteria | 1206 |
| 39 | Ga0070703_10374871 | 3300005406 | Bacteria | 613 |
| 40 | Ga0070709_10182557 | 3300005434 | Bacteria | 1474 |
| 41 | Ga0070709_10461581 | 3300005434 | Bacteria | 958 |
| 42 | Ga0070714_101033293 | 3300005435 | Bacteria | 800 |
| 43 | Ga0070714_101175214 | 3300005435 | Bacteria | 748 |
| 44 | Ga0070714_101211618 | 3300005435 | Bacteria | 736 |
| 45 | Ga0070713_100000191 | 3300005436 | Bacteria | 40649 |
| 46 | Ga0070713_100000621 | 3300005436 | Bacteria | 22637 |
| 47 | Ga0070713_100009875 | 3300005436 | Bacteria | 6867 |
| 48 | Ga0070713_100394131 | 3300005436 | Unclassified | 1292 |
| 49 | Ga0070710_10006664 | 3300005437 | Bacteria | 5559 |
| 50 | Ga0070701_10167642 | 3300005438 | Unclassified | 1277 |
| 51 | Ga0070701_10258040 | 3300005438 | Bacteria | 1055 |
| 52 | Ga0070711_100000562 | 3300005439 | Bacteria | 19387 |
| 53 | Ga0070711_100141071 | 3300005439 | Bacteria | 1807 |
| 54 | Ga0070711_101009756 | 3300005439 | Unclassified | 714 |
| 55 | Ga0070711_101561825 | 3300005439 | Bacteria | 576 |
| 56 | Ga0070705_100044643 | 3300005440 | Bacteria | 2546 |
| 57 | Ga0070708_100039815 | 3300005445 | Bacteria | 4114 |
| 58 | Ga0070663_100052970 | 3300005455 | Bacteria | 2896 |
| 59 | Ga0070663_100415218 | 3300005455 | Bacteria | 1103 |
| 60 | Ga0070678_100002847 | 3300005456 | Bacteria | 9574 |
| 61 | Ga0070662_100015044 | 3300005457 | Bacteria | 5176 |
| 62 | Ga0070662_100034161 | 3300005457 | Bacteria | 3585 |
| 63 | Ga0070662_100382651 | 3300005457 | Bacteria | 1158 |
| 64 | Ga0070662_101244287 | 3300005457 | Bacteria | 640 |
| 65 | Ga0070681_10053935 | 3300005458 | Bacteria | 4006 |
| 66 | Ga0068867_100303648 | 3300005459 | Bacteria | 1317 |
| 67 | Ga0070685_10001706 | 3300005466 | Bacteria | 11541 |
| 68 | Ga0070706_100025279 | 3300005467 | Bacteria | 5465 |
| 69 | Ga0070698_100156612 | 3300005471 | Bacteria | 2224 |
| 70 | Ga0070699_100461878 | 3300005518 | Bacteria | 1151 |
| 71 | Ga0070699_100718938 | 3300005518 | Bacteria | 913 |
| 72 | Ga0070679_100027431 | 3300005530 | Bacteria | 5605 |
| 73 | Ga0070679_100159685 | 3300005530 | Bacteria | 2229 |
| 74 | Ga0070684_100020647 | 3300005535 | Bacteria | 5463 |
| 75 | Ga0070684_100070714 | 3300005535 | Bacteria | 3071 |
| 76 | Ga0070697_100011036 | 3300005536 | Bacteria | 7058 |
| 77 | Ga0068853_100012925 | 3300005539 | Bacteria | 6805 |
| 78 | Ga0068853_100199306 | 3300005539 | Bacteria | 1821 |
| 79 | Ga0070672_100347514 | 3300005543 | Bacteria | 1264 |
| 80 | Ga0070686_100232324 | 3300005544 | Unclassified | 1339 |
| 81 | Ga0070686_100885840 | 3300005544 | Bacteria | 725 |
| 82 | Ga0070695_100383240 | 3300005545 | Bacteria | 1061 |
| 83 | Ga0070695_100780801 | 3300005545 | Bacteria | 764 |
| 84 | Ga0070696_100016947 | 3300005546 | Bacteria | 4914 |
| 85 | Ga0070696_100221773 | 3300005546 | Bacteria | 1419 |
| 86 | Ga0070693_100018809 | 3300005547 | Bacteria | 3613 |
| 87 | Ga0070693_100031585 | 3300005547 | Bacteria | 2904 |
| 88 | Ga0070665_100130301 | 3300005548 | Bacteria | 2517 |
| 89 | Ga0070704_100012707 | 3300005549 | Bacteria | 5209 |
| 90 | Ga0068855_100007194 | 3300005563 | Bacteria | 13506 |
| 91 | Ga0068855_100737398 | 3300005563 | Bacteria | 1051 |
| 92 | Ga0070664_100000658 | 3300005564 | Bacteria | 26393 |
| 93 | Ga0070664_100161415 | 3300005564 | Bacteria | 1983 |
| 94 | Ga0070664_100453622 | 3300005564 | Bacteria | 1177 |
| 95 | Ga0068857_100005799 | 3300005577 | Bacteria | 10556 |
| 96 | Ga0068854_100049776 | 3300005578 | Bacteria | 2995 |
| 97 | Ga0068854_100282114 | 3300005578 | Bacteria | 1338 |
| 98 | Ga0068854_100373954 | 3300005578 | Bacteria | 1172 |
| 99 | Ga0068856_100021309 | 3300005614 | Bacteria | 6298 |
| 100 | Ga0068856_100032074 | 3300005614 | Bacteria | 5142 |
| 101 | Ga0070702_100014764 | 3300005615 | Bacteria | 3970 |
| 102 | Ga0070702_100094519 | 3300005615 | Bacteria | 1820 |
| 103 | Ga0068852_100177379 | 3300005616 | Bacteria | 2001 |
| 104 | Ga0068852_100224103 | 3300005616 | Bacteria | 1789 |
| 105 | Ga0068852_100241207 | 3300005616 | Bacteria | 1727 |
| 106 | Ga0068859_100001741 | 3300005617 | Bacteria | 22164 |
| 107 | Ga0068864_100027331 | 3300005618 | Bacteria | 4818 |
| 108 | Ga0068866_10001140 | 3300005718 | Bacteria | 11673 |
| 109 | Ga0068866_11436845 | 3300005718 | Bacteria | 505 |
| 110 | Ga0068861_101437426 | 3300005719 | Bacteria | 675 |
| 111 | Ga0068851_10015536 | 3300005834 | Bacteria | 3629 |
| 112 | Ga0068851_10018491 | 3300005834 | Bacteria | 3357 |
| 113 | Ga0068870_10017607 | 3300005840 | Bacteria | 3435 |
| 114 | Ga0068863_100007778 | 3300005841 | Bacteria | 10479 |
| 115 | Ga0068858_100025618 | 3300005842 | Bacteria | 5488 |
| 116 | Ga0068860_100595725 | 3300005843 | Bacteria | 1110 |
| 117 | Ga0068860_101642551 | 3300005843 | Bacteria | 664 |
| 118 | Ga0075363_100257489 | 3300006048 | Bacteria | 1006 |
| 119 | Ga0070715_10110736 | 3300006163 | Bacteria | 1295 |
| 120 | Ga0070716_100808323 | 3300006173 | Bacteria | 726 |
| 121 | Ga0070712_100003612 | 3300006175 | Bacteria | 9538 |
| 122 | Ga0070712_100004881 | 3300006175 | Bacteria | 8295 |
| 123 | Ga0070712_101277988 | 3300006175 | Bacteria | 639 |
| 124 | Ga0070712_101489584 | 3300006175 | Bacteria | 591 |
| 125 | Ga0075362_10587777 | 3300006177 | Bacteria | 575 |
| 126 | Ga0075362_10712405 | 3300006177 | Bacteria | 524 |
| 127 | Ga0075367_10492742 | 3300006178 | Unclassified | 777 |
| 128 | Ga0097621_100227817 | 3300006237 | Bacteria | 1626 |
| 129 | Ga0097621_102096495 | 3300006237 | Bacteria | 541 |
| 130 | Ga0068871_100225108 | 3300006358 | Bacteria | 1626 |
| 131 | Ga0068871_100499180 | 3300006358 | Unclassified | 1096 |
| 132 | Ga0068871_101098175 | 3300006358 | Bacteria | 744 |
| 133 | Ga0075428_102348913 | 3300006844 | Bacteria | 548 |
| 134 | Ga0075430_100457452 | 3300006846 | Bacteria | 1053 |
| 135 | Ga0075430_100905016 | 3300006846 | Bacteria | 727 |
| 136 | Ga0075433_10879135 | 3300006852 | Bacteria | 782 |
| 137 | Ga0075434_100243253 | 3300006871 | Bacteria | 1819 |
| 138 | Ga0075434_100369726 | 3300006871 | Unclassified | 1455 |
| 139 | Ga0075434_102488385 | 3300006871 | Bacteria | 519 |
| 140 | Ga0068865_100147061 | 3300006881 | Bacteria | 1783 |
| 141 | Ga0075436_100220249 | 3300006914 | Bacteria | 1346 |
| 142 | Ga0097620_100001741 | 3300006931 | Bacteria | 22164 |
| 143 | Ga0105250_10535957 | 3300009092 | Bacteria | 535 |
| 144 | Ga0105240_10001889 | 3300009093 | Bacteria | 34824 |
| 145 | Ga0105240_10087092 | 3300009093 | Bacteria | 3825 |
| 146 | Ga0105245_10009343 | 3300009098 | Bacteria | 8553 |
| 147 | Ga0105245_10009415 | 3300009098 | Bacteria | 8519 |
| 148 | Ga0105245_10046677 | 3300009098 | Bacteria | 3871 |
| 149 | Ga0105245_10238348 | 3300009098 | Bacteria | 1762 |
| 150 | Ga0105247_10014436 | 3300009101 | Bacteria | 4739 |
| 151 | Ga0105243_10119280 | 3300009148 | Bacteria | 2221 |
| 152 | Ga0105243_12548382 | 3300009148 | Bacteria | 551 |
| 153 | Ga0105241_10011046 | 3300009174 | Bacteria | 6625 |
| 154 | Ga0105241_10027934 | 3300009174 | Bacteria | 4201 |
| 155 | Ga0105242_10008131 | 3300009176 | Bacteria | 8072 |
| 156 | Ga0105242_10115527 | 3300009176 | Bacteria | 2294 |
| 157 | Ga0105248_10013308 | 3300009177 | Bacteria | 9056 |
| 158 | Ga0105248_10111798 | 3300009177 | Bacteria | 3081 |
| 159 | Ga0105248_10818849 | 3300009177 | Bacteria | 1051 |
| 160 | Ga0105248_11352713 | 3300009177 | Bacteria | 806 |
| 161 | Ga0105237_11313250 | 3300009545 | Bacteria | 730 |
| 162 | Ga0105238_10009503 | 3300009551 | Bacteria | 9731 |
| 163 | Ga0105238_10086589 | 3300009551 | Bacteria | 3120 |
| 164 | Ga0105238_10884733 | 3300009551 | Bacteria | 911 |
| 165 | Ga0105249_11647019 | 3300009553 | Bacteria | 714 |
| 166 | Ga0105246_10082186 | 3300011119 | Bacteria | 2298 |
| 167 | Ga0105246_10566276 | 3300011119 | Bacteria | 976 |
| 168 | Ga0157373_10013745 | 3300013100 | Bacteria | 5935 |
| 169 | Ga0157373_10164214 | 3300013100 | Bacteria | 1562 |
| 170 | Ga0157371_10036382 | 3300013102 | Bacteria | 3525 |
| 171 | Ga0157370_10046754 | 3300013104 | Bacteria | 4150 |
| 172 | Ga0157370_10221282 | 3300013104 | Bacteria | 1753 |
| 173 | Ga0157369_10042059 | 3300013105 | Bacteria | 4986 |
| 174 | Ga0157374_10001809 | 3300013296 | Bacteria | 18004 |
| 175 | Ga0157374_10261469 | 3300013296 | Bacteria | 1705 |
