F456968

General Info

Members Datasets Scaffolds Average Seq Length
509 213 1020 308

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10022735|Ga0111539_100227354
Length 364
Sequence MIIYVFIQINKDKLILRVCSFVIQQFIDSLFSTWRKMYIAVAKNLMKKIICLCLLMTGHFIHLFAQDIKKDTVYVGIYITSIHDIDFKQKEFATSFWLWMRYRNHEFDFYNNLEIPSAKSIEKSFFTIDTSGGQVYLQMKLQCVMKDSWRISNFPFDEQKLRISLENSQFDANSLVIMPDTAGAHFDRRFTLRGWKIDSCIISSGKRVYETAFGLANGGKQLSEYSNFRVRLSITRDAGGLFWKMFLGMYLAFLITFICFYIHADSMDSRFGLSVGSLFAVVGNKYIIDSSLPESSSFTLVDTLHGLTLFVILVVIAANAHSLRLIKKDKFKEAIKFDNKIALVILILYVLLNFWFIWQAKYGK

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
93 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
94 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
153 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
163 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
164 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
165 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
166 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
167 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
168 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
177 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
183 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
204 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
205 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
206 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
207 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
208 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
209 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
210 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
211 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
212 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
213 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 0
Isolates 1.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.77
Nodule 0
Rhizoplane 0.79
Rhizosphere 94.7
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10022735 3300009094 Bacteria 7700
2 JGI24751J29686_10001499 3300002459 Unclassified 4852
3 JGI25158J39367_1002839 3300002739 Bacteria 2746
4 rootH1_10017206 3300003316 Bacteria 3483
5 rootH1_10017206 3300003323 Bacteria 1740
6 rootH1_10149922 3300003316 Bacteria 1355
7 rootH1_10149922 3300003323 Bacteria 1686
8 rootH2_10056725 3300003320 Bacteria 17011
9 rootL2_10124221 3300003322 Bacteria 1941
10 rootH1_10001695 3300003323 Bacteria 2724
11 rootH1_10100522 3300003323 Bacteria 2772
12 Ga0065714_10007089 3300005288 Bacteria 4100
13 Ga0065712_10000790 3300005290 Bacteria 8045
14 Ga0065712_10004359 3300005290 Bacteria 3240
15 Ga0065712_10084896 3300005290 Bacteria 2733
16 Ga0065715_10106291 3300005293 Bacteria 2839
17 Ga0065715_10127044 3300005293 Bacteria 2096
18 Ga0070658_10314847 3300005327 Bacteria 1336
19 Ga0070676_10003926 3300005328 Bacteria 7802
20 Ga0070676_10016929 3300005328 Bacteria 4030
21 Ga0070676_10022167 3300005328 Bacteria 3560
22 Ga0070676_10126779 3300005328 Bacteria 1609
23 Ga0070683_100000439 3300005329 Bacteria 28892
24 Ga0070683_100001669 3300005329 Bacteria 17224
25 Ga0070683_100016564 3300005329 Bacteria 6503
26 Ga0070683_100258839 3300005329 Bacteria 1655
27 Ga0070690_100328660 3300005330 Bacteria 1104
28 Ga0070670_100025346 3300005331 Bacteria 5102
29 Ga0070670_100057679 3300005331 Bacteria 3333
30 Ga0070670_100090740 3300005331 Bacteria 2626
31 Ga0070670_100093434 3300005331 Bacteria 2587
32 Ga0070670_100164028 3300005331 Unclassified 1926
33 Ga0070670_100329088 3300005331 Unclassified 1340
34 Ga0070670_100381217 3300005331 Unclassified 1242
35 Ga0070677_10004524 3300005333 Bacteria 4539
36 Ga0070677_10007319 3300005333 Bacteria 3682
37 Ga0068869_100002672 3300005334 Bacteria 10776
38 Ga0068869_100003135 3300005334 Bacteria 10085
39 Ga0068869_100027826 3300005334 Bacteria 3944
40 Ga0068869_100089932 3300005334 Bacteria 2306
41 Ga0068869_100124093 3300005334 Bacteria 1978
42 Ga0068869_100151274 3300005334 Bacteria 1800
43 Ga0068869_100304120 3300005334 Bacteria 1289
44 Ga0070666_10000470 3300005335 Bacteria 24388
45 Ga0070666_10029989 3300005335 Bacteria 3580
46 Ga0070680_100066915 3300005336 Bacteria 2947
47 Ga0068868_100000658 3300005338 Bacteria 23281
48 Ga0068868_100032721 3300005338 Bacteria 4002
49 Ga0068868_100033454 3300005338 Bacteria 3963
50 Ga0068868_100043943 3300005338 Bacteria 3491
51 Ga0068868_100182864 3300005338 Bacteria 1740
52 Ga0068868_100208952 3300005338 Unclassified 1631
53 Ga0070689_100007156 3300005340 Bacteria 7778
54 Ga0070689_100013288 3300005340 Bacteria 5955
55 Ga0070689_100013860 3300005340 Bacteria 5843
56 Ga0070689_100293115 3300005340 Bacteria 1352
57 Ga0070687_100045270 3300005343 Bacteria 2246
58 Ga0070661_100001766 3300005344 Bacteria 14999
59 Ga0070661_100017243 3300005344 Bacteria 5120
60 Ga0070668_100081498 3300005347 Bacteria 2537
61 Ga0070668_100116023 3300005347 Bacteria 2135
62 Ga0070668_100130127 3300005347 Bacteria 2019
63 Ga0070669_100037456 3300005353 Bacteria 3518
64 Ga0070669_100041841 3300005353 Bacteria 3333
65 Ga0070669_100044822 3300005353 Bacteria 3222