| 176 | Ga0157378_10009283 | 3300013297 | Bacteria | 8568 |
| 177 | Ga0157378_10009954 | 3300013297 | Bacteria | 8288 |
| 178 | Ga0157378_11205903 | 3300013297 | Bacteria | 796 |
| 179 | Ga0163162_10011811 | 3300013306 | Bacteria | 8518 |
| 180 | Ga0163162_10078481 | 3300013306 | Bacteria | 3367 |
| 181 | Ga0163162_10343668 | 3300013306 | Bacteria | 1625 |
| 182 | Ga0157372_10006706 | 3300013307 | Bacteria | 12248 |
| 183 | Ga0157372_10543483 | 3300013307 | Unclassified | 1354 |
| 184 | Ga0157372_10924433 | 3300013307 | Bacteria | 1012 |
| 185 | Ga0157375_10008616 | 3300013308 | Bacteria | 8929 |
| 186 | Ga0163163_10001352 | 3300014325 | Bacteria | 20693 |
| 187 | Ga0157380_10376579 | 3300014326 | Bacteria | 1338 |
| 188 | Ga0157380_12382496 | 3300014326 | Bacteria | 594 |
| 189 | Ga0182008_10319443 | 3300014497 | Bacteria | 817 |
| 190 | Ga0157377_10005762 | 3300014745 | Bacteria | 5846 |
| 191 | Ga0157377_10336930 | 3300014745 | Bacteria | 1007 |
| 192 | Ga0157377_10488912 | 3300014745 | Bacteria | 858 |
| 193 | Ga0157379_10006078 | 3300014968 | Bacteria | 10396 |
| 194 | Ga0157379_12065483 | 3300014968 | Bacteria | 564 |
| 195 | Ga0157376_10005980 | 3300014969 | Bacteria | 8550 |
| 196 | Ga0157376_10006034 | 3300014969 | Bacteria | 8519 |
| 197 | Ga0163161_10085588 | 3300017792 | Bacteria | 2326 |
| 198 | Ga0206356_10597502 | 3300020070 | Bacteria | 529 |
| 199 | Ga0213874_10189473 | 3300021377 | Bacteria | 735 |
| 200 | Ga0207656_10036142 | 3300025321 | Bacteria | 2072 |
| 201 | Ga0207656_10058146 | 3300025321 | Bacteria | 1688 |
| 202 | Ga0207653_10044574 | 3300025885 | Bacteria | 1463 |
| 203 | Ga0207692_10033157 | 3300025898 | Bacteria | 2488 |
| 204 | Ga0207692_10062830 | 3300025898 | Bacteria | 1928 |
| 205 | Ga0207642_10000592 | 3300025899 | Bacteria | 11152 |
| 206 | Ga0207680_10002576 | 3300025903 | Bacteria | 8460 |
| 207 | Ga0207680_10353120 | 3300025903 | Bacteria | 1033 |
| 208 | Ga0207685_10002717 | 3300025905 | Bacteria | 4120 |
| 209 | Ga0207699_10166127 | 3300025906 | Bacteria | 1473 |
| 210 | Ga0207699_10918925 | 3300025906 | Bacteria | 646 |
| 211 | Ga0207645_10020446 | 3300025907 | Bacteria | 4333 |
| 212 | Ga0207643_10011278 | 3300025908 | Bacteria | 4826 |
| 213 | Ga0207705_10452506 | 3300025909 | Bacteria | 996 |
| 214 | Ga0207684_10448098 | 3300025910 | Bacteria | 1108 |
| 215 | Ga0207654_10013929 | 3300025911 | Bacteria | 4145 |
| 216 | Ga0207654_10208034 | 3300025911 | Bacteria | 1292 |
| 217 | Ga0207654_10475349 | 3300025911 | Bacteria | 880 |
| 218 | Ga0207707_10076043 | 3300025912 | Bacteria | 2930 |
| 219 | Ga0207707_10746854 | 3300025912 | Unclassified | 818 |
| 220 | Ga0207695_10061236 | 3300025913 | Bacteria | 3891 |
| 221 | Ga0207695_10434844 | 3300025913 | Bacteria | 1196 |
| 222 | Ga0207671_10196135 | 3300025914 | Bacteria | 1576 |
| 223 | Ga0207693_10000652 | 3300025915 | Bacteria | 31091 |
| 224 | Ga0207693_10260850 | 3300025915 | Bacteria | 1359 |
| 225 | Ga0207663_10002608 | 3300025916 | Bacteria | 8679 |
| 226 | Ga0207663_10218515 | 3300025916 | Bacteria | 1385 |
| 227 | Ga0207663_10485671 | 3300025916 | Bacteria | 958 |
| 228 | Ga0207663_10762508 | 3300025916 | Unclassified | 769 |
| 229 | Ga0207660_10098203 | 3300025917 | Bacteria | 2184 |
| 230 | Ga0207660_10347569 | 3300025917 | Bacteria | 1188 |
| 231 | Ga0207662_10118900 | 3300025918 | Bacteria | 1655 |
| 232 | Ga0207662_10323975 | 3300025918 | Bacteria | 1029 |
| 233 | Ga0207657_10007901 | 3300025919 | Bacteria | 10850 |
| 234 | Ga0207657_10032956 | 3300025919 | Bacteria | 4674 |
| 235 | Ga0207657_10234531 | 3300025919 | Bacteria | 1467 |
| 236 | Ga0207649_10011486 | 3300025920 | Bacteria | 4884 |
| 237 | Ga0207649_10175581 | 3300025920 | Bacteria | 1496 |
| 238 | Ga0207652_10043014 | 3300025921 | Bacteria | 3846 |
| 239 | Ga0207652_10140590 | 3300025921 | Bacteria | 2158 |
| 240 | Ga0207646_10107936 | 3300025922 | Bacteria | 2497 |
| 241 | Ga0207681_10202779 | 3300025923 | Bacteria | 1524 |
| 242 | Ga0207694_10005853 | 3300025924 | Bacteria | 9423 |
| 243 | Ga0207694_10173787 | 3300025924 | Unclassified | 1745 |
| 244 | Ga0207650_10033734 | 3300025925 | Bacteria | 3709 |
| 245 | Ga0207650_10841056 | 3300025925 | Bacteria | 778 |
| 246 | Ga0207687_10002403 | 3300025927 | Bacteria | 12697 |
| 247 | Ga0207687_10009624 | 3300025927 | Bacteria | 6317 |
| 248 | Ga0207687_10073134 | 3300025927 | Bacteria | 2454 |
| 249 | Ga0207687_10241647 | 3300025927 | Bacteria | 1431 |
| 250 | Ga0207700_10000073 | 3300025928 | Bacteria | 61784 |
| 251 | Ga0207700_10006059 | 3300025928 | Bacteria | 7282 |
| 252 | Ga0207700_10006798 | 3300025928 | Bacteria | 6950 |
| 253 | Ga0207700_10954223 | 3300025928 | Unclassified | 768 |
| 254 | Ga0207664_10047118 | 3300025929 | Bacteria | 3385 |
| 255 | Ga0207664_10049165 | 3300025929 | Bacteria | 3319 |
| 256 | Ga0207664_10889759 | 3300025929 | Bacteria | 800 |
| 257 | Ga0207664_11417614 | 3300025929 | Unclassified | 615 |
| 258 | Ga0207644_10001544 | 3300025931 | Bacteria | 14840 |
| 259 | Ga0207644_10123185 | 3300025931 | Bacteria | 1976 |
| 260 | Ga0207690_10192769 | 3300025932 | Bacteria | 1542 |
| 261 | Ga0207706_10008050 | 3300025933 | Bacteria | 9728 |
| 262 | Ga0207706_10045117 | 3300025933 | Bacteria | 3906 |
| 263 | Ga0207706_10094807 | 3300025933 | Bacteria | 2625 |
| 264 | Ga0207686_10016224 | 3300025934 | Bacteria | 4176 |
| 265 | Ga0207686_10334010 | 3300025934 | Bacteria | 1136 |
| 266 | Ga0207670_10042018 | 3300025936 | Bacteria | 3010 |
| 267 | Ga0207669_10074261 | 3300025937 | Bacteria | 2149 |
| 268 | Ga0207669_10109132 | 3300025937 | Bacteria | 1850 |
| 269 | Ga0207704_10036269 | 3300025938 | Bacteria | 2836 |
| 270 | Ga0207704_10524026 | 3300025938 | Bacteria | 959 |
| 271 | Ga0207665_10006908 | 3300025939 | Bacteria | 7511 |
| 272 | Ga0207665_10013379 | 3300025939 | Bacteria | 5394 |
| 273 | Ga0207691_10046844 | 3300025940 | Bacteria | 3971 |
| 274 | Ga0207711_10000087 | 3300025941 | Bacteria | 98302 |
| 275 | Ga0207711_11734469 | 3300025941 | Bacteria | 568 |
| 276 | Ga0207711_11975819 | 3300025941 | Bacteria | 526 |
| 277 | Ga0207689_10092657 | 3300025942 | Bacteria | 2482 |
| 278 | Ga0207689_10140083 | 3300025942 | Bacteria | 1992 |
| 279 | Ga0207689_10498412 | 3300025942 | Bacteria | 1020 |
| 280 | Ga0207661_10009752 | 3300025944 | Bacteria | 6897 |
| 281 | Ga0207661_10080276 | 3300025944 | Bacteria | 2691 |
| 282 | Ga0207679_10003953 | 3300025945 | Bacteria | 9205 |
| 283 | Ga0207679_10033839 | 3300025945 | Bacteria | 3600 |
| 284 | Ga0207679_10876885 | 3300025945 | Bacteria | 820 |
| 285 | Ga0207667_10020237 | 3300025949 | Bacteria | 7405 |
| 286 | Ga0207667_10388603 | 3300025949 | Bacteria | 1421 |
| 287 | Ga0207651_10004718 | 3300025960 | Bacteria | 6922 |
| 288 | Ga0207668_10494937 | 3300025972 | Bacteria | 1051 |
| 289 | Ga0207640_10004420 | 3300025981 | Bacteria | 7627 |
| 290 | Ga0207640_10265846 | 3300025981 | Bacteria | 1339 |
| 291 | Ga0207640_10807485 | 3300025981 | Bacteria | 813 |
| 292 | Ga0207640_11794150 | 3300025981 | Bacteria | 554 |
| 293 | Ga0207658_10034077 | 3300025986 | Bacteria | 3636 |
| 294 | Ga0207658_10187491 | 3300025986 | Bacteria | 1716 |
| 295 | Ga0207658_11685132 | 3300025986 | Bacteria | 579 |
| 296 | Ga0207677_10003281 | 3300026023 | Bacteria | 8554 |
| 297 | Ga0207677_10041797 | 3300026023 | Bacteria | 3034 |
| 298 | Ga0207703_10003435 | 3300026035 | Bacteria | 13293 |
| 299 | Ga0207639_10129456 | 3300026041 | Bacteria | 2087 |
| 300 | Ga0207639_10334991 | 3300026041 | Bacteria | 1347 |
| 301 | Ga0207639_11936637 | 3300026041 | Bacteria | 550 |
| 302 | Ga0207639_12076710 | 3300026041 | Bacteria | 529 |
| 303 | Ga0207678_10007957 | 3300026067 | Bacteria | 9349 |
| 304 | Ga0207678_10207610 | 3300026067 | Bacteria | 1675 |
| 305 | Ga0207708_10623523 | 3300026075 | Bacteria | 915 |
| 306 | Ga0207702_10007712 | 3300026078 | Bacteria | 9141 |
| 307 | Ga0207702_10089970 | 3300026078 | Bacteria | 2685 |
| 308 | Ga0207702_10141546 | 3300026078 | Bacteria | 2177 |
| 309 | Ga0207702_11193922 | 3300026078 | Bacteria | 755 |
| 310 | Ga0207702_11426675 | 3300026078 | Bacteria | 686 |
| 311 | Ga0207641_10008086 | 3300026088 | Bacteria | 8714 |
| 312 | Ga0207648_10010002 | 3300026089 | Bacteria | 9024 |
| 313 | Ga0207676_10000294 | 3300026095 | Bacteria | 43081 |
| 314 | Ga0207674_10000140 | 3300026116 | Bacteria | 84173 |
| 315 | Ga0207674_10002122 | 3300026116 | Bacteria | 25063 |
| 316 | Ga0207675_100195812 | 3300026118 | Bacteria | 1940 |
| 317 | Ga0207683_10000355 | 3300026121 | Bacteria | 42024 |
| 318 | Ga0207698_10016336 | 3300026142 | Bacteria | 5000 |
| 319 | Ga0207698_10016903 | 3300026142 | Bacteria | 4933 |
| 320 | Ga0207698_10061360 | 3300026142 | Bacteria | 2929 |
| 321 | Ga0268266_10027032 | 3300028379 | Bacteria | 4882 |
| 322 | Ga0268264_10007222 | 3300028381 | Bacteria | 9303 |
| 323 | Ga0268264_10014173 | 3300028381 | Bacteria | 6556 |
| 324 | Ga0307515_10700302 | 3300028794 | Bacteria | 629 |
| 325 | Ga0265762_1091070 | 3300030760 | Bacteria | 665 |
| 326 | Ga0265760_10112625 | 3300031090 | Bacteria | 868 |
| 327 | Ga0265325_10017881 | 3300031241 | Bacteria | 3937 |
| 328 | Ga0265339_10092815 | 3300031249 | Bacteria | 1580 |
| 329 | Ga0307509_10981369 | 3300031507 | Bacteria | 511 |
| 330 | Ga0307408_100001498 | 3300031548 | Bacteria | 17329 |
| 331 | Ga0307408_100849822 | 3300031548 | Bacteria | 832 |
| 332 | Ga0265342_10200524 | 3300031712 | Bacteria | 1084 |
| 333 | Ga0316576_10132045 | 3300031727 | Bacteria | 1878 |
| 334 | Ga0316578_10037032 | 3300031728 | Bacteria | 2809 |
| 335 | Ga0307516_10000674 | 3300031730 | Bacteria | 46280 |
| 336 | Ga0307405_10001138 | 3300031731 | Bacteria | 10916 |
| 337 | Ga0316577_10015985 | 3300031733 | Bacteria | 4130 |
| 338 | Ga0307413_10003003 | 3300031824 | Bacteria | 6998 |
| 339 | Ga0307410_10001643 | 3300031852 | Bacteria | 10280 |
| 340 | Ga0307406_10002738 | 3300031901 | Bacteria | 9617 |
| 341 | Ga0307407_10006282 | 3300031903 | Bacteria | 5255 |
| 342 | Ga0307412_10032795 | 3300031911 | Bacteria | 3295 |
| 343 | Ga0307412_10737151 | 3300031911 | Bacteria | 849 |
| 344 | Ga0307409_100014130 | 3300031995 | Bacteria | 5176 |
| 345 | Ga0307416_100007511 | 3300032002 | Bacteria | 6941 |
| 346 | Ga0307416_102881183 | 3300032002 | Bacteria | 575 |
| 347 | Ga0307414_10033734 | 3300032004 | Bacteria | 3386 |
| 348 | Ga0307414_10327583 | 3300032004 | Bacteria | 1306 |
| 349 | Ga0307411_10018866 | 3300032005 | Bacteria | 3969 |
| 350 | Ga0307411_11720146 | 3300032005 | Bacteria | 581 |
| 351 | Ga0307415_100001765 | 3300032126 | Bacteria | 10567 |
| 352 | Ga0316580_10131388 | 3300032139 | Bacteria | 767 |
| 353 | Ga0316588_1113511 | 3300033528 | Bacteria | 683 |
| 354 | Ga0373926_0097590 | 3300035083 | Bacteria | 1096 |
| 355 | Ga0373926_0281458 | 3300035083 | Bacteria | 647 |
| 356 | Ga0373926_0293307 | 3300035083 | Bacteria | 634 |
| 357 | Ga0373934_0001028 | 3300035086 | Bacteria | 10066 |
| 358 | Ga0373944_0099832 | 3300035089 | Bacteria | 979 |
| 359 | Ga0373944_0127025 | 3300035089 | Bacteria | 883 |
| 360 | Ga0373923_0000349 | 3300035111 | Bacteria | 10443 |
| 361 | Ga0373932_0118639 | 3300035112 | Bacteria | 880 |
| 362 | Ga0373936_0062980 | 3300035113 | Unclassified | 1517 |
| 363 | Ga0373945_0063880 | 3300035116 | Bacteria | 1379 |
| 364 | Ga0373953_0006544 | 3300035117 | Bacteria | 3845 |
| 365 | Ga0373954_0001030 | 3300035118 | Bacteria | 11058 |
| 366 | Ga0373956_0002915 | 3300035119 | Bacteria | 6921 |
| 367 | Ga0373956_0084820 | 3300035119 | Bacteria | 1456 |
| 368 | Ga0373957_0000571 | 3300035120 | Bacteria | 9332 |
| 369 | Ga0373943_0061726 | 3300035170 | Bacteria | 1874 |
| 370 | Ga0373943_0061733 | 3300035170 | Bacteria | 1874 |
| 371 | Ga0373943_0220810 | 3300035170 | Bacteria | 1055 |
| 372 | Ga0373946_0044870 | 3300035171 | Bacteria | 1826 |
| 373 | Ga0373946_0319524 | 3300035171 | Bacteria | 771 |
| 374 | Ga0373955_0046454 | 3300035172 | Bacteria | 2347 |
| 375 | Ga0373962_0177309 | 3300035242 | Bacteria | 711 |
| 376 | Ga0316574_0000470 | 3300035398 | Bacteria | 16292 |
| 377 | Ga0373924_0003473 | 3300035410 | Bacteria | 5426 |
| 378 | Ga0373931_0140471 | 3300035691 | Unclassified | 1398 |
| 379 | Ga0373935_0059111 | 3300035692 | Bacteria | 2449 |
| 380 | Ga0373935_0104218 | 3300035692 | Bacteria | 1874 |
| 381 | Ga0373935_0329319 | 3300035692 | Bacteria | 1085 |
| 382 | Ga0373927_0009005 | 3300035695 | Bacteria | 6701 |
| 383 | Ga0373927_0220995 | 3300035695 | Bacteria | 1244 |
| 384 | Ga0373927_0717627 | 3300035695 | Bacteria | 660 |
| 385 | Ga0373933_0004932 | 3300035724 | Bacteria | 7279 |
| 386 | Ga0373933_0139582 | 3300035724 | Bacteria | 1529 |
| 387 | Ga0373947_0031091 | 3300035725 | Bacteria | 3140 |
| 388 | Ga0373947_0081985 | 3300035725 | Bacteria | 1998 |
| 389 | Ga0373947_0130745 | 3300035725 | Bacteria | 1602 |
| 390 | Ga0373937_0001093 | 3300036401 | Bacteria | 22840 |
| 391 | Ga0373937_0056352 | 3300036401 | Bacteria | 3609 |
| 392 | Ga0373937_0467075 | 3300036401 | Bacteria | 1198 |
| 393 | Ga0373937_0670776 | 3300036401 | Bacteria | 983 |
| 394 | Ga0316582_0001306 | 3300036647 | Bacteria | 10788 |
| 395 | Ga0316584_0006760 | 3300036712 | Bacteria | 7780 |
| 396 | Ga0373925_0013694 | 3300037068 | Bacteria | 5872 |
| 397 | Ga0373925_0087135 | 3300037068 | Bacteria | 2383 |
| 398 | Ga0373925_0410320 | 3300037068 | Bacteria | 1105 |
| 399 | Ga0373925_0483835 | 3300037068 | Bacteria | 1015 |
| 400 | Ga0395905_0444831 | 3300037471 | Bacteria | 1193 |
| 401 | Ga0436360_0649202 | 3300039438 | Unclassified | 832 |
| 402 | Ga0436361_0784397 | 3300039447 | Bacteria | 600 |
| 403 | Ga0436363_0720287 | 3300039450 | Bacteria | 919 |
| 404 | Ga0436362_0139994 | 3300039453 | Bacteria | 500 |
| 405 | Ga0451798_0126328 | 3300041458 | Bacteria | 1470 |
| 406 | Ga0451800_1285167 | 3300041459 | Bacteria | 932 |
| 407 | Ga0451851_1060694 | 3300041507 | Bacteria | 1147 |
| 408 | Ga0451853_0980077 | 3300041512 | Bacteria | 1236 |
| 409 | Ga0439448_0112418 | 3300042005 | Bacteria | 931 |
| 410 | Ga0451577_0023224 | 3300042876 | Bacteria | 5657 |
| 411 | Ga0451577_0174985 | 3300042876 | Bacteria | 1934 |
| 412 | Ga0466961_0058801 | 3300044693 | Bacteria | 2445 |
| 413 | Ga0453684_0031880 | 3300044712 | Bacteria | 7391 |
| 414 | Ga0466957_0545307 | 3300044842 | Bacteria | 808 |
| 415 | Ga0466959_0035337 | 3300045049 | Bacteria | 3697 |
| 416 | Ga0451576_0037379 | 3300045051 | Bacteria | 5143 |
| 417 | Ga0451576_0457900 | 3300045051 | Bacteria | 1339 |
| 418 | Ga0451576_1325122 | 3300045051 | Bacteria | 750 |
| 419 | Ga0451576_2535605 | 3300045051 | Bacteria | 523 |
| 420 | Ga0495629_0809823 | 3300046459 | Bacteria | 618 |
| 421 | Ga0495651_0537135 | 3300046462 | Bacteria | 744 |
| 422 | Ga0495653_0098730 | 3300046463 | Bacteria | 2120 |
| 423 | Ga0495650_0167688 | 3300046471 | Bacteria | 779 |
| 424 | Ga0495580_0039176 | 3300046472 | Bacteria | 3390 |
| 425 | Ga0495580_0168775 | 3300046472 | Unclassified | 1513 |
| 426 | Ga0495582_0063949 | 3300046473 | Bacteria | 2031 |
| 427 | Ga0495582_0511366 | 3300046473 | Unclassified | 694 |
| 428 | Ga0495639_0028687 | 3300046475 | Bacteria | 2466 |
| 429 | Ga0495662_0045115 | 3300046476 | Bacteria | 2127 |
| 430 | Ga0495664_0148810 | 3300046477 | Bacteria | 1420 |
| 431 | Ga0495608_0391091 | 3300046511 | Unclassified | 851 |
| 432 | Ga0495628_0145364 | 3300046516 | Bacteria | 1808 |
| 433 | Ga0495630_0066871 | 3300046517 | Bacteria | 2702 |
| 434 | Ga0495630_0823938 | 3300046517 | Bacteria | 708 |
| 435 | Ga0495652_0125994 | 3300046529 | Bacteria | 2035 |
| 436 | Ga0495665_0032779 | 3300046531 | Bacteria | 2779 |
| 437 | Ga0495640_0271769 | 3300046533 | Bacteria | 1057 |
| 438 | Ga0495586_0168991 | 3300046535 | Unclassified | 1235 |
| 439 | Ga0495587_0092653 | 3300046536 | Bacteria | 1745 |
| 440 | Ga0495621_0046416 | 3300046539 | Bacteria | 1541 |
| 441 | Ga0495645_0026388 | 3300046543 | Bacteria | 4217 |
| 442 | Ga0495645_0670707 | 3300046543 | Bacteria | 632 |
| 443 | Ga0495667_0224935 | 3300046559 | Bacteria | 1197 |
| 444 | Ga0495634_0377834 | 3300046642 | Bacteria | 845 |
| 445 | Ga0495635_0012559 | 3300046663 | Bacteria | 5935 |
| 446 | Ga0495659_0066223 | 3300046664 | Bacteria | 1345 |
| 447 | Ga0495588_0100292 | 3300046674 | Bacteria | 1521 |
| 448 | Ga0495657_0132288 | 3300046675 | Bacteria | 1562 |
| 449 | Ga0495623_0016408 | 3300046679 | Bacteria | 4785 |
| 450 | Ga0495623_0353962 | 3300046679 | Bacteria | 799 |
| 451 | Ga0495647_0004099 | 3300046681 | Bacteria | 4710 |
| 452 | Ga0495658_0052947 | 3300046683 | Bacteria | 2303 |