66 Ga0070669_100262802 3300005353 Bacteria 1378
67 Ga0070675_100022283 3300005354 Bacteria 5060
68 Ga0070675_100027768 3300005354 Bacteria 4550
69 Ga0070675_100087279 3300005354 Bacteria 2609
70 Ga0070675_100200994 3300005354 Unclassified 1730
71 Ga0070671_100118273 3300005355 Bacteria 2229
72 Ga0070671_100224959 3300005355 Bacteria 1592
73 Ga0070673_100005298 3300005364 Bacteria 8241
74 Ga0070673_100007282 3300005364 Bacteria 7285
75 Ga0070673_100026043 3300005364 Bacteria 4314
76 Ga0070673_100136240 3300005364 Bacteria 2067
77 Ga0070673_100171953 3300005364 Unclassified 1850
78 Ga0070673_100334087 3300005364 Unclassified 1341
79 Ga0070673_100367838 3300005364 Bacteria 1279
80 Ga0070673_100530234 3300005364 Bacteria 1068
81 Ga0070688_100091432 3300005365 Bacteria 1989
82 Ga0070688_100172009 3300005365 Bacteria 1496
83 Ga0070659_100086031 3300005366 Bacteria 2515
84 Ga0070667_100029116 3300005367 Bacteria 4599
85 Ga0070667_100084351 3300005367 Bacteria 2723
86 Ga0070701_10048467 3300005438 Bacteria 2192
87 Ga0070663_100134306 3300005455 Bacteria 1882
88 Ga0070678_100182405 3300005456 Bacteria 1720
89 Ga0070678_100358970 3300005456 Unclassified 1255
90 Ga0070662_100001642 3300005457 Bacteria 13780
91 Ga0070662_100009992 3300005457 Bacteria 6213
92 Ga0070662_100031224 3300005457 Unclassified 3737
93 Ga0070662_100120781 3300005457 Bacteria 2008
94 Ga0070662_100174818 3300005457 Bacteria 1689
95 Ga0070662_100208548 3300005457 Bacteria 1554
96 Ga0070681_10041548 3300005458 Bacteria 4608
97 Ga0070681_10189680 3300005458 Bacteria 1975
98 Ga0068867_100021678 3300005459 Unclassified 4584
99 Ga0068867_100033261 3300005459 Bacteria 3732
100 Ga0068867_100101641 3300005459 Bacteria 2197
101 Ga0070685_10004551 3300005466 Bacteria 7019
102 Ga0070685_10017481 3300005466 Unclassified 3839
103 Ga0070685_10047459 3300005466 Bacteria 2469
104 Ga0070685_10106998 3300005466 Bacteria 1717
105 Ga0070679_100020027 3300005530 Bacteria 6519
106 Ga0070684_100000465 3300005535 Bacteria 27738
107 Ga0070684_100003698 3300005535 Bacteria 11540
108 Ga0070684_100011630 3300005535 Bacteria 7015
109 Ga0070684_100040832 3300005535 Bacteria 3997
110 Ga0068853_100003783 3300005539 Bacteria 11593
111 Ga0068853_100019189 3300005539 Bacteria 5666
112 Ga0068853_100071068 3300005539 Unclassified 3030
113 Ga0068853_100085238 3300005539 Unclassified 2769
114 Ga0068853_100182584 3300005539 Unclassified 1903
115 Ga0070672_100225168 3300005543 Unclassified 1574
116 Ga0070672_100442609 3300005543 Bacteria 1118
117 Ga0070686_100020063 3300005544 Bacteria 3951
118 Ga0070686_100054069 3300005544 Bacteria 2567
119 Ga0070686_100180408 3300005544 Bacteria 1500
120 Ga0070665_100038063 3300005548 Bacteria 4835
121 Ga0070665_100279290 3300005548 Unclassified 1672
122 Ga0068855_100001787 3300005563 Bacteria 26881
123 Ga0068855_100160629 3300005563 Bacteria 2551
124 Ga0068855_100462458 3300005563 Bacteria 1383
125 Ga0070664_100001035 3300005564 Bacteria 21877
126 Ga0070664_100004076 3300005564 Bacteria 11741
127 Ga0070664_100019224 3300005564 Bacteria 5619
128 Ga0070664_100288818 3300005564 Unclassified 1480
129 Ga0068857_100028580 3300005577 Bacteria 4920
130 Ga0068857_100058791 3300005577 Bacteria 3415
131 Ga0068857_100282790 3300005577 Bacteria 1526
132 Ga0068857_100383513 3300005577 Bacteria 1305
133 Ga0068856_100009483 3300005614 Bacteria 9450
134 Ga0068856_100362355 3300005614 Bacteria 1468
135 Ga0070702_100127584 3300005615 Bacteria 1602
136 Ga0068852_100002245 3300005616 Bacteria 13263
137 Ga0068852_100002978 3300005616 Bacteria 11767
138 Ga0068852_100007347 3300005616 Bacteria 8039
139 Ga0068852_100023497 3300005616 Bacteria 4963
140 Ga0068852_100037746 3300005616 Bacteria 4053
141 Ga0068859_100000012 3300005617 Bacteria 300376
142 Ga0068859_100025982 3300005617 Bacteria 5875
143 Ga0068859_100045630 3300005617 Bacteria 4402
144 Ga0068859_100071863 3300005617 Bacteria 3495
145 Ga0068859_100110142 3300005617 Bacteria 2815
146 Ga0068859_100143520 3300005617 Unclassified 2461
147 Ga0068859_100148912 3300005617 Bacteria 2416
148 Ga0068859_100169006 3300005617 Bacteria 2267
149 Ga0068859_100273967 3300005617 Bacteria 1780
150 Ga0068859_100350301 3300005617 Bacteria 1571
151 Ga0068864_100020169 3300005618 Bacteria 5576
152 Ga0068864_100079208 3300005618 Unclassified 2876
153 Ga0068864_100237540 3300005618 Unclassified 1687
154 Ga0068864_100547584 3300005618 Bacteria 1118
155 Ga0068866_10074920 3300005718 Bacteria 1801
156 Ga0068866_10091506 3300005718 Bacteria 1658
157 Ga0068861_100002531 3300005719 Bacteria 11941
158 Ga0068861_100143488 3300005719 Bacteria 1952
159 Ga0068861_100146626 3300005719 Bacteria 1932
160 Ga0068851_10064748 3300005834 Unclassified 1879
161 Ga0068870_10003764 3300005840 Bacteria 6453
162 Ga0068863_100119569 3300005841 Bacteria 2511
163 Ga0068863_100194888 3300005841 Bacteria 1948
164 Ga0068858_100007142 3300005842 Bacteria 10843
165 Ga0068858_100074900 3300005842 Bacteria 3143
166 Ga0068858_100162838 3300005842 Bacteria 2101
167 Ga0068860_100015093 3300005843 Bacteria 7549
168 Ga0068860_100038858 3300005843 Bacteria 4553
169 Ga0068860_100342240 3300005843 Bacteria 1471
170 Ga0068860_100411030 3300005843 Unclassified 1340
171 Ga0070715_10012162 3300006163 Bacteria 3123
172 Ga0070715_10026598 3300006163 Bacteria 2303
173 Ga0075366_10052694 3300006195 Bacteria 2417
174 Ga0075366_10132255 3300006195 Bacteria 1506
175 Ga0097621_100030624 3300006237 Bacteria 4261
176 Ga0097621_100038780 3300006237 Bacteria 3823
177 Ga0097621_100068070 3300006237 Bacteria 2936
178 Ga0097621_100166401 3300006237 Bacteria 1898
179 Ga0097621_100320951 3300006237 Bacteria 1372
180 Ga0097621_100352471 3300006237 Bacteria 1309
181 Ga0097621_100422119 3300006237 Bacteria 1197
182 Ga0068871_100042089 3300006358 Bacteria 3665
183 Ga0068871_100052390 3300006358 Unclassified 3305
184 Ga0068871_100299340 3300006358 Bacteria 1411
185 Ga0068871_100302655 3300006358 Bacteria 1404
186 Ga0075428_100197877 3300006844 Unclassified 2173
187 Ga0075431_100043609 3300006847 Unclassified 4626
188 Ga0075429_100044521 3300006880 Unclassified 3860
189 Ga0075429_100496844 3300006880 Bacteria 1069
190 Ga0068865_100058612 3300006881 Bacteria 2690
191 Ga0068865_100099629 3300006881 Bacteria 2125
192 Ga0097620_100000012 3300006931 Bacteria 300376
193 Ga0097620_100025982 3300006931 Bacteria 5875
194 Ga0097620_100045632 3300006931 Bacteria 4402
195 Ga0097620_100071864 3300006931 Bacteria 3495
196 Ga0097620_100110139 3300006931 Bacteria 2815
197 Ga0097620_100143528 3300006931 Unclassified 2461
198 Ga0097620_100148901 3300006931 Bacteria 2416
199 Ga0097620_100169009 3300006931 Bacteria 2267
200 Ga0097620_100273965 3300006931 Bacteria 1780
201 Ga0097620_100350305 3300006931 Bacteria 1571
202 Ga0105240_10036150 3300009093 Bacteria 6356
203 Ga0105247_10001409 3300009101 Bacteria 17436
204 Ga0114129_10050382 3300009147 Bacteria 5849
205 Ga0105241_10006619 3300009174 Bacteria 8538
206 Ga0105241_10007353 3300009174 Bacteria 8100
207 Ga0105241_10023083 3300009174 Unclassified 4612
208 Ga0105242_10003990 3300009176 Bacteria 11466
209 Ga0105242_10039739 3300009176 Bacteria 3788
210 Ga0105242_10190781 3300009176 Bacteria 1814
211 Ga0105242_10196877 3300009176 Unclassified 1787
212 Ga0105242_10313034 3300009176 Bacteria 1437
213 Ga0105237_10005184 3300009545 Bacteria 14739
214 Ga0105237_10007356 3300009545 Bacteria 12066
215 Ga0105237_10050413 3300009545 Bacteria 4182
216 Ga0105249_10000628 3300009553 Bacteria 32164
217 Ga0105249_10018024 3300009553 Bacteria 6276
218 Ga0105249_10048912 3300009553 Bacteria 3856
219 Ga0105249_10121019 3300009553 Bacteria 2487
220 Ga0105249_10345445 3300009553 Bacteria 1506
221 Ga0105239_10000432 3300010375 Bacteria 61084
222 Ga0105239_10000886 3300010375 Bacteria 42475
223 Ga0105239_10007177 3300010375 Bacteria 12814
224 Ga0105239_10130997 3300010375 Bacteria 2790
225 Ga0105239_10196815 3300010375 Bacteria 2257
226 Ga0105239_10243498 3300010375 Bacteria 2019
227 Ga0105246_10082579 3300011119 Bacteria 2294
228 Ga0105246_10208965 3300011119 Bacteria 1522
229 Ga0105246_10452189 3300011119 Bacteria 1080
230 Ga0157373_10006792 3300013100 Bacteria 8523
231 Ga0157373_10017278 3300013100 Bacteria 5253
232 Ga0157373_10019462 3300013100 Bacteria 4939
233 Ga0157373_10200565 3300013100 Bacteria 1406
234 Ga0157371_10001920 3300013102 Bacteria 20754
235 Ga0157371_10154043 3300013102 Bacteria 1640
236 Ga0157370_10004433 3300013104 Bacteria 16087
237 Ga0157370_10072681 3300013104 Unclassified 3245
238 Ga0157370_10098220 3300013104 Bacteria 2746
239 Ga0157369_10000005 3300013105 Bacteria 470816
240 Ga0157374_10000260 3300013296 Bacteria 48732
241 Ga0157374_10038713 3300013296 Bacteria 4384
242 Ga0157374_10064924 3300013296 Unclassified 3427
243 Ga0157378_10030936 3300013297 Unclassified 4726
244 Ga0157378_10051021 3300013297 Bacteria 3681
245 Ga0157378_10056067 3300013297 Bacteria 3510
246 Ga0157378_10075195 3300013297 Unclassified 3040
247 Ga0157378_10146876 3300013297 Bacteria 2194
248 Ga0163162_10000140 3300013306 Bacteria 65811
249 Ga0163162_10001370 3300013306 Bacteria 22646
250 Ga0163162_10005880 3300013306 Bacteria 11867
251 Ga0163162_10066861 3300013306 Bacteria 3644
252 Ga0163162_10071305 3300013306 Bacteria 3527
253 Ga0157372_10014107 3300013307 Bacteria 8534
254 Ga0157372_10029735 3300013307 Bacteria 5969
255 Ga0157372_10040779 3300013307 Bacteria 5130
256 Ga0157372_10073593 3300013307 Bacteria 3852
257 Ga0157372_10542284 3300013307 Bacteria 1356
258 Ga0157375_10030579 3300013308 Bacteria 5080
259 Ga0157375_10055033 3300013308 Bacteria 3921
260 Ga0157375_10057225 3300013308 Bacteria 3853
261 Ga0157375_10067374 3300013308 Bacteria 3577
262 Ga0157375_10078100 3300013308 Bacteria 3342
263 Ga0157375_10155097 3300013308 Bacteria 2428
264 Ga0163163_10000279 3300014325 Bacteria 50882
265 Ga0163163_10003321 3300014325 Bacteria 13645
266 Ga0163163_10054767 3300014325 Bacteria 3941
267 Ga0163163_10272018 3300014325 Unclassified 1745
268 Ga0157380_10026062 3300014326 Bacteria 4438
269 Ga0157380_10042545 3300014326 Bacteria 3551
270 Ga0157380_10146128 3300014326 Bacteria 2038