| 453 | Ga0495669_0382083 | 3300046684 | Bacteria | 682 |
| 454 | Ga0495613_0036154 | 3300046689 | Bacteria | 3662 |
| 455 | Ga0495600_0060078 | 3300046809 | Bacteria | 2482 |
| 456 | Ga0495581_0007795 | 3300047315 | Bacteria | 6200 |
| 457 | Ga0495674_0134572 | 3300047319 | Bacteria | 2081 |
| 458 | Ga0495674_1243084 | 3300047319 | Bacteria | 561 |
| 459 | Ga0495680_0058477 | 3300047322 | Bacteria | 2979 |
| 460 | Ga0495675_0063091 | 3300047444 | Bacteria | 2345 |
| 461 | Ga0495684_0010531 | 3300047471 | Bacteria | 7149 |
| 462 | Ga0495686_0051074 | 3300047472 | Unclassified | 2596 |
| 463 | Ga0495593_0103076 | 3300047673 | Bacteria | 1462 |
| 464 | Ga0495602_0134711 | 3300048088 | Bacteria | 1965 |
| 465 | Ga0495602_0777646 | 3300048088 | Bacteria | 644 |
| 466 | Ga0496100_0491507 | 3300048903 | Bacteria | 945 |
| 467 | Ga0496100_1309431 | 3300048903 | Bacteria | 572 |
| 468 | Ga0496101_0062991 | 3300048904 | Bacteria | 2698 |
| 469 | Ga0496102_0028779 | 3300048905 | Bacteria | 4967 |
| 470 | Ga0496102_0467056 | 3300048905 | Bacteria | 1183 |
| 471 | Ga0496103_0132828 | 3300048906 | Bacteria | 1590 |
| 472 | Ga0496104_0015746 | 3300048907 | Bacteria | 6859 |
| 473 | Ga0496105_0004395 | 3300048908 | Bacteria | 10614 |
| 474 | Ga0496107_0243964 | 3300048910 | Bacteria | 1337 |
| 475 | Ga0496107_0619921 | 3300048910 | Unclassified | 799 |
| 476 | Ga0496108_0028601 | 3300048911 | Bacteria | 4612 |
| 477 | Ga0496109_0004450 | 3300048912 | Bacteria | 11702 |
| 478 | Ga0496109_2007126 | 3300048912 | Bacteria | 510 |
| 479 | Ga0496110_0187003 | 3300048913 | Bacteria | 1881 |
| 480 | Ga0496112_0003789 | 3300048915 | Bacteria | 12634 |
| 481 | Ga0496112_0066831 | 3300048915 | Bacteria | 3548 |
| 482 | Ga0496114_0127683 | 3300048917 | Bacteria | 2193 |
| 483 | Ga0496115_0066673 | 3300048918 | Bacteria | 2909 |
| 484 | Ga0496124_0108369 | 3300048927 | Bacteria | 2240 |
| 485 | Ga0501298_147672 | 3300049521 | Bacteria | 573 |
| 486 | Ga0501040_0206737 | 3300049576 | Bacteria | 1395 |
| 487 | Ga0501070_0815932 | 3300049586 | Bacteria | 732 |
| 488 | Ga0501071_0496397 | 3300049587 | Bacteria | 936 |
| 489 | Ga0501072_1069288 | 3300049588 | Bacteria | 628 |
| 490 | Ga0501074_0933249 | 3300049590 | Bacteria | 611 |
| 491 | Ga0501075_0198057 | 3300049591 | Bacteria | 1532 |
| 492 | Ga0501257_030857 | 3300049686 | Bacteria | 1291 |
| 493 | Ga0501219_025902 | 3300049703 | Bacteria | 532 |
| 494 | Ga0501045_0423135 | 3300049824 | Bacteria | 991 |
| 495 | Ga0501204_042288 | 3300049850 | Bacteria | 672 |
| 496 | nmdc:mga0k408_868337_c1 | 3300050493 | Bacteria | 524 |
| 497 | nmdc:mga06z11_443174_c1 | 3300050494 | Unclassified | 784 |
| 498 | nmdc:mga06z11_911794_c1 | 3300050494 | Bacteria | 535 |
| 499 | nmdc:mga0n895_365840_c1 | 3300050512 | Unclassified | 1460 |
| 500 | nmdc:mga08x19_372126_c1 | 3300050514 | Bacteria | 1000 |
| 501 | Ga0495601_0017347 | 3300053077 | Bacteria | 4369 |
| 502 | Ga0495601_0150133 | 3300053077 | Bacteria | 1521 |
| 503 | Ga0495612_0029135 | 3300053078 | Bacteria | 2223 |
| 504 | Ga0495612_0082889 | 3300053078 | Bacteria | 1349 |
| 505 | Ga0495595_0024784 | 3300053084 | Bacteria | 2652 |
| 506 | Ga0495619_0169917 | 3300053085 | Bacteria | 1507 |
| 507 | Ga0495619_0347338 | 3300053085 | Bacteria | 1026 |
| 508 | Ga0500627_0505794 | 3300053158 | Bacteria | 502 |
| 509 | Ga0501084_0313078 | 3300054114 | Bacteria | 1326 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047319 | Ga0495674_1243084 | Ga0495674_1243084_12_257 | 69 |
| 2 | 3300006852 | Ga0075433_10879135 | Ga0075433_108791352 | 78 |
| 3 | 3300006846 | Ga0075430_100905016 | Ga0075430_1009050162 | 79 |
| 4 | 3300032002 | Ga0307416_102881183 | Ga0307416_1028811832 | 79 |
| 5 | 3300049521 | Ga0501298_147672 | Ga0501298_147672_242_502 | 79 |
| 6 | 3300049587 | Ga0501071_0496397 | Ga0501071_0496397_75_317 | 79 |
| 7 | 3300049703 | Ga0501219_025902 | Ga0501219_025902_242_499 | 79 |
| 8 | 3300049824 | Ga0501045_0423135 | Ga0501045_0423135_341_583 | 79 |
| 9 | 3300054114 | Ga0501084_0313078 | Ga0501084_0313078_944_1186 | 79 |
| 10 | 3300005434 | Ga0070709_10182557 | Ga0070709_101825573 | 80 |
| 11 | 3300005435 | Ga0070714_101175214 | Ga0070714_1011752142 | 80 |
| 12 | 3300005436 | Ga0070713_100000191 | Ga0070713_10000019118 | 80 |
| 13 | 3300005436 | Ga0070713_100009875 | Ga0070713_1000098753 | 80 |
| 14 | 3300005471 | Ga0070698_100156612 | Ga0070698_1001566123 | 80 |
| 15 | 3300005563 | Ga0068855_100737398 | Ga0068855_1007373982 | 80 |
| 16 | 3300005616 | Ga0068852_100177379 | Ga0068852_1001773792 | 80 |
| 17 | 3300006175 | Ga0070712_101277988 | Ga0070712_1012779882 | 80 |
| 18 | 3300006914 | Ga0075436_100220249 | Ga0075436_1002202491 | 80 |
| 19 | 3300009093 | Ga0105240_10087092 | Ga0105240_100870924 | 80 |
| 20 | 3300009148 | Ga0105243_12548382 | Ga0105243_125483822 | 80 |
| 21 | 3300009177 | Ga0105248_10111798 | Ga0105248_101117982 | 80 |
| 22 | 3300009551 | Ga0105238_10086589 | Ga0105238_100865894 | 80 |
| 23 | 3300011119 | Ga0105246_10082186 | Ga0105246_100821863 | 80 |
| 24 | 3300013100 | Ga0157373_10164214 | Ga0157373_101642141 | 80 |
| 25 | 3300013102 | Ga0157371_10036382 | Ga0157371_100363821 | 80 |
| 26 | 3300014497 | Ga0182008_10319443 | Ga0182008_103194432 | 80 |
| 27 | 3300025321 | Ga0207656_10058146 | Ga0207656_100581461 | 80 |
| 28 | 3300025898 | Ga0207692_10062830 | Ga0207692_100628302 | 80 |
| 29 | 3300025906 | Ga0207699_10166127 | Ga0207699_101661272 | 80 |
| 30 | 3300025913 | Ga0207695_10434844 | Ga0207695_104348442 | 80 |
| 31 | 3300025914 | Ga0207671_10196135 | Ga0207671_101961353 | 80 |
| 32 | 3300025915 | Ga0207693_10260850 | Ga0207693_102608502 | 80 |
| 33 | 3300025917 | Ga0207660_10347569 | Ga0207660_103475691 | 80 |
| 34 | 3300025918 | Ga0207662_10323975 | Ga0207662_103239753 | 80 |
| 35 | 3300025921 | Ga0207652_10140590 | Ga0207652_101405903 | 80 |
| 36 | 3300025923 | Ga0207681_10202779 | Ga0207681_102027791 | 80 |
| 37 | 3300025925 | Ga0207650_10841056 | Ga0207650_108410562 | 80 |
| 38 | 3300025928 | Ga0207700_10000073 | Ga0207700_1000007316 | 80 |
| 39 | 3300025928 | Ga0207700_10006798 | Ga0207700_100067987 | 80 |
| 40 | 3300025929 | Ga0207664_10047118 | Ga0207664_100471182 | 80 |
| 41 | 3300025932 | Ga0207690_10192769 | Ga0207690_101927691 | 80 |
| 42 | 3300025939 | Ga0207665_10013379 | Ga0207665_100133794 | 80 |
| 43 | 3300025944 | Ga0207661_10080276 | Ga0207661_100802763 | 80 |
| 44 | 3300025949 | Ga0207667_10388603 | Ga0207667_103886033 | 80 |
| 45 | 3300025986 | Ga0207658_11685132 | Ga0207658_116851322 | 80 |
| 46 | 3300026041 | Ga0207639_10129456 | Ga0207639_101294563 | 80 |
| 47 | 3300026118 | Ga0207675_100195812 | Ga0207675_1001958123 | 80 |
| 48 | 3300035116 | Ga0373945_0063880 | Ga0373945_0063880_996_1274 | 80 |
| 49 | 3300035695 | Ga0373927_0220995 | Ga0373927_0220995_634_912 | 80 |
| 50 | 3300037068 | Ga0373925_0013694 | Ga0373925_0013694_1321_1599 | 80 |
| 51 | 3300042005 | Ga0439448_0112418 | Ga0439448_0112418_183_461 | 80 |
| 52 | 3300045051 | Ga0451576_0457900 | Ga0451576_0457900_313_561 | 80 |
| 53 | 3300045051 | Ga0451576_2535605 | Ga0451576_2535605_121_369 | 80 |
| 54 | 3300046472 | Ga0495580_0039176 | Ga0495580_0039176_1812_2090 | 80 |
| 55 | 3300046473 | Ga0495582_0063949 | Ga0495582_0063949_1323_1601 | 80 |
| 56 | 3300046475 | Ga0495639_0028687 | Ga0495639_0028687_2005_2283 | 80 |
| 57 | 3300046517 | Ga0495630_0066871 | Ga0495630_0066871_593_871 | 80 |
| 58 | 3300046531 | Ga0495665_0032779 | Ga0495665_0032779_212_490 | 80 |
| 59 | 3300046663 | Ga0495635_0012559 | Ga0495635_0012559_1138_1416 | 80 |
| 60 | 3300046679 | Ga0495623_0353962 | Ga0495623_0353962_511_789 | 80 |
| 61 | 3300046683 | Ga0495658_0052947 | Ga0495658_0052947_171_449 | 80 |
| 62 | 3300046689 | Ga0495613_0036154 | Ga0495613_0036154_1213_1491 | 80 |
| 63 | 3300047471 | Ga0495684_0010531 | Ga0495684_0010531_6441_6719 | 80 |
| 64 | 3300047673 | Ga0495593_0103076 | Ga0495593_0103076_32_310 | 80 |
| 65 | 3300048905 | Ga0496102_0028779 | Ga0496102_0028779_3994_4272 | 80 |
| 66 | 3300048915 | Ga0496112_0066831 | Ga0496112_0066831_175_453 | 80 |
| 67 | 3300050514 | nmdc:mga08x19_372126_c1 | nmdc:mga08x19_372126_c1_340_618 | 80 |
| 68 | 3300005356 | Ga0070674_100220166 | Ga0070674_1002201662 | 84 |