271 Ga0157380_10188813 3300014326 Bacteria 1817
272 Ga0157377_10000298 3300014745 Bacteria 23299
273 Ga0157377_10019134 3300014745 Bacteria 3574
274 Ga0157377_10066562 3300014745 Unclassified 2072
275 Ga0157377_10086377 3300014745 Bacteria 1844
276 Ga0157379_10009420 3300014968 Bacteria 8508
277 Ga0157379_10035747 3300014968 Bacteria 4429
278 Ga0157379_10089923 3300014968 Bacteria 2754
279 Ga0157379_10465759 3300014968 Unclassified 1168
280 Ga0157376_10004802 3300014969 Bacteria 9411
281 Ga0157376_10009325 3300014969 Bacteria 7130
282 Ga0157376_10179537 3300014969 Bacteria 1934
283 Ga0182006_1000105 3300015261 Bacteria 91439
284 Ga0182007_10000023 3300015262 Bacteria 187131
285 Ga0183373_1001 3300015682 Bacteria 1410374
286 Ga0163161_10000932 3300017792 Bacteria 22543
287 Ga0163161_10019746 3300017792 Bacteria 4726
288 Ga0163161_10026319 3300017792 Bacteria 4121
289 Ga0163161_10061356 3300017792 Bacteria 2737
290 Ga0213876_10002676 3300021384 Bacteria 10405
291 Ga0209436_100986 3300025208 Bacteria 10973
292 Ga0209130_1003457 3300025284 Bacteria 6685
293 Ga0207426_1000135 3300025302 Bacteria 202216
294 Ga0207697_10021308 3300025315 Bacteria 2653
295 Ga0207697_10051156 3300025315 Bacteria 1707
296 Ga0207656_10107667 3300025321 Bacteria 1285
297 Ga0207682_10007580 3300025893 Bacteria 4322
298 Ga0207682_10028313 3300025893 Unclassified 2235
299 Ga0207688_10006914 3300025901 Bacteria 6176
300 Ga0207680_10000031 3300025903 Bacteria 77871
301 Ga0207680_10073585 3300025903 Bacteria 2125
302 Ga0207647_10000476 3300025904 Bacteria 32374
303 Ga0207685_10064360 3300025905 Unclassified 1464
304 Ga0207645_10000307 3300025907 Bacteria 41105
305 Ga0207645_10006699 3300025907 Bacteria 8232
306 Ga0207643_10010161 3300025908 Bacteria 5060
307 Ga0207643_10019073 3300025908 Bacteria 3758
308 Ga0207654_10003339 3300025911 Bacteria 8129
309 Ga0207707_10250132 3300025912 Bacteria 1540
310 Ga0207695_10007767 3300025913 Bacteria 13580
311 Ga0207671_10001908 3300025914 Bacteria 23135
312 Ga0207671_10031601 3300025914 Unclassified 3944
313 Ga0207671_10039944 3300025914 Bacteria 3474
314 Ga0207662_10076443 3300025918 Bacteria 2035
315 Ga0207662_10106979 3300025918 Bacteria 1740
316 Ga0207657_10056652 3300025919 Bacteria 3381
317 Ga0207649_10074164 3300025920 Bacteria 2183
318 Ga0207649_10150970 3300025920 Bacteria 1600
319 Ga0207681_10100784 3300025923 Bacteria 2082
320 Ga0207650_10011893 3300025925 Bacteria 5997
321 Ga0207650_10018368 3300025925 Bacteria 4907
322 Ga0207650_10078230 3300025925 Bacteria 2502
323 Ga0207650_10082348 3300025925 Bacteria 2442
324 Ga0207659_10010229 3300025926 Bacteria 5884
325 Ga0207659_10027736 3300025926 Bacteria 3838
326 Ga0207659_10156087 3300025926 Unclassified 1787
327 Ga0207659_10161574 3300025926 Bacteria 1759
328 Ga0207687_10271876 3300025927 Bacteria 1355
329 Ga0207690_10018603 3300025932 Unclassified 4262
330 Ga0207706_10015302 3300025933 Bacteria 6935
331 Ga0207706_10027916 3300025933 Bacteria 5045
332 Ga0207706_10048935 3300025933 Unclassified 3738
333 Ga0207706_10228586 3300025933 Bacteria 1628
334 Ga0207686_10001024 3300025934 Bacteria 16549
335 Ga0207686_10123279 3300025934 Unclassified 1767
336 Ga0207670_10003459 3300025936 Bacteria 8372
337 Ga0207670_10009215 3300025936 Bacteria 5617
338 Ga0207670_10013928 3300025936 Bacteria 4760
339 Ga0207670_10098341 3300025936 Bacteria 2085
340 Ga0207669_10067489 3300025937 Bacteria 2229
341 Ga0207704_10103075 3300025938 Bacteria 1908
342 Ga0207691_10004335 3300025940 Bacteria 13773
343 Ga0207691_10014833 3300025940 Bacteria 7426
344 Ga0207691_10042227 3300025940 Bacteria 4204
345 Ga0207691_10233926 3300025940 Bacteria 1590
346 Ga0207689_10000359 3300025942 Bacteria 42877
347 Ga0207689_10001757 3300025942 Bacteria 20439
348 Ga0207689_10008141 3300025942 Bacteria 9142
349 Ga0207689_10025666 3300025942 Unclassified 4936
350 Ga0207689_10045344 3300025942 Unclassified 3636
351 Ga0207689_10046558 3300025942 Bacteria 3584
352 Ga0207661_10015817 3300025944 Bacteria 5558
353 Ga0207661_10120190 3300025944 Unclassified 2235
354 Ga0207661_10291764 3300025944 Bacteria 1460
355 Ga0207679_10000363 3300025945 Bacteria 32874
356 Ga0207679_10008676 3300025945 Bacteria 6482
357 Ga0207679_10020053 3300025945 Bacteria 4506
358 Ga0207667_10006628 3300025949 Bacteria 13998
359 Ga0207667_10011720 3300025949 Bacteria 10170
360 Ga0207667_10394228 3300025949 Bacteria 1410
361 Ga0207651_10053802 3300025960 Unclassified 2754
362 Ga0207651_10067945 3300025960 Unclassified 2510
363 Ga0207651_10100504 3300025960 Bacteria 2144
364 Ga0207651_10387972 3300025960 Bacteria 1185
365 Ga0207651_10469030 3300025960 Bacteria 1083
366 Ga0207712_10000775 3300025961 Bacteria 23829
367 Ga0207712_10002104 3300025961 Bacteria 13034
368 Ga0207712_10011100 3300025961 Bacteria 5735
369 Ga0207712_10020739 3300025961 Bacteria 4307
370 Ga0207668_10036037 3300025972 Bacteria 3300
371 Ga0207668_10126859 3300025972 Bacteria 1942
372 Ga0207640_10075640 3300025981 Unclassified 2283
373 Ga0207658_10074850 3300025986 Bacteria 2574
374 Ga0207658_10171911 3300025986 Bacteria 1786