| 69 | 3300005364 | Ga0070673_101722328 | Ga0070673_1017223281 | 84 |
| 70 | 3300005438 | Ga0070701_10258040 | Ga0070701_102580402 | 84 |
| 71 | 3300005457 | Ga0070662_100382651 | Ga0070662_1003826512 | 84 |
| 72 | 3300005457 | Ga0070662_101244287 | Ga0070662_1012442872 | 84 |
| 73 | 3300005544 | Ga0070686_100885840 | Ga0070686_1008858402 | 84 |
| 74 | 3300005718 | Ga0068866_11436845 | Ga0068866_114368452 | 84 |
| 75 | 3300009092 | Ga0105250_10535957 | Ga0105250_105359572 | 84 |
| 76 | 3300009098 | Ga0105245_10238348 | Ga0105245_102383482 | 84 |
| 77 | 3300013306 | Ga0163162_10343668 | Ga0163162_103436683 | 84 |
| 78 | 3300014745 | Ga0157377_10488912 | Ga0157377_104889122 | 84 |
| 79 | 3300014968 | Ga0157379_12065483 | Ga0157379_120654832 | 84 |
| 80 | 3300025927 | Ga0207687_10241647 | Ga0207687_102416472 | 84 |
| 81 | 3300025933 | Ga0207706_10094807 | Ga0207706_100948072 | 84 |
| 82 | 3300025937 | Ga0207669_10109132 | Ga0207669_101091323 | 84 |
| 83 | 3300025938 | Ga0207704_10524026 | Ga0207704_105240261 | 84 |
| 84 | 3300025972 | Ga0207668_10494937 | Ga0207668_104949372 | 84 |
| 85 | 3300025981 | Ga0207640_11794150 | Ga0207640_117941502 | 84 |
| 86 | 3300048903 | Ga0496100_1309431 | Ga0496100_1309431_25_279 | 84 |
| 87 | 3300048912 | Ga0496109_2007126 | Ga0496109_2007126_197_451 | 84 |
| 88 | 3300049686 | Ga0501257_030857 | Ga0501257_030857_552_824 | 84 |
| 89 | 3300049850 | Ga0501204_042288 | Ga0501204_042288_217_489 | 84 |
| 90 | 3300001978 | JGI24747J21853_1048555 | JGI24747J21853_10485552 | 85 |
| 91 | 3300005327 | Ga0070658_11064003 | Ga0070658_110640032 | 85 |
| 92 | 3300005328 | Ga0070676_10121496 | Ga0070676_101214963 | 85 |
| 93 | 3300005329 | Ga0070683_100055831 | Ga0070683_1000558313 | 85 |
| 94 | 3300005330 | Ga0070690_100003078 | Ga0070690_1000030783 | 85 |
| 95 | 3300005331 | Ga0070670_100020490 | Ga0070670_1000204907 | 85 |
| 96 | 3300005331 | Ga0070670_100343403 | Ga0070670_1003434033 | 85 |
| 97 | 3300005334 | Ga0068869_100023785 | Ga0068869_1000237856 | 85 |
| 98 | 3300005334 | Ga0068869_100537084 | Ga0068869_1005370842 | 85 |
| 99 | 3300005335 | Ga0070666_10004746 | Ga0070666_1000474611 | 85 |
| 100 | 3300005335 | Ga0070666_11338461 | Ga0070666_113384612 | 85 |
| 101 | 3300005336 | Ga0070680_100011375 | Ga0070680_1000113754 | 85 |
| 102 | 3300005336 | Ga0070680_100382310 | Ga0070680_1003823103 | 85 |
| 103 | 3300005337 | Ga0070682_100013128 | Ga0070682_1000131282 | 85 |
| 104 | 3300005338 | Ga0068868_100015847 | Ga0068868_1000158478 | 85 |
| 105 | 3300005338 | Ga0068868_102122145 | Ga0068868_1021221452 | 85 |
| 106 | 3300005339 | Ga0070660_100022673 | Ga0070660_1000226732 | 85 |
| 107 | 3300005339 | Ga0070660_100044088 | Ga0070660_1000440883 | 85 |
| 108 | 3300005339 | Ga0070660_100467982 | Ga0070660_1004679822 | 85 |
| 109 | 3300005340 | Ga0070689_100006592 | Ga0070689_1000065922 | 85 |
| 110 | 3300005341 | Ga0070691_10289101 | Ga0070691_102891011 | 85 |
| 111 | 3300005343 | Ga0070687_100191436 | Ga0070687_1001914363 | 85 |
| 112 | 3300005344 | Ga0070661_100015818 | Ga0070661_1000158183 | 85 |
| 113 | 3300005344 | Ga0070661_100094025 | Ga0070661_1000940253 | 85 |
| 114 | 3300005345 | Ga0070692_10004689 | Ga0070692_100046896 | 85 |
| 115 | 3300005345 | Ga0070692_10234915 | Ga0070692_102349152 | 85 |
| 116 | 3300005355 | Ga0070671_100206171 | Ga0070671_1002061714 | 85 |
| 117 | 3300005364 | Ga0070673_100002265 | Ga0070673_1000022657 | 85 |
| 118 | 3300005365 | Ga0070688_100012315 | Ga0070688_1000123151 | 85 |
| 119 | 3300005366 | Ga0070659_100068867 | Ga0070659_1000688673 | 85 |
| 120 | 3300005366 | Ga0070659_100394320 | Ga0070659_1003943202 | 85 |
| 121 | 3300005367 | Ga0070667_100259151 | Ga0070667_1002591511 | 85 |
| 122 | 3300005367 | Ga0070667_100428652 | Ga0070667_1004286521 | 85 |
| 123 | 3300005406 | Ga0070703_10374871 | Ga0070703_103748712 | 85 |
| 124 | 3300005434 | Ga0070709_10461581 | Ga0070709_104615812 | 85 |
| 125 | 3300005435 | Ga0070714_101033293 | Ga0070714_1010332931 | 85 |
| 126 | 3300005435 | Ga0070714_101211618 | Ga0070714_1012116182 | 85 |
| 127 | 3300005436 | Ga0070713_100000621 | Ga0070713_1000006215 | 85 |
| 128 | 3300005436 | Ga0070713_100394131 | Ga0070713_1003941312 | 85 |
| 129 | 3300005437 | Ga0070710_10006664 | Ga0070710_100066643 | 85 |
| 130 | 3300005438 | Ga0070701_10167642 | Ga0070701_101676422 | 85 |
| 131 | 3300005439 | Ga0070711_100000562 | Ga0070711_10000056213 | 85 |
| 132 | 3300005439 | Ga0070711_100141071 | Ga0070711_1001410714 | 85 |
| 133 | 3300005439 | Ga0070711_101009756 | Ga0070711_1010097562 | 85 |
| 134 | 3300005439 | Ga0070711_101561825 | Ga0070711_1015618251 | 85 |
| 135 | 3300005440 | Ga0070705_100044643 | Ga0070705_1000446432 | 85 |
| 136 | 3300005445 | Ga0070708_100039815 | Ga0070708_1000398151 | 85 |
| 137 | 3300005455 | Ga0070663_100052970 | Ga0070663_1000529704 | 85 |
| 138 | 3300005455 | Ga0070663_100415218 | Ga0070663_1004152182 | 85 |
| 139 | 3300005456 | Ga0070678_100002847 | Ga0070678_1000028472 | 85 |
| 140 | 3300005457 | Ga0070662_100015044 | Ga0070662_1000150443 | 85 |
| 141 | 3300005457 | Ga0070662_100034161 | Ga0070662_1000341613 | 85 |
| 142 | 3300005458 | Ga0070681_10053935 | Ga0070681_100539356 | 85 |
| 143 | 3300005459 | Ga0068867_100303648 | Ga0068867_1003036482 | 85 |
| 144 | 3300005466 | Ga0070685_10001706 | Ga0070685_100017065 | 85 |
| 145 | 3300005467 | Ga0070706_100025279 | Ga0070706_1000252795 | 85 |
| 146 | 3300005518 | Ga0070699_100461878 | Ga0070699_1004618782 | 85 |
| 147 | 3300005518 | Ga0070699_100718938 | Ga0070699_1007189382 | 85 |
| 148 | 3300005530 | Ga0070679_100159685 | Ga0070679_1001596852 | 85 |
| 149 | 3300005535 | Ga0070684_100020647 | Ga0070684_1000206474 | 85 |
| 150 | 3300005535 | Ga0070684_100070714 | Ga0070684_1000707144 | 85 |
| 151 | 3300005536 | Ga0070697_100011036 | Ga0070697_1000110368 | 85 |
| 152 | 3300005539 | Ga0068853_100012925 | Ga0068853_1000129255 | 85 |
| 153 | 3300005539 | Ga0068853_100199306 | Ga0068853_1001993062 | 85 |
| 154 | 3300005543 | Ga0070672_100347514 | Ga0070672_1003475141 | 85 |
| 155 | 3300005544 | Ga0070686_100232324 | Ga0070686_1002323242 | 85 |
| 156 | 3300005545 | Ga0070695_100383240 | Ga0070695_1003832401 | 85 |
| 157 | 3300005545 | Ga0070695_100780801 | Ga0070695_1007808011 | 85 |
| 158 | 3300005546 | Ga0070696_100016947 | Ga0070696_1000169477 | 85 |
| 159 | 3300005546 | Ga0070696_100221773 | Ga0070696_1002217733 | 85 |
| 160 | 3300005547 | Ga0070693_100018809 | Ga0070693_1000188094 | 85 |
| 161 | 3300005547 | Ga0070693_100031585 | Ga0070693_1000315854 | 85 |
| 162 | 3300005548 | Ga0070665_100130301 | Ga0070665_1001303013 | 85 |
| 163 | 3300005549 | Ga0070704_100012707 | Ga0070704_1000127074 | 85 |
| 164 | 3300005563 | Ga0068855_100007194 | Ga0068855_10000719411 | 85 |
| 165 | 3300005564 | Ga0070664_100000658 | Ga0070664_10000065829 | 85 |
| 166 | 3300005564 | Ga0070664_100161415 | Ga0070664_1001614152 | 85 |
| 167 | 3300005564 | Ga0070664_100453622 | Ga0070664_1004536222 | 85 |
| 168 | 3300005577 | Ga0068857_100005799 | Ga0068857_1000057995 | 85 |
| 169 | 3300005578 | Ga0068854_100049776 | Ga0068854_1000497765 | 85 |
| 170 | 3300005578 | Ga0068854_100282114 | Ga0068854_1002821142 | 85 |
| 171 | 3300005578 | Ga0068854_100373954 | Ga0068854_1003739543 | 85 |
| 172 | 3300005614 | Ga0068856_100021309 | Ga0068856_1000213096 | 85 |
| 173 | 3300005614 | Ga0068856_100032074 | Ga0068856_1000320746 | 85 |
| 174 | 3300005615 | Ga0070702_100014764 | Ga0070702_1000147646 | 85 |
| 175 | 3300005615 | Ga0070702_100094519 | Ga0070702_1000945194 | 85 |
| 176 | 3300005616 | Ga0068852_100224103 | Ga0068852_1002241032 | 85 |
| 177 | 3300005616 | Ga0068852_100241207 | Ga0068852_1002412072 | 85 |
| 178 | 3300005617 | Ga0068859_100001741 | Ga0068859_10000174119 | 85 |
| 179 | 3300005618 | Ga0068864_100027331 | Ga0068864_1000273312 | 85 |
| 180 | 3300005718 | Ga0068866_10001140 | Ga0068866_1000114012 | 85 |
| 181 | 3300005719 | Ga0068861_101437426 | Ga0068861_1014374261 | 85 |
| 182 | 3300005834 | Ga0068851_10015536 | Ga0068851_100155366 | 85 |
| 183 | 3300005834 | Ga0068851_10018491 | Ga0068851_100184914 | 85 |
| 184 | 3300005840 | Ga0068870_10017607 | Ga0068870_100176073 | 85 |
| 185 | 3300005841 | Ga0068863_100007778 | Ga0068863_1000077788 | 85 |
| 186 | 3300005842 | Ga0068858_100025618 | Ga0068858_1000256187 | 85 |