375 Ga0207658_10185757 3300025986 Unclassified 1724
376 Ga0207677_10060025 3300026023 Bacteria 2626
377 Ga0207677_10088538 3300026023 Bacteria 2245
378 Ga0207677_10360884 3300026023 Bacteria 1220
379 Ga0207677_10388837 3300026023 Unclassified 1179
380 Ga0207703_10016165 3300026035 Bacteria 5817
381 Ga0207703_10028509 3300026035 Bacteria 4401
382 Ga0207703_10134168 3300026035 Unclassified 2141
383 Ga0207703_10139920 3300026035 Bacteria 2099
384 Ga0207703_10248881 3300026035 Bacteria 1601
385 Ga0207639_10001622 3300026041 Bacteria 15128
386 Ga0207639_10019300 3300026041 Bacteria 4861
387 Ga0207639_10093825 3300026041 Bacteria 2408
388 Ga0207639_10155407 3300026041 Unclassified 1921
389 Ga0207639_10223853 3300026041 Bacteria 1627
390 Ga0207708_10066046 3300026075 Bacteria 2766
391 Ga0207702_10049127 3300026078 Bacteria 3559
392 Ga0207641_10000048 3300026088 Bacteria 178206
393 Ga0207641_10001235 3300026088 Bacteria 25590
394 Ga0207641_10011819 3300026088 Bacteria 7163
395 Ga0207641_10154107 3300026088 Bacteria 2084
396 Ga0207648_10001972 3300026089 Bacteria 22390
397 Ga0207648_10014895 3300026089 Bacteria 7168
398 Ga0207648_10049522 3300026089 Bacteria 3676
399 Ga0207648_10158370 3300026089 Bacteria 1999
400 Ga0207676_10011474 3300026095 Bacteria 6335
401 Ga0207676_10046148 3300026095 Bacteria 3370
402 Ga0207676_10055886 3300026095 Bacteria 3101
403 Ga0207676_10072642 3300026095 Unclassified 2766
404 Ga0207676_10123297 3300026095 Bacteria 2189
405 Ga0207674_10005344 3300026116 Bacteria 15272
406 Ga0207674_10007882 3300026116 Bacteria 12374
407 Ga0207674_10095013 3300026116 Bacteria 2967
408 Ga0207674_10099597 3300026116 Unclassified 2889
409 Ga0207674_10184854 3300026116 Bacteria 2035
410 Ga0207674_10276267 3300026116 Bacteria 1628
411 Ga0207675_100002732 3300026118 Bacteria 17369
412 Ga0207675_100062699 3300026118 Bacteria 3473
413 Ga0207675_100089567 3300026118 Bacteria 2892
414 Ga0207675_100206912 3300026118 Bacteria 1886
415 Ga0207675_100590612 3300026118 Bacteria 1113
416 Ga0207683_10003643 3300026121 Bacteria 13402
417 Ga0207683_10128710 3300026121 Unclassified 2276
418 Ga0207683_10281610 3300026121 Bacteria 1519
419 Ga0207698_10016456 3300026142 Bacteria 4985
420 Ga0207698_10070942 3300026142 Unclassified 2762
421 Ga0207698_10120014 3300026142 Bacteria 2223
422 Ga0207698_10443091 3300026142 Unclassified 1252
423 Ga0207428_10091376 3300027907 Bacteria 2363
424 Ga0268266_10406219 3300028379 Bacteria 1288
425 Ga0268265_10359786 3300028380 Unclassified 1332
426 Ga0268264_10021190 3300028381 Bacteria 5310
427 Ga0268264_10064857 3300028381 Bacteria 3075
428 Ga0268264_10079567 3300028381 Bacteria 2797
429 Ga0307515_10000001 3300028794 Bacteria 4259510
430 Ga0307515_10192865 3300028794 Bacteria 1941
431 Ga0265327_10000191 3300031251 Bacteria 130083
432 Ga0307516_10160352 3300031730 Bacteria 2000
433 Ga0307405_10000182 3300031731 Bacteria 23237
434 Ga0307412_10300417 3300031911 Unclassified 1269
435 Ga0373943_0046625 3300035170 Bacteria 2116
436 Ga0373955_0016211 3300035172 Bacteria 3664
437 Ga0373935_0189023 3300035692 Bacteria 1418
438 Ga0373933_0217272 3300035724 Bacteria 1226
439 Ga0373937_0017571 3300036401 Bacteria 6375
440 Ga0373925_0204671 3300037068 Bacteria 1571
441 Ga0395901_0191387 3300038443 Unclassified 2145
442 Ga0436365_1601764 3300039437 Bacteria 32491
443 Ga0439441_026135 3300042001 Bacteria 1106
444 Ga0466972_0001162 3300044658 Bacteria 12600
445 Ga0466972_0001391 3300044658 Bacteria 11729
446 Ga0453684_0028714 3300044712 Bacteria 7923
447 Ga0466968_0029576 3300044735 Bacteria 2266
448 Ga0495592_0020767 3300046454 Bacteria 4996
449 Ga0495592_0080098 3300046454 Bacteria 2364
450 Ga0495628_0013798 3300046516 Bacteria 6789
451 Ga0495630_0014341 3300046517 Bacteria 5772
452 Ga0495652_0165527 3300046529 Unclassified 1712
453 Ga0495598_0004930 3300046537 Bacteria 2925
454 Ga0495635_0109608 3300046663 Bacteria 1886
455 Ga0495600_0247032 3300046809 Bacteria 1136
456 Ga0495636_0000038 3300047318 Bacteria 56537
457 Ga0495672_0012274 3300047320 Bacteria 5991
458 Ga0495672_0023596 3300047320 Bacteria 3980
459 Ga0495686_0028548 3300047472 Bacteria 3633
460 Ga0495686_0121508 3300047472 Unclassified 1556
461 Ga0496108_0342833 3300048911 Bacteria 1304
462 Ga0496110_0013298 3300048913 Bacteria 6799
463 Ga0496110_0082295 3300048913 Bacteria 2871
464 Ga0496111_0269555 3300048914 Bacteria 1263
465 Ga0501290_005979 3300049513 Unclassified 1519
466 Ga0501034_0054309 3300049571 Bacteria 4033
467 Ga0501034_0101402 3300049571 Bacteria 2872
468 Ga0501037_0004999 3300049573 Bacteria 9642
469 Ga0501037_0009096 3300049573 Bacteria 7277
470 Ga0501037_0113463 3300049573 Bacteria 1951
471 Ga0501038_0050183 3300049574 Bacteria 3606
472 Ga0501039_0009853 3300049575 Bacteria 7286
473 Ga0501039_0155072 3300049575 Bacteria 1799
474 Ga0501043_0034842 3300049579 Bacteria 3959
475 Ga0501043_0079409 3300049579 Unclassified 2578
476 Ga0501043_0228385 3300049579 Bacteria 1438
477 Ga0501046_0204307 3300049580 Bacteria 1469
478 Ga0501047_0006881 3300049581 Bacteria 10685
479 Ga0501047_0022575 3300049581 Bacteria 6042
480 Ga0501047_0184580 3300049581 Bacteria 1951
481 Ga0501048_0113741 3300049582 Bacteria 1912
482 Ga0501070_0033131 3300049586 Bacteria 4322
483 Ga0501074_0030119 3300049590 Bacteria 3933
484 Ga0501228_003007 3300049666 Bacteria 1364
485 Ga0501080_0122830 3300049742 Bacteria 2405
486 Ga0501083_0050317 3300049744 Bacteria 2805
487 Ga0501035_0019865 3300049822 Bacteria 6171
488 Ga0501035_0057755 3300049822 Bacteria 3459
489 Ga0501035_0069127 3300049822 Bacteria 3131
490 Ga0501044_0004185 3300049823 Bacteria 16218
491 Ga0501044_0013445 3300049823 Bacteria 8852
492 Ga0501044_0043252 3300049823 Bacteria 4681
493 Ga0501044_0107421 3300049823 Bacteria 2802
494 Ga0501044_0136201 3300049823 Bacteria 2447
495 Ga0501044_0194069 3300049823 Bacteria 1992
496 nmdc:mga0k408_203030_c1 3300050493 Bacteria 1183
497 nmdc:mga05p37_38096_c1 3300050507 Bacteria 5897
498 nmdc:mga0qj67_7890_c1 3300050509 Bacteria 7865
499 nmdc:mga06r32_20257_c1 3300050510 Bacteria 6120
500 nmdc:mga08y16_16707_c1 3300050511 Bacteria 7723
501 Ga0500578_0000091 3300053086 Bacteria 102427
502 Ga0500611_000059 3300053727 Bacteria 48867
503 2842723278 2842722452 Bacteria 6263924
504 2842909770 2842909656 Bacteria 6185908
505 2852625323 2852623160 Bacteria 4376875
506 2884934336 2884933994 Bacteria 4535041
507 2929180743 2929177148 Bacteria 7883697
508 2945983139 2945977869 Bacteria 7777518
509 2946000068 2945997725 Bacteria 6404843
510 2946017469 2946013367 Bacteria 7766675
511 2954017011 2954016120 Bacteria 6446024
512 Ga0111539_10022735
513 JGI24751J29686_10001499
514 JGI25158J39367_1002839
515 rootH1_10017206
516 rootH1_10149922
517 rootH2_10056725
518 rootL2_10124221
519 rootH1_10001695
520 rootH1_10100522
521 Ga0065714_10007089
522 Ga0065712_10000790
523 Ga0065712_10004359
524 Ga0065712_10084896
525 Ga0065715_10106291
526 Ga0065715_10127044
527 Ga0070658_10314847
528 Ga0070676_10003926
529 Ga0070676_10016929
530 Ga0070676_10022167
531 Ga0070676_10126779
532 Ga0070683_100000439
533 Ga0070683_100001669
534 Ga0070683_100016564
535 Ga0070683_100258839
536 Ga0070690_100328660
537 Ga0070670_100025346
538 Ga0070670_100057679
539 Ga0070670_100090740
540 Ga0070670_100093434
541 Ga0070670_100164028
542 Ga0070670_100329088
543 Ga0070670_100381217
544 Ga0070677_10004524
545 Ga0070677_10007319
546 Ga0068869_100002672
547 Ga0068869_100003135
548 Ga0068869_100027826
549 Ga0068869_100089932
550 Ga0068869_100124093
551 Ga0068869_100151274
552 Ga0068869_100304120
553 Ga0070666_10000470
554 Ga0070666_10029989
555 Ga0070680_100066915
556 Ga0068868_100000658
557 Ga0068868_100032721
558 Ga0068868_100033454
559 Ga0068868_100043943
560 Ga0068868_100182864
561 Ga0068868_100208952
562 Ga0070689_100007156
563 Ga0070689_100013288
564 Ga0070689_100013860
565 Ga0070689_100293115
566 Ga0070687_100045270
567 Ga0070661_100001766
568 Ga0070661_100017243
569 Ga0070668_100081498
570 Ga0070668_100116023
571 Ga0070668_100130127
572 Ga0070669_100037456
573 Ga0070669_100041841
574 Ga0070669_100044822
575 Ga0070669_100262802
576 Ga0070675_100022283
577 Ga0070675_100027768
578 Ga0070675_100087279
579 Ga0070675_100200994
580 Ga0070671_100118273
581 Ga0070671_100224959
582 Ga0070673_100005298
583 Ga0070673_100007282
584 Ga0070673_100026043
585 Ga0070673_100136240
586 Ga0070673_100171953
587 Ga0070673_100334087
588 Ga0070673_100367838
589 Ga0070673_100530234
590 Ga0070688_100091432
591 Ga0070688_100172009
592 Ga0070659_100086031
593 Ga0070667_100029116
594 Ga0070667_100084351
595 Ga0070701_10048467
596 Ga0070663_100134306
597 Ga0070678_100182405
598 Ga0070678_100358970
599 Ga0070662_100001642
600 Ga0070662_100009992
601 Ga0070662_100031224
602 Ga0070662_100120781
603 Ga0070662_100174818
604 Ga0070662_100208548
605 Ga0070681_10041548
606 Ga0070681_10189680
607 Ga0068867_100021678
608 Ga0068867_100033261
609 Ga0068867_100101641
610 Ga0070685_10004551
611 Ga0070685_10017481
612 Ga0070685_10047459
613 Ga0070685_10106998
614 Ga0070679_100020027
615 Ga0070684_100000465
616 Ga0070684_100003698
617 Ga0070684_100011630
618 Ga0070684_100040832
619 Ga0068853_100003783
620 Ga0068853_100019189
621 Ga0068853_100071068
622 Ga0068853_100085238
623 Ga0068853_100182584
624 Ga0070672_100225168
625 Ga0070672_100442609
626 Ga0070686_100020063
627 Ga0070686_100054069
628 Ga0070686_100180408
629 Ga0070665_100038063
630 Ga0070665_100279290
631 Ga0068855_100001787
632 Ga0068855_100160629
633 Ga0068855_100462458
634 Ga0070664_100001035
635 Ga0070664_100004076
636 Ga0070664_100019224
637 Ga0070664_100288818
638 Ga0068857_100028580
639 Ga0068857_100058791
640 Ga0068857_100282790
641 Ga0068857_100383513
642 Ga0068856_100009483
643 Ga0068856_100362355
644 Ga0070702_100127584
645 Ga0068852_100002245
646 Ga0068852_100002978
647 Ga0068852_100007347
648 Ga0068852_100023497
649 Ga0068852_100037746
650 Ga0068859_100000012
651 Ga0068859_100025982
652 Ga0068859_100045630
653 Ga0068859_100071863
654 Ga0068859_100110142
655 Ga0068859_100143520
656 Ga0068859_100148912
657 Ga0068859_100169006
658 Ga0068859_100273967
659 Ga0068859_100350301
660 Ga0068864_100020169
661 Ga0068864_100079208