| 187 | 3300005843 | Ga0068860_100595725 | Ga0068860_1005957252 | 85 |
| 188 | 3300005843 | Ga0068860_101642551 | Ga0068860_1016425512 | 85 |
| 189 | 3300006048 | Ga0075363_100257489 | Ga0075363_1002574892 | 85 |
| 190 | 3300006163 | Ga0070715_10110736 | Ga0070715_101107362 | 85 |
| 191 | 3300006173 | Ga0070716_100808323 | Ga0070716_1008083231 | 85 |
| 192 | 3300006175 | Ga0070712_100003612 | Ga0070712_1000036123 | 85 |
| 193 | 3300006175 | Ga0070712_100004881 | Ga0070712_1000048819 | 85 |
| 194 | 3300006175 | Ga0070712_101489584 | Ga0070712_1014895842 | 85 |
| 195 | 3300006177 | Ga0075362_10587777 | Ga0075362_105877772 | 85 |
| 196 | 3300006177 | Ga0075362_10712405 | Ga0075362_107124051 | 85 |
| 197 | 3300006237 | Ga0097621_100227817 | Ga0097621_1002278173 | 85 |
| 198 | 3300006237 | Ga0097621_102096495 | Ga0097621_1020964952 | 85 |
| 199 | 3300006358 | Ga0068871_100225108 | Ga0068871_1002251083 | 85 |
| 200 | 3300006358 | Ga0068871_100499180 | Ga0068871_1004991803 | 85 |
| 201 | 3300006358 | Ga0068871_101098175 | Ga0068871_1010981752 | 85 |
| 202 | 3300006844 | Ga0075428_102348913 | Ga0075428_1023489131 | 85 |
| 203 | 3300006871 | Ga0075434_100243253 | Ga0075434_1002432533 | 85 |
| 204 | 3300006871 | Ga0075434_100369726 | Ga0075434_1003697263 | 85 |
| 205 | 3300006871 | Ga0075434_102488385 | Ga0075434_1024883853 | 85 |
| 206 | 3300006881 | Ga0068865_100147061 | Ga0068865_1001470612 | 85 |
| 207 | 3300006931 | Ga0097620_100001741 | Ga0097620_10000174111 | 85 |
| 208 | 3300009093 | Ga0105240_10001889 | Ga0105240_1000188938 | 85 |
| 209 | 3300009098 | Ga0105245_10009343 | Ga0105245_100093433 | 85 |
| 210 | 3300009098 | Ga0105245_10009415 | Ga0105245_100094153 | 85 |
| 211 | 3300009098 | Ga0105245_10046677 | Ga0105245_100466774 | 85 |
| 212 | 3300009101 | Ga0105247_10014436 | Ga0105247_100144364 | 85 |
| 213 | 3300009148 | Ga0105243_10119280 | Ga0105243_101192803 | 85 |
| 214 | 3300009174 | Ga0105241_10011046 | Ga0105241_100110469 | 85 |
| 215 | 3300009174 | Ga0105241_10027934 | Ga0105241_100279344 | 85 |
| 216 | 3300009176 | Ga0105242_10008131 | Ga0105242_1000813111 | 85 |
| 217 | 3300009176 | Ga0105242_10115527 | Ga0105242_101155274 | 85 |
| 218 | 3300009177 | Ga0105248_10013308 | Ga0105248_100133083 | 85 |
| 219 | 3300009177 | Ga0105248_10818849 | Ga0105248_108188492 | 85 |
| 220 | 3300009545 | Ga0105237_11313250 | Ga0105237_113132502 | 85 |
| 221 | 3300009551 | Ga0105238_10009503 | Ga0105238_100095034 | 85 |
| 222 | 3300009551 | Ga0105238_10884733 | Ga0105238_108847332 | 85 |
| 223 | 3300009553 | Ga0105249_11647019 | Ga0105249_116470192 | 85 |
| 224 | 3300011119 | Ga0105246_10566276 | Ga0105246_105662762 | 85 |
| 225 | 3300013100 | Ga0157373_10013745 | Ga0157373_100137457 | 85 |
| 226 | 3300013104 | Ga0157370_10046754 | Ga0157370_100467546 | 85 |
| 227 | 3300013104 | Ga0157370_10221282 | Ga0157370_102212822 | 85 |
| 228 | 3300013105 | Ga0157369_10042059 | Ga0157369_100420592 | 85 |
| 229 | 3300013296 | Ga0157374_10001809 | Ga0157374_100018099 | 85 |
| 230 | 3300013296 | Ga0157374_10261469 | Ga0157374_102614692 | 85 |
| 231 | 3300013297 | Ga0157378_10009283 | Ga0157378_100092833 | 85 |
| 232 | 3300013297 | Ga0157378_10009954 | Ga0157378_100099542 | 85 |
| 233 | 3300013297 | Ga0157378_11205903 | Ga0157378_112059032 | 85 |
| 234 | 3300013306 | Ga0163162_10011811 | Ga0163162_100118113 | 85 |
| 235 | 3300013306 | Ga0163162_10078481 | Ga0163162_100784813 | 85 |
| 236 | 3300013307 | Ga0157372_10006706 | Ga0157372_100067063 | 85 |
| 237 | 3300013307 | Ga0157372_10543483 | Ga0157372_105434833 | 85 |
| 238 | 3300013307 | Ga0157372_10924433 | Ga0157372_109244332 | 85 |
| 239 | 3300013308 | Ga0157375_10008616 | Ga0157375_100086163 | 85 |
| 240 | 3300014325 | Ga0163163_10001352 | Ga0163163_1000135217 | 85 |
| 241 | 3300014326 | Ga0157380_10376579 | Ga0157380_103765793 | 85 |
| 242 | 3300014326 | Ga0157380_12382496 | Ga0157380_123824962 | 85 |
| 243 | 3300014745 | Ga0157377_10005762 | Ga0157377_100057623 | 85 |
| 244 | 3300014745 | Ga0157377_10336930 | Ga0157377_103369302 | 85 |
| 245 | 3300014968 | Ga0157379_10006078 | Ga0157379_100060783 | 85 |
| 246 | 3300014969 | Ga0157376_10005980 | Ga0157376_100059803 | 85 |
| 247 | 3300014969 | Ga0157376_10006034 | Ga0157376_100060343 | 85 |
| 248 | 3300017792 | Ga0163161_10085588 | Ga0163161_100855883 | 85 |
| 249 | 3300020070 | Ga0206356_10597502 | Ga0206356_105975022 | 85 |
| 250 | 3300021377 | Ga0213874_10189473 | Ga0213874_101894732 | 85 |
| 251 | 3300025321 | Ga0207656_10036142 | Ga0207656_100361423 | 85 |
| 252 | 3300025885 | Ga0207653_10044574 | Ga0207653_100445742 | 85 |
| 253 | 3300025898 | Ga0207692_10033157 | Ga0207692_100331573 | 85 |
| 254 | 3300025899 | Ga0207642_10000592 | Ga0207642_100005925 | 85 |
| 255 | 3300025903 | Ga0207680_10002576 | Ga0207680_100025765 | 85 |
| 256 | 3300025903 | Ga0207680_10353120 | Ga0207680_103531203 | 85 |
| 257 | 3300025905 | Ga0207685_10002717 | Ga0207685_100027174 | 85 |
| 258 | 3300025906 | Ga0207699_10918925 | Ga0207699_109189252 | 85 |
| 259 | 3300025907 | Ga0207645_10020446 | Ga0207645_100204464 | 85 |
| 260 | 3300025908 | Ga0207643_10011278 | Ga0207643_100112785 | 85 |
| 261 | 3300025909 | Ga0207705_10452506 | Ga0207705_104525062 | 85 |
| 262 | 3300025910 | Ga0207684_10448098 | Ga0207684_104480982 | 85 |
| 263 | 3300025911 | Ga0207654_10013929 | Ga0207654_100139293 | 85 |
| 264 | 3300025911 | Ga0207654_10208034 | Ga0207654_102080341 | 85 |
| 265 | 3300025911 | Ga0207654_10475349 | Ga0207654_104753491 | 85 |
| 266 | 3300025912 | Ga0207707_10076043 | Ga0207707_100760433 | 85 |
| 267 | 3300025912 | Ga0207707_10746854 | Ga0207707_107468542 | 85 |
| 268 | 3300025913 | Ga0207695_10061236 | Ga0207695_100612361 | 85 |
| 269 | 3300025915 | Ga0207693_10000652 | Ga0207693_1000065216 | 85 |
| 270 | 3300025916 | Ga0207663_10002608 | Ga0207663_100026085 | 85 |
| 271 | 3300025916 | Ga0207663_10218515 | Ga0207663_102185152 | 85 |
| 272 | 3300025916 | Ga0207663_10485671 | Ga0207663_104856711 | 85 |
| 273 | 3300025916 | Ga0207663_10762508 | Ga0207663_107625082 | 85 |
| 274 | 3300025917 | Ga0207660_10098203 | Ga0207660_100982033 | 85 |
| 275 | 3300025918 | Ga0207662_10118900 | Ga0207662_101189003 | 85 |
| 276 | 3300025919 | Ga0207657_10007901 | Ga0207657_1000790114 | 85 |
| 277 | 3300025919 | Ga0207657_10032956 | Ga0207657_100329562 | 85 |
| 278 | 3300025919 | Ga0207657_10234531 | Ga0207657_102345312 | 85 |
| 279 | 3300025920 | Ga0207649_10011486 | Ga0207649_100114867 | 85 |
| 280 | 3300025920 | Ga0207649_10175581 | Ga0207649_101755813 | 85 |
| 281 | 3300025921 | Ga0207652_10043014 | Ga0207652_100430144 | 85 |
| 282 | 3300025922 | Ga0207646_10107936 | Ga0207646_101079364 | 85 |
| 283 | 3300025924 | Ga0207694_10005853 | Ga0207694_100058539 | 85 |
| 284 | 3300025924 | Ga0207694_10173787 | Ga0207694_101737874 | 85 |
| 285 | 3300025925 | Ga0207650_10033734 | Ga0207650_100337343 | 85 |
| 286 | 3300025927 | Ga0207687_10002403 | Ga0207687_100024036 | 85 |
| 287 | 3300025927 | Ga0207687_10009624 | Ga0207687_100096249 | 85 |
| 288 | 3300025927 | Ga0207687_10073134 | Ga0207687_100731344 | 85 |
| 289 | 3300025928 | Ga0207700_10006059 | Ga0207700_100060598 | 85 |
| 290 | 3300025928 | Ga0207700_10954223 | Ga0207700_109542231 | 85 |
| 291 | 3300025929 | Ga0207664_10049165 | Ga0207664_100491655 | 85 |
| 292 | 3300025929 | Ga0207664_10889759 | Ga0207664_108897592 | 85 |
| 293 | 3300025929 | Ga0207664_11417614 | Ga0207664_114176142 | 85 |
| 294 | 3300025931 | Ga0207644_10001544 | Ga0207644_1000154411 | 85 |
| 295 | 3300025931 | Ga0207644_10123185 | Ga0207644_101231852 | 85 |
| 296 | 3300025933 | Ga0207706_10008050 | Ga0207706_100080507 | 85 |
| 297 | 3300025933 | Ga0207706_10045117 | Ga0207706_100451173 | 85 |
| 298 | 3300025934 | Ga0207686_10016224 | Ga0207686_100162246 | 85 |
| 299 | 3300025934 | Ga0207686_10334010 | Ga0207686_103340103 | 85 |
| 300 | 3300025936 | Ga0207670_10042018 | Ga0207670_100420183 | 85 |
| 301 | 3300025937 | Ga0207669_10074261 | Ga0207669_100742613 | 85 |
| 302 | 3300025938 | Ga0207704_10036269 | Ga0207704_100362694 | 85 |
| 303 | 3300025939 | Ga0207665_10006908 | Ga0207665_1000690810 | 85 |
| 304 | 3300025940 | Ga0207691_10046844 | Ga0207691_100468443 | 85 |
| 305 | 3300025941 | Ga0207711_10000087 | Ga0207711_1000008778 | 85 |