662 Ga0068864_100237540
663 Ga0068864_100547584
664 Ga0068866_10074920
665 Ga0068866_10091506
666 Ga0068861_100002531
667 Ga0068861_100143488
668 Ga0068861_100146626
669 Ga0068851_10064748
670 Ga0068870_10003764
671 Ga0068863_100119569
672 Ga0068863_100194888
673 Ga0068858_100007142
674 Ga0068858_100074900
675 Ga0068858_100162838
676 Ga0068860_100015093
677 Ga0068860_100038858
678 Ga0068860_100342240
679 Ga0068860_100411030
680 Ga0070715_10012162
681 Ga0070715_10026598
682 Ga0075366_10052694
683 Ga0075366_10132255
684 Ga0097621_100030624
685 Ga0097621_100038780
686 Ga0097621_100068070
687 Ga0097621_100166401
688 Ga0097621_100320951
689 Ga0097621_100352471
690 Ga0097621_100422119
691 Ga0068871_100042089
692 Ga0068871_100052390
693 Ga0068871_100299340
694 Ga0068871_100302655
695 Ga0075428_100197877
696 Ga0075431_100043609
697 Ga0075429_100044521
698 Ga0075429_100496844
699 Ga0068865_100058612
700 Ga0068865_100099629
701 Ga0097620_100000012
702 Ga0097620_100025982
703 Ga0097620_100045632
704 Ga0097620_100071864
705 Ga0097620_100110139
706 Ga0097620_100143528
707 Ga0097620_100148901
708 Ga0097620_100169009
709 Ga0097620_100273965
710 Ga0097620_100350305
711 Ga0105240_10036150
712 Ga0105247_10001409
713 Ga0114129_10050382
714 Ga0105241_10006619
715 Ga0105241_10007353
716 Ga0105241_10023083
717 Ga0105242_10003990
718 Ga0105242_10039739
719 Ga0105242_10190781
720 Ga0105242_10196877
721 Ga0105242_10313034
722 Ga0105237_10005184
723 Ga0105237_10007356
724 Ga0105237_10050413
725 Ga0105249_10000628
726 Ga0105249_10018024
727 Ga0105249_10048912
728 Ga0105249_10121019
729 Ga0105249_10345445
730 Ga0105239_10000432
731 Ga0105239_10000886
732 Ga0105239_10007177
733 Ga0105239_10130997
734 Ga0105239_10196815
735 Ga0105239_10243498
736 Ga0105246_10082579
737 Ga0105246_10208965
738 Ga0105246_10452189
739 Ga0157373_10006792
740 Ga0157373_10017278
741 Ga0157373_10019462
742 Ga0157373_10200565
743 Ga0157371_10001920
744 Ga0157371_10154043
745 Ga0157370_10004433
746 Ga0157370_10072681
747 Ga0157370_10098220
748 Ga0157369_10000005
749 Ga0157374_10000260
750 Ga0157374_10038713
751 Ga0157374_10064924
752 Ga0157378_10030936
753 Ga0157378_10051021
754 Ga0157378_10056067
755 Ga0157378_10075195
756 Ga0157378_10146876
757 Ga0163162_10000140
758 Ga0163162_10001370
759 Ga0163162_10005880
760 Ga0163162_10066861
761 Ga0163162_10071305
762 Ga0157372_10014107
763 Ga0157372_10029735
764 Ga0157372_10040779
765 Ga0157372_10073593
766 Ga0157372_10542284
767 Ga0157375_10030579
768 Ga0157375_10055033
769 Ga0157375_10057225
770 Ga0157375_10067374
771 Ga0157375_10078100
772 Ga0157375_10155097
773 Ga0163163_10000279
774 Ga0163163_10003321
775 Ga0163163_10054767
776 Ga0163163_10272018
777 Ga0157380_10026062
778 Ga0157380_10042545
779 Ga0157380_10146128
780 Ga0157380_10188813
781 Ga0157377_10000298
782 Ga0157377_10019134
783 Ga0157377_10066562
784 Ga0157377_10086377
785 Ga0157379_10009420
786 Ga0157379_10035747
787 Ga0157379_10089923
788 Ga0157379_10465759
789 Ga0157376_10004802
790 Ga0157376_10009325
791 Ga0157376_10179537
792 Ga0182006_1000105
793 Ga0182007_10000023
794 Ga0183373_1001
795 Ga0163161_10000932
796 Ga0163161_10019746
797 Ga0163161_10026319
798 Ga0163161_10061356
799 Ga0213876_10002676
800 Ga0209436_100986
801 Ga0209130_1003457
802 Ga0207426_1000135
803 Ga0207697_10021308
804 Ga0207697_10051156
805 Ga0207656_10107667
806 Ga0207682_10007580
807 Ga0207682_10028313
808 Ga0207688_10006914
809 Ga0207680_10000031
810 Ga0207680_10073585
811 Ga0207647_10000476
812 Ga0207685_10064360
813 Ga0207645_10000307
814 Ga0207645_10006699
815 Ga0207643_10010161
816 Ga0207643_10019073
817 Ga0207654_10003339
818 Ga0207707_10250132
819 Ga0207695_10007767
820 Ga0207671_10001908
821 Ga0207671_10031601
822 Ga0207671_10039944
823 Ga0207662_10076443
824 Ga0207662_10106979
825 Ga0207657_10056652
826 Ga0207649_10074164
827 Ga0207649_10150970
828 Ga0207681_10100784
829 Ga0207650_10011893
830 Ga0207650_10018368
831 Ga0207650_10078230
832 Ga0207650_10082348
833 Ga0207659_10010229
834 Ga0207659_10027736
835 Ga0207659_10156087
836 Ga0207659_10161574
837 Ga0207687_10271876
838 Ga0207690_10018603
839 Ga0207706_10015302
840 Ga0207706_10027916
841 Ga0207706_10048935
842 Ga0207706_10228586
843 Ga0207686_10001024
844 Ga0207686_10123279
845 Ga0207670_10003459
846 Ga0207670_10009215
847 Ga0207670_10013928
848 Ga0207670_10098341
849 Ga0207669_10067489
850 Ga0207704_10103075
851 Ga0207691_10004335
852 Ga0207691_10014833
853 Ga0207691_10042227
854 Ga0207691_10233926
855 Ga0207689_10000359
856 Ga0207689_10001757
857 Ga0207689_10008141
858 Ga0207689_10025666
859 Ga0207689_10045344
860 Ga0207689_10046558
861 Ga0207661_10015817
862 Ga0207661_10120190
863 Ga0207661_10291764
864 Ga0207679_10000363
865 Ga0207679_10008676
866 Ga0207679_10020053
867 Ga0207667_10006628
868 Ga0207667_10011720
869 Ga0207667_10394228
870 Ga0207651_10053802
871 Ga0207651_10067945
872 Ga0207651_10100504
873 Ga0207651_10387972
874 Ga0207651_10469030
875 Ga0207712_10000775
876 Ga0207712_10002104
877 Ga0207712_10011100
878 Ga0207712_10020739
879 Ga0207668_10036037
880 Ga0207668_10126859
881 Ga0207640_10075640
882 Ga0207658_10074850
883 Ga0207658_10171911
884 Ga0207658_10185757
885 Ga0207677_10060025
886 Ga0207677_10088538
887 Ga0207677_10360884
888 Ga0207677_10388837
889 Ga0207703_10016165
890 Ga0207703_10028509
891 Ga0207703_10134168
892 Ga0207703_10139920
893 Ga0207703_10248881
894 Ga0207639_10001622
895 Ga0207639_10019300
896 Ga0207639_10093825
897 Ga0207639_10155407
898 Ga0207639_10223853
899 Ga0207708_10066046
900 Ga0207702_10049127
901 Ga0207641_10000048
902 Ga0207641_10001235
903 Ga0207641_10011819
904 Ga0207641_10154107
905 Ga0207648_10001972
906 Ga0207648_10014895
907 Ga0207648_10049522
908 Ga0207648_10158370
909 Ga0207676_10011474
910 Ga0207676_10046148
911 Ga0207676_10055886
912 Ga0207676_10072642
913 Ga0207676_10123297
914 Ga0207674_10005344
915 Ga0207674_10007882
916 Ga0207674_10095013
917 Ga0207674_10099597
918 Ga0207674_10184854
919 Ga0207674_10276267
920 Ga0207675_100002732
921 Ga0207675_100062699
922 Ga0207675_100089567
923 Ga0207675_100206912
924 Ga0207675_100590612
925 Ga0207683_10003643
926 Ga0207683_10128710
927 Ga0207683_10281610
928 Ga0207698_10016456
929 Ga0207698_10070942
930 Ga0207698_10120014
931 Ga0207698_10443091
932 Ga0207428_10091376
933 Ga0268266_10406219
934 Ga0268265_10359786
935 Ga0268264_10021190
936 Ga0268264_10064857
937 Ga0268264_10079567
938 Ga0307515_10000001
939 Ga0307515_10192865
940 Ga0265327_10000191
941 Ga0307516_10160352
942 Ga0307405_10000182
943 Ga0307412_10300417
944 Ga0373943_0046625
945 Ga0373955_0016211
946 Ga0373935_0189023
947 Ga0373933_0217272
948 Ga0373937_0017571
949 Ga0373925_0204671
950 Ga0395901_0191387
951 Ga0436365_1601764
952 Ga0439441_026135
953 Ga0466972_0001162
954 Ga0466972_0001391
955 Ga0453684_0028714
956 Ga0466968_0029576
957 Ga0495592_0020767
958 Ga0495592_0080098
959 Ga0495628_0013798
960 Ga0495630_0014341
961 Ga0495652_0165527
962 Ga0495598_0004930
963 Ga0495635_0109608
964 Ga0495600_0247032
965 Ga0495636_0000038
966 Ga0495672_0012274
967 Ga0495672_0023596
968 Ga0495686_0028548
969 Ga0495686_0121508
970 Ga0496108_0342833
971 Ga0496110_0013298
972 Ga0496110_0082295
973 Ga0496111_0269555
974 Ga0501290_005979
975 Ga0501034_0054309
976 Ga0501034_0101402
977 Ga0501037_0004999
978 Ga0501037_0009096
979 Ga0501037_0113463
980 Ga0501038_0050183
981 Ga0501039_0009853
982 Ga0501039_0155072
983 Ga0501043_0034842
984 Ga0501043_0079409
985 Ga0501043_0228385
986 Ga0501046_0204307
987 Ga0501047_0006881
988 Ga0501047_0022575
989 Ga0501047_0184580
990 Ga0501048_0113741
991 Ga0501070_0033131
992 Ga0501074_0030119
993 Ga0501228_003007
994 Ga0501080_0122830
995 Ga0501083_0050317
996 Ga0501035_0019865
997 Ga0501035_0057755
998 Ga0501035_0069127
999 Ga0501044_0004185
1000 Ga0501044_0013445
1001 Ga0501044_0043252
1002 Ga0501044_0107421
1003 Ga0501044_0136201
1004 Ga0501044_0194069
1005 nmdc:mga0k408_203030_c1
1006 nmdc:mga05p37_38096_c1
1007 nmdc:mga0qj67_7890_c1
1008 nmdc:mga06r32_20257_c1
1009 nmdc:mga08y16_16707_c1
1010 Ga0500578_0000091
1011 Ga0500611_000059
1012 2842723278
1013 2842909770
1014 2852625323
1015 2884934336
1016 2929180743
1017 2945983139
1018 2946000068
1019 2946017469
1020 2954017011

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qn9-assembly1.cif.gz_B cryo-em structure of human full-length extrasynaptic alpha4beta3delta gaba(a)r in complex with gaba, histamine and nanobody nb25 in a pre-open/closed state 0.8232 37 310
7a5v-assembly1.cif.gz_A cryoem structure of a human gamma-aminobutyric acid receptor, the gaba(a)r-beta3 homopentamer, in complex with histamine and megabody mb25 in lipid nanodisc 0.8156 37 310
8dn4-assembly1.cif.gz_E cryo-em structure of human glycine receptor alpha-1 beta heteromer, glycine-bound state3(desensitized state) 0.8135 37 310
7qnb-assembly1.cif.gz_B cryo-em structure of human full-length beta3gamma2 gaba(a)r in complex with gaba and nanobody nb25 0.8128 37 310
5o8f-assembly1.cif.gz_A structure of a chimaeric beta3-alpha5 gabaa receptor in complex with nanobody nb25 and pregnanolone 0.8124 37 310
ID Description Score Start End Superfamily
4f8hA02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.939 195 309 1.20.58.390
3eamB02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.9384 197 309 1.20.58.390
2xq3B02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.9375 199 309 1.20.58.390
2xq4C02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.9371 199 309 1.20.58.390
2xq8A02 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.9367 199 309 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A3D5KMZ1-F1-model_v4 Uncharacterized protein 0.8923 149 309 GO:0016020
AF-A0A3D5KMZ1-F1-model_v4 Uncharacterized protein 0.882 149 309 GO:0016020
AF-A0A820RMJ1-F1-model_v4 Uncharacterized protein 0.8752 185 309 GO:0006811
GO:0016020
AF-A0A3R7MDU2-F1-model_v4 Neurotransmitter-gated ion-channel transmembrane domain-containing protein 0.8635 185 283 GO:0004888
GO:0005230
GO:0005254
GO:0016020
GO:0099095
AF-A0A2A3E1L7-F1-model_v4 Gamma-aminobutyric acid receptor alpha 0.8623 142 277 GO:0004890
GO:0005230
GO:0005254
GO:0045211
GO:0099095

Map