| 306 | 3300025941 | Ga0207711_11975819 | Ga0207711_119758192 | 85 |
| 307 | 3300025942 | Ga0207689_10092657 | Ga0207689_100926574 | 85 |
| 308 | 3300025942 | Ga0207689_10140083 | Ga0207689_101400834 | 85 |
| 309 | 3300025942 | Ga0207689_10498412 | Ga0207689_104984122 | 85 |
| 310 | 3300025944 | Ga0207661_10009752 | Ga0207661_100097527 | 85 |
| 311 | 3300025945 | Ga0207679_10003953 | Ga0207679_100039539 | 85 |
| 312 | 3300025945 | Ga0207679_10033839 | Ga0207679_100338392 | 85 |
| 313 | 3300025945 | Ga0207679_10876885 | Ga0207679_108768851 | 85 |
| 314 | 3300025949 | Ga0207667_10020237 | Ga0207667_100202374 | 85 |
| 315 | 3300025960 | Ga0207651_10004718 | Ga0207651_100047187 | 85 |
| 316 | 3300025981 | Ga0207640_10004420 | Ga0207640_100044204 | 85 |
| 317 | 3300025981 | Ga0207640_10265846 | Ga0207640_102658463 | 85 |
| 318 | 3300025981 | Ga0207640_10807485 | Ga0207640_108074851 | 85 |
| 319 | 3300025986 | Ga0207658_10034077 | Ga0207658_100340776 | 85 |
| 320 | 3300025986 | Ga0207658_10187491 | Ga0207658_101874912 | 85 |
| 321 | 3300026023 | Ga0207677_10003281 | Ga0207677_1000328112 | 85 |
| 322 | 3300026023 | Ga0207677_10041797 | Ga0207677_100417975 | 85 |
| 323 | 3300026035 | Ga0207703_10003435 | Ga0207703_1000343515 | 85 |
| 324 | 3300026041 | Ga0207639_10334991 | Ga0207639_103349913 | 85 |
| 325 | 3300026041 | Ga0207639_11936637 | Ga0207639_119366372 | 85 |
| 326 | 3300026041 | Ga0207639_12076710 | Ga0207639_120767102 | 85 |
| 327 | 3300026067 | Ga0207678_10007957 | Ga0207678_100079574 | 85 |
| 328 | 3300026067 | Ga0207678_10207610 | Ga0207678_102076103 | 85 |
| 329 | 3300026075 | Ga0207708_10623523 | Ga0207708_106235231 | 85 |
| 330 | 3300026078 | Ga0207702_10007712 | Ga0207702_100077128 | 85 |
| 331 | 3300026078 | Ga0207702_10089970 | Ga0207702_100899702 | 85 |
| 332 | 3300026078 | Ga0207702_10141546 | Ga0207702_101415463 | 85 |
| 333 | 3300026078 | Ga0207702_11193922 | Ga0207702_111939222 | 85 |
| 334 | 3300026078 | Ga0207702_11426675 | Ga0207702_114266752 | 85 |
| 335 | 3300026088 | Ga0207641_10008086 | Ga0207641_100080865 | 85 |
| 336 | 3300026089 | Ga0207648_10010002 | Ga0207648_100100022 | 85 |
| 337 | 3300026095 | Ga0207676_10000294 | Ga0207676_1000029422 | 85 |
| 338 | 3300026116 | Ga0207674_10000140 | Ga0207674_1000014048 | 85 |
| 339 | 3300026116 | Ga0207674_10002122 | Ga0207674_1000212213 | 85 |
| 340 | 3300026121 | Ga0207683_10000355 | Ga0207683_1000035530 | 85 |
| 341 | 3300026142 | Ga0207698_10016336 | Ga0207698_100163366 | 85 |
| 342 | 3300026142 | Ga0207698_10016903 | Ga0207698_100169032 | 85 |
| 343 | 3300026142 | Ga0207698_10061360 | Ga0207698_100613602 | 85 |
| 344 | 3300028379 | Ga0268266_10027032 | Ga0268266_100270324 | 85 |
| 345 | 3300028381 | Ga0268264_10007222 | Ga0268264_1000722212 | 85 |
| 346 | 3300028381 | Ga0268264_10014173 | Ga0268264_100141739 | 85 |
| 347 | 3300028794 | Ga0307515_10700302 | Ga0307515_107003021 | 85 |
| 348 | 3300031241 | Ga0265325_10017881 | Ga0265325_100178815 | 85 |
| 349 | 3300031507 | Ga0307509_10981369 | Ga0307509_109813691 | 85 |
| 350 | 3300031548 | Ga0307408_100849822 | Ga0307408_1008498222 | 85 |
| 351 | 3300031712 | Ga0265342_10200524 | Ga0265342_102005242 | 85 |
| 352 | 3300031730 | Ga0307516_10000674 | Ga0307516_100006743 | 85 |
| 353 | 3300031911 | Ga0307412_10737151 | Ga0307412_107371512 | 85 |
| 354 | 3300032005 | Ga0307411_11720146 | Ga0307411_117201462 | 85 |
| 355 | 3300035083 | Ga0373926_0097590 | Ga0373926_0097590_613_906 | 85 |
| 356 | 3300035083 | Ga0373926_0281458 | Ga0373926_0281458_124_417 | 85 |
| 357 | 3300035083 | Ga0373926_0293307 | Ga0373926_0293307_247_540 | 85 |
| 358 | 3300035086 | Ga0373934_0001028 | Ga0373934_0001028_5370_5663 | 85 |
| 359 | 3300035089 | Ga0373944_0099832 | Ga0373944_0099832_238_531 | 85 |
| 360 | 3300035089 | Ga0373944_0127025 | Ga0373944_0127025_446_739 | 85 |
| 361 | 3300035111 | Ga0373923_0000349 | Ga0373923_0000349_8075_8368 | 85 |
| 362 | 3300035112 | Ga0373932_0118639 | Ga0373932_0118639_549_812 | 85 |
| 363 | 3300035113 | Ga0373936_0062980 | Ga0373936_0062980_252_545 | 85 |
| 364 | 3300035117 | Ga0373953_0006544 | Ga0373953_0006544_2691_2984 | 85 |
| 365 | 3300035118 | Ga0373954_0001030 | Ga0373954_0001030_5362_5655 | 85 |
| 366 | 3300035119 | Ga0373956_0002915 | Ga0373956_0002915_2220_2513 | 85 |
| 367 | 3300035119 | Ga0373956_0084820 | Ga0373956_0084820_604_897 | 85 |
| 368 | 3300035120 | Ga0373957_0000571 | Ga0373957_0000571_3758_4051 | 85 |
| 369 | 3300035170 | Ga0373943_0061726 | Ga0373943_0061726_1362_1655 | 85 |
| 370 | 3300035170 | Ga0373943_0061733 | Ga0373943_0061733_716_1009 | 85 |
| 371 | 3300035170 | Ga0373943_0220810 | Ga0373943_0220810_135_428 | 85 |
| 372 | 3300035171 | Ga0373946_0044870 | Ga0373946_0044870_1119_1412 | 85 |
| 373 | 3300035171 | Ga0373946_0319524 | Ga0373946_0319524_93_386 | 85 |
| 374 | 3300035172 | Ga0373955_0046454 | Ga0373955_0046454_376_669 | 85 |
| 375 | 3300035242 | Ga0373962_0177309 | Ga0373962_0177309_49_312 | 85 |
| 376 | 3300035410 | Ga0373924_0003473 | Ga0373924_0003473_1598_1891 | 85 |
| 377 | 3300035691 | Ga0373931_0140471 | Ga0373931_0140471_575_868 | 85 |
| 378 | 3300035692 | Ga0373935_0059111 | Ga0373935_0059111_1569_1862 | 85 |
| 379 | 3300035692 | Ga0373935_0104218 | Ga0373935_0104218_1170_1463 | 85 |
| 380 | 3300035692 | Ga0373935_0329319 | Ga0373935_0329319_218_511 | 85 |
| 381 | 3300035695 | Ga0373927_0009005 | Ga0373927_0009005_6105_6398 | 85 |
| 382 | 3300035695 | Ga0373927_0717627 | Ga0373927_0717627_158_451 | 85 |
| 383 | 3300035724 | Ga0373933_0004932 | Ga0373933_0004932_107_400 | 85 |
| 384 | 3300035724 | Ga0373933_0139582 | Ga0373933_0139582_1089_1382 | 85 |
| 385 | 3300035725 | Ga0373947_0031091 | Ga0373947_0031091_690_983 | 85 |
| 386 | 3300035725 | Ga0373947_0081985 | Ga0373947_0081985_615_908 | 85 |
| 387 | 3300035725 | Ga0373947_0130745 | Ga0373947_0130745_1214_1507 | 85 |
| 388 | 3300036401 | Ga0373937_0001093 | Ga0373937_0001093_10151_10444 | 85 |
| 389 | 3300036401 | Ga0373937_0056352 | Ga0373937_0056352_2447_2740 | 85 |
| 390 | 3300036401 | Ga0373937_0467075 | Ga0373937_0467075_114_407 | 85 |
| 391 | 3300036401 | Ga0373937_0670776 | Ga0373937_0670776_596_853 | 85 |
| 392 | 3300037068 | Ga0373925_0087135 | Ga0373925_0087135_887_1180 | 85 |
| 393 | 3300037068 | Ga0373925_0410320 | Ga0373925_0410320_430_723 | 85 |
| 394 | 3300037068 | Ga0373925_0483835 | Ga0373925_0483835_635_928 | 85 |
| 395 | 3300037471 | Ga0395905_0444831 | Ga0395905_0444831_197_457 | 85 |
| 396 | 3300039438 | Ga0436360_0649202 | Ga0436360_0649202_406_663 | 85 |
| 397 | 3300039450 | Ga0436363_0720287 | Ga0436363_0720287_452_709 | 85 |
| 398 | 3300041459 | Ga0451800_1285167 | Ga0451800_1285167_333_593 | 85 |
| 399 | 3300041507 | Ga0451851_1060694 | Ga0451851_1060694_868_1128 | 85 |
| 400 | 3300041512 | Ga0451853_0980077 | Ga0451853_0980077_563_856 | 85 |
| 401 | 3300046459 | Ga0495629_0809823 | Ga0495629_0809823_236_529 | 85 |
| 402 | 3300046462 | Ga0495651_0537135 | Ga0495651_0537135_97_390 | 85 |
| 403 | 3300046463 | Ga0495653_0098730 | Ga0495653_0098730_577_870 | 85 |
| 404 | 3300046472 | Ga0495580_0168775 | Ga0495580_0168775_964_1257 | 85 |
| 405 | 3300046476 | Ga0495662_0045115 | Ga0495662_0045115_1089_1382 | 85 |
| 406 | 3300046477 | Ga0495664_0148810 | Ga0495664_0148810_917_1210 | 85 |
| 407 | 3300046511 | Ga0495608_0391091 | Ga0495608_0391091_262_555 | 85 |
| 408 | 3300046516 | Ga0495628_0145364 | Ga0495628_0145364_13_306 | 85 |
| 409 | 3300046517 | Ga0495630_0823938 | Ga0495630_0823938_352_645 | 85 |
| 410 | 3300046529 | Ga0495652_0125994 | Ga0495652_0125994_772_1065 | 85 |
| 411 | 3300046533 | Ga0495640_0271769 | Ga0495640_0271769_231_524 | 85 |
| 412 | 3300046535 | Ga0495586_0168991 | Ga0495586_0168991_240_533 | 85 |
| 413 | 3300046536 | Ga0495587_0092653 | Ga0495587_0092653_448_741 | 85 |
| 414 | 3300046539 | Ga0495621_0046416 | Ga0495621_0046416_58_351 | 85 |
| 415 | 3300046543 | Ga0495645_0026388 | Ga0495645_0026388_262_555 | 85 |
| 416 | 3300046543 | Ga0495645_0670707 | Ga0495645_0670707_147_440 | 85 |
| 417 | 3300046559 | Ga0495667_0224935 | Ga0495667_0224935_519_812 | 85 |
| 418 | 3300046642 | Ga0495634_0377834 | Ga0495634_0377834_313_606 | 85 |
| 419 | 3300046664 | Ga0495659_0066223 | Ga0495659_0066223_38_331 | 85 |
| 420 | 3300046674 | Ga0495588_0100292 | Ga0495588_0100292_652_945 | 85 |
| 421 | 3300046675 | Ga0495657_0132288 | Ga0495657_0132288_205_498 | 85 |
| 422 | 3300046679 | Ga0495623_0016408 | Ga0495623_0016408_2619_2912 | 85 |
| 423 | 3300046681 | Ga0495647_0004099 | Ga0495647_0004099_1579_1872 | 85 |
| 424 | 3300046684 | Ga0495669_0382083 | Ga0495669_0382083_274_567 | 85 |
| 425 | 3300046809 | Ga0495600_0060078 | Ga0495600_0060078_1652_1945 | 85 |
| 426 | 3300047315 | Ga0495581_0007795 | Ga0495581_0007795_2896_3189 | 85 |
| 427 | 3300047319 | Ga0495674_0134572 | Ga0495674_0134572_417_710 | 85 |
| 428 | 3300047322 | Ga0495680_0058477 | Ga0495680_0058477_1557_1850 | 85 |
| 429 | 3300047444 | Ga0495675_0063091 | Ga0495675_0063091_781_1074 | 85 |
| 430 | 3300048088 | Ga0495602_0134711 | Ga0495602_0134711_1567_1860 | 85 |
| 431 | 3300048088 | Ga0495602_0777646 | Ga0495602_0777646_113_406 | 85 |
| 432 | 3300048903 | Ga0496100_0491507 | Ga0496100_0491507_226_519 | 85 |
| 433 | 3300048904 | Ga0496101_0062991 | Ga0496101_0062991_2202_2495 | 85 |
| 434 | 3300048905 | Ga0496102_0467056 | Ga0496102_0467056_837_1130 | 85 |
| 435 | 3300048906 | Ga0496103_0132828 | Ga0496103_0132828_1243_1536 | 85 |
| 436 | 3300048907 | Ga0496104_0015746 | Ga0496104_0015746_887_1180 | 85 |
| 437 | 3300048908 | Ga0496105_0004395 | Ga0496105_0004395_1237_1530 | 85 |
| 438 | 3300048910 | Ga0496107_0243964 | Ga0496107_0243964_385_678 | 85 |
| 439 | 3300048910 | Ga0496107_0619921 | Ga0496107_0619921_157_423 | 85 |
| 440 | 3300048911 | Ga0496108_0028601 | Ga0496108_0028601_3741_4034 | 85 |
| 441 | 3300048912 | Ga0496109_0004450 | Ga0496109_0004450_6485_6778 | 85 |
| 442 | 3300048913 | Ga0496110_0187003 | Ga0496110_0187003_441_734 | 85 |
| 443 | 3300048915 | Ga0496112_0003789 | Ga0496112_0003789_5072_5365 | 85 |
| 444 | 3300048917 | Ga0496114_0127683 | Ga0496114_0127683_1835_2128 | 85 |
| 445 | 3300048918 | Ga0496115_0066673 | Ga0496115_0066673_1076_1369 | 85 |
| 446 | 3300048927 | Ga0496124_0108369 | Ga0496124_0108369_412_672 | 85 |
| 447 | 3300049586 | Ga0501070_0815932 | Ga0501070_0815932_373_630 | 85 |
| 448 | 3300050493 | nmdc:mga0k408_868337_c1 | nmdc:mga0k408_868337_c1_243_503 | 85 |
| 449 | 3300050494 | nmdc:mga06z11_911794_c1 | nmdc:mga06z11_911794_c1_70_330 | 85 |
| 450 | 3300050512 | nmdc:mga0n895_365840_c1 | nmdc:mga0n895_365840_c1_857_1150 | 85 |
| 451 | 3300053077 | Ga0495601_0017347 | Ga0495601_0017347_1643_1936 | 85 |
| 452 | 3300053077 | Ga0495601_0150133 | Ga0495601_0150133_538_831 | 85 |
| 453 | 3300053078 | Ga0495612_0029135 | Ga0495612_0029135_312_605 | 85 |
| 454 | 3300053078 | Ga0495612_0082889 | Ga0495612_0082889_463_756 | 85 |
| 455 | 3300053084 | Ga0495595_0024784 | Ga0495595_0024784_1630_1923 | 85 |
| 456 | 3300053085 | Ga0495619_0169917 | Ga0495619_0169917_361_654 | 85 |
| 457 | 3300053085 | Ga0495619_0347338 | Ga0495619_0347338_381_674 | 85 |
| 458 | 3300053158 | Ga0500627_0505794 | Ga0500627_0505794_76_336 | 85 |
| 459 | 3300039447 | Ga0436361_0784397 | Ga0436361_0784397_144_407 | 86 |
| 460 | 3300044693 | Ga0466961_0058801 | Ga0466961_0058801_1818_2081 | 86 |
| 461 | 3300044842 | Ga0466957_0545307 | Ga0466957_0545307_45_308 | 86 |
| 462 | 3300045049 | Ga0466959_0035337 | Ga0466959_0035337_478_741 | 86 |
| 463 | 3300006846 | Ga0075430_100457452 | Ga0075430_1004574522 | 87 |
| 464 | 3300030760 | Ga0265762_1091070 | Ga0265762_10910702 | 87 |
| 465 | 3300031090 | Ga0265760_10112625 | Ga0265760_101126252 | 87 |
| 466 | 3300031249 | Ga0265339_10092815 | Ga0265339_100928153 | 87 |
| 467 | 3300039453 | Ga0436362_0139994 | Ga0436362_0139994_48_317 | 87 |
| 468 | 3300003322 | rootL2_10014067 | rootL2_1001406715 | 88 |
| 469 | 3300046473 | Ga0495582_0511366 | Ga0495582_0511366_258_527 | 88 |
| 470 | 3300005530 | Ga0070679_100027431 | Ga0070679_1000274313 | 89 |
| 471 | 3300006178 | Ga0075367_10492742 | Ga0075367_104927422 | 89 |
| 472 | 3300041458 | Ga0451798_0126328 | Ga0451798_0126328_954_1226 | 89 |
| 473 | 3300046471 | Ga0495650_0167688 | Ga0495650_0167688_52_327 | 89 |
| 474 | 3300047472 | Ga0495686_0051074 | Ga0495686_0051074_623_898 | 89 |
| 475 | 3300050494 | nmdc:mga06z11_443174_c1 | nmdc:mga06z11_443174_c1_449_748 | 89 |
| 476 | 3300031548 | Ga0307408_100001498 | Ga0307408_1000014985 | 90 |
| 477 | 3300031727 | Ga0316576_10132045 | Ga0316576_101320453 | 90 |
| 478 | 3300031728 | Ga0316578_10037032 | Ga0316578_100370323 | 90 |
| 479 | 3300031731 | Ga0307405_10001138 | Ga0307405_100011382 | 90 |
| 480 | 3300031733 | Ga0316577_10015985 | Ga0316577_100159853 | 90 |
| 481 | 3300031824 | Ga0307413_10003003 | Ga0307413_100030033 | 90 |
| 482 | 3300031852 | Ga0307410_10001643 | Ga0307410_100016438 | 90 |
| 483 | 3300031901 | Ga0307406_10002738 | Ga0307406_100027388 | 90 |
| 484 | 3300031903 | Ga0307407_10006282 | Ga0307407_100062825 | 90 |
| 485 | 3300031911 | Ga0307412_10032795 | Ga0307412_100327954 | 90 |
| 486 | 3300031995 | Ga0307409_100014130 | Ga0307409_1000141304 | 90 |
| 487 | 3300032002 | Ga0307416_100007511 | Ga0307416_1000075114 | 90 |
| 488 | 3300032004 | Ga0307414_10033734 | Ga0307414_100337344 | 90 |
| 489 | 3300032005 | Ga0307411_10018866 | Ga0307411_100188664 | 90 |
| 490 | 3300032126 | Ga0307415_100001765 | Ga0307415_1000017655 | 90 |
| 491 | 3300032139 | Ga0316580_10131388 | Ga0316580_101313882 | 90 |
| 492 | 3300033528 | Ga0316588_1113511 | Ga0316588_11135112 | 90 |
| 493 | 3300035398 | Ga0316574_0000470 | Ga0316574_0000470_12020_12292 | 90 |
| 494 | 3300036647 | Ga0316582_0001306 | Ga0316582_0001306_6905_7177 | 90 |
| 495 | 3300036712 | Ga0316584_0006760 | Ga0316584_0006760_5851_6123 | 90 |
| 496 | 3300049576 | Ga0501040_0206737 | Ga0501040_0206737_266_547 | 90 |
| 497 | 3300049588 | Ga0501072_1069288 | Ga0501072_1069288_73_354 | 90 |
| 498 | 3300049590 | Ga0501074_0933249 | Ga0501074_0933249_284_565 | 90 |
| 499 | 3300049591 | Ga0501075_0198057 | Ga0501075_0198057_914_1195 | 90 |
| 500 | 3300042876 | Ga0451577_0023224 | Ga0451577_0023224_1853_2128 | 91 |
| 501 | 3300042876 | Ga0451577_0174985 | Ga0451577_0174985_1101_1376 | 91 |
| 502 | 3300044712 | Ga0453684_0031880 | Ga0453684_0031880_2000_2275 | 91 |
| 503 | 3300045051 | Ga0451576_0037379 | Ga0451576_0037379_359_634 | 91 |
| 504 | 3300045051 | Ga0451576_1325122 | Ga0451576_1325122_175_450 | 91 |
| 505 | 3300009177 | Ga0105248_11352713 | Ga0105248_113527132 | 92 |
| 506 | 3300025941 | Ga0207711_11734469 | Ga0207711_117344692 | 92 |
| 507 | 3300032004 | Ga0307414_10327583 | Ga0307414_103275832 | 92 |
| 508 | 2162886007 | SwRhRL2b_contig_1270333 | SwRhRL2b_0128.00001620 | 93 |
| 509 | 2162886007 | SwRhRL2b_contig_1635463 | SwRhRL2b_0742.00005790 | 93 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4tr0-assembly2.cif.gz_B | crystal structure of gssg-bound cgrx2 | 0.9546 | 9 | 93 |
| 4tr1-assembly1.cif.gz_A | crystal structure of gsh-bound cgrx2/c15s | 0.952 | 9 | 93 |
| 1fov-assembly1.cif.gz_A | glutaredoxin 3 from escherichia coli in the fully oxidized form | 0.948 | 10 | 90 |
| 4tr1-assembly2.cif.gz_B | crystal structure of gsh-bound cgrx2/c15s | 0.9456 | 9 | 91 |
| 1nm3-assembly1.cif.gz_B | crystal structure of heamophilus influenza hybrid-prx5 | 0.925 | 8 | 81 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6GDU0_1_74_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9627 | 21 | 90 | 3.40.30.10 |
| 4tr0B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9536 | 9 | 93 | 3.40.30.10 |
| af_A0A1D6LVM4_243_327_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9503 | 9 | 89 | 3.40.30.10 |
| af_A0A1D6KSR1_221_307_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9324 | 9 | 90 | 3.40.30.10 |
| 3grxA00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9235 | 10 | 90 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N1DNA2-F1-model_v4 | Glutaredoxin | 1.002 | 9 | 90 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |
| AF-A0A0H4UWF2-F1-model_v4 | deleted | 1.001 | 10 | 90 |
|
| AF-A0A2A4QQS8-F1-model_v4 | Glutaredoxin | 1.001 | 9 | 90 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |
| AF-A0A3A4QCT5-F1-model_v4 | Glutaredoxin | 1 | 11 | 90 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |
| AF-A0A847DDF6-F1-model_v4 | Glutaredoxin | 0.9996 | 9 | 90 |
GO:0005737
GO:0015038 GO:0034599 GO:0045454 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar