F456960

General Info

Members Datasets Scaffolds Average Seq Length
509 259 1018 200

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100151520|Ga0075429_1001515201
Length 236
Sequence LAYTPIVAVCDLDRSGFFFAVSGSCGEWLFQPERPPSQKGLDMTKSTLDVEAILKRAAPVTRQHGHEIQPFGHLVRMPIALSENACKESVDNLNQLLADTIALRDLYKKHHWQIAGPTFYQLHLLFDKHYDEQSELVDAIAERIQLLGGVSIAMAHDVAETTLIPRPPKGREEAPVQISRLLHAHEIVLKEARAMARRASETGDDGTNDLIVSDVIRRNELQVWFVAEHVVDVPVV

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
105 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
106 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
108 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
109 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
111 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
161 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
162 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
169 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
170 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
176 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
177 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
191 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
192 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
236 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
240 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
249 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
250 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 1.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.95
Rhizosphere 96.66
Stem 0
Stem Tuber 0
Unclassified 12.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100151520 3300006880 Bacteria 2030
2 JGI24749J21850_1014134 3300002076 Bacteria 1120
3 JGI24749J21850_1034686 3300002076 Unclassified 730
4 JGI25406J46586_10013756 3300003203 Bacteria 3461
5 Ga0065714_10067030 3300005288 Bacteria 5973
6 Ga0065704_10223261 3300005289 Bacteria 1067
7 Ga0065704_10288588 3300005289 Bacteria 908
8 Ga0065712_10068399 3300005290 Bacteria 10914
9 Ga0065715_10000217 3300005293 Bacteria 35543
10 Ga0065715_10224426 3300005293 Unclassified 1258
11 Ga0065715_10563425 3300005293 Bacteria 732
12 Ga0065707_10350939 3300005295 Unclassified 918
13 Ga0070676_10006316 3300005328 Bacteria 6332
14 Ga0070676_10030291 3300005328 Bacteria 3085
15 Ga0070690_100017024 3300005330 Bacteria 4363
16 Ga0070690_100101083 3300005330 Bacteria 1912
17 Ga0070670_100011887 3300005331 Bacteria 7444
18 Ga0070677_10021656 3300005333 Unclassified 2361
19 Ga0070677_10129629 3300005333 Unclassified 1150
20 Ga0068869_100058804 3300005334 Bacteria 2812
21 Ga0068869_100087383 3300005334 Bacteria 2339
22 Ga0070666_10055144 3300005335 Bacteria 2682
23 Ga0070682_100123081 3300005337 Bacteria 1744
24 Ga0068868_100018780 3300005338 Bacteria 5171
25 Ga0070689_100020491 3300005340 Bacteria 4907
26 Ga0070691_10110621 3300005341 Bacteria 1374
27 Ga0070687_100090482 3300005343 Unclassified 1691
28 Ga0070661_100172045 3300005344 Unclassified 1645
29 Ga0070668_100038267 3300005347 Bacteria 3666
30 Ga0070668_100200057 3300005347 Bacteria 1640
31 Ga0070669_100125134 3300005353 Bacteria 1966
32 Ga0070669_100173129 3300005353 Bacteria 1684
33 Ga0070675_100037521 3300005354 Bacteria 3948
34 Ga0070674_100042884 3300005356 Bacteria 3075
35 Ga0070673_100015974 3300005364 Bacteria 5291
36 Ga0070673_100430249 3300005364 Bacteria 1184
37 Ga0070673_100772247 3300005364 Bacteria 886
38 Ga0070688_100031438 3300005365 Bacteria 3193
39 Ga0070688_100065272 3300005365 Bacteria 2313
40 Ga0070659_100022907 3300005366 Bacteria 4774
41 Ga0070659_100866634 3300005366 Bacteria 788
42 Ga0070667_100067678 3300005367 Bacteria 3037
43 Ga0070667_100408437 3300005367 Bacteria 1237
44 Ga0070703_10053199 3300005406 Bacteria 1301
45 Ga0070709_10020764 3300005434 Bacteria 3818
46 Ga0070701_10166141 3300005438 Unclassified 1282
47 Ga0070701_10242840 3300005438 Bacteria 1084
48 Ga0070705_100011395 3300005440 Bacteria 4486
49 Ga0070705_100014615 3300005440 Bacteria 4043
50 Ga0070694_100023294 3300005444 Bacteria 3980
51 Ga0070708_100017141 3300005445 Bacteria 6033
52 Ga0070708_100027203 3300005445 Bacteria 4905
53 Ga0070708_100176976 3300005445 Bacteria 1994
54 Ga0070708_100282098 3300005445 Bacteria 1563
55 Ga0070708_100314501 3300005445 Bacteria 1475
56 Ga0070708_100799411 3300005445 Unclassified 887
57 Ga0070663_100370431 3300005455 Bacteria 1164
58 Ga0070678_100161653 3300005456 Bacteria 1815
59 Ga0070678_100202608 3300005456 Bacteria 1639
60 Ga0070662_100012508 3300005457 Bacteria 5628
61 Ga0070662_100528737 3300005457 Bacteria 986
62 Ga0070662_100944050 3300005457 Bacteria 737
63 Ga0070681_10299558 3300005458 Bacteria 1518
64 Ga0068867_100119365 3300005459 Unclassified 2036
65 Ga0070685_10051369 3300005466 Unclassified 2384
66 Ga0070685_10113801 3300005466 Bacteria 1671
67 Ga0070706_100018009 3300005467 Bacteria 6515
68 Ga0070706_100058332 3300005467 Bacteria 3563
69 Ga0070706_100278613 3300005467 Bacteria 1561
70 Ga0070707_100056695 3300005468 Bacteria 3758
71 Ga0070707_100079189 3300005468 Bacteria 3171
72 Ga0070707_100764714 3300005468 Bacteria 929
73 Ga0070707_100795090 3300005468 Unclassified 910
74 Ga0070698_100036849 3300005471 Bacteria 5048
75 Ga0070698_100191364 3300005471 Bacteria 1983
76 Ga0070698_100320237 3300005471 Bacteria 1481
77 Ga0070698_100398353 3300005471 Bacteria 1310
78 Ga0070698_100466810 3300005471 Bacteria 1198
79 Ga0070699_100018519 3300005518 Bacteria 5982
80 Ga0070699_100275207 3300005518 Bacteria 1507
81 Ga0070699_100310483 3300005518 Bacteria 1416
82 Ga0070699_100325077 3300005518 Bacteria 1383
83 Ga0070697_100000671 3300005536 Bacteria 25737
84 Ga0070697_100227597 3300005536 Bacteria 1590
85 Ga0070697_100307249 3300005536 Unclassified 1364
86 Ga0070697_100309684 3300005536 Unclassified 1358
87 Ga0070672_100014624 3300005543 Bacteria 5566
88 Ga0070672_100301625 3300005543 Bacteria 1358
89 Ga0070686_100025014 3300005544 Bacteria 3586
90 Ga0070695_100028889 3300005545 Bacteria 3443
91 Ga0070695_100441696 3300005545 Unclassified 995
92 Ga0070696_100001746 3300005546 Bacteria 14258
93 Ga0070696_100321855 3300005546 Bacteria 1190
94 Ga0070693_100000070 3300005547 Bacteria 42181
95 Ga0070693_100232803 3300005547 Bacteria 1213
96 Ga0070693_100711867 3300005547 Unclassified 736
97 Ga0070665_100009511 3300005548 Bacteria 9829
98 Ga0070665_100080226 3300005548 Bacteria 3268
99 Ga0070665_100087755 3300005548 Bacteria 3116
100 Ga0070665_100113521 3300005548 Bacteria 2712
101 Ga0070665_100166724 3300005548 Bacteria 2205
102 Ga0070704_100008231 3300005549 Bacteria 6239
103 Ga0070704_100032382 3300005549 Bacteria 3525
104 Ga0070704_100092900 3300005549 Bacteria 2253
105 Ga0068855_100198264 3300005563 Bacteria 2261
106 Ga0070664_100009860 3300005564 Bacteria 7740
107 Ga0068854_100126729 3300005578 Bacteria 1945
108 Ga0068852_100098719 3300005616 Bacteria 2630
109 Ga0068859_100121921 3300005617 Bacteria 2674
110 Ga0068859_100122762 3300005617 Bacteria 2664
111 Ga0068864_100027105 3300005618 Bacteria 4835
112 Ga0068864_100051750 3300005618 Bacteria 3539
113 Ga0068861_100034069 3300005719 Bacteria 3763
114 Ga0068861_100259317 3300005719 Unclassified 1487
115 Ga0068870_10059175 3300005840 Bacteria 2053
116 Ga0068863_100022294 3300005841 Bacteria 6047
117 Ga0068863_100023610 3300005841 Bacteria 5871
118 Ga0068863_100593767 3300005841 Bacteria 1095
119 Ga0068858_100050031 3300005842 Bacteria 3868
120 Ga0068858_100255486 3300005842 Bacteria 1665
121 Ga0068860_100040441 3300005843 Bacteria 4455
122 Ga0068860_100081136 3300005843 Bacteria 3085
123 Ga0068860_100445618 3300005843 Bacteria 1287
124 Ga0068862_100034326 3300005844 Bacteria 4291
125 Ga0068862_100613097 3300005844 Bacteria 1046
126 Ga0081539_10000010 3300005985 Bacteria 484386
127 Ga0075432_10235470 3300006058 Unclassified 737
128 Ga0070716_100044001 3300006173 Unclassified 2500
129 Ga0070716_100515736 3300006173 Unclassified 885
130 Ga0097621_100046359 3300006237 Bacteria 3517
131 Ga0097621_100064190 3300006237 Bacteria 3019
132 Ga0097621_100175470 3300006237 Bacteria 1850
133 Ga0097621_100183018 3300006237 Bacteria 1811
134 Ga0097621_100226909 3300006237 Bacteria 1630
135 Ga0097621_100438815 3300006237 Bacteria 1174
136 Ga0068871_100005904 3300006358 Bacteria 8612
137 Ga0068871_100036279 3300006358 Bacteria 3924
138 Ga0068871_100111125 3300006358 Bacteria 2305
139 Ga0068871_100669554 3300006358 Unclassified 949
140 Ga0075428_100079272 3300006844 Bacteria 3585
141 Ga0075428_100102324 3300006844 Bacteria 3124
142 Ga0075428_101171312 3300006844 Bacteria 811
143 Ga0075430_100085770 3300006846 Bacteria 2636
144 Ga0075431_100012034 3300006847 Bacteria 8731
145 Ga0075431_100199173 3300006847 Bacteria 2049
146 Ga0075431_100495356 3300006847 Unclassified 1214
147 Ga0075433_10003209 3300006852 Bacteria 12611
148 Ga0075433_10005635 3300006852 Bacteria 9844
149 Ga0075433_10010403 3300006852 Bacteria 7465
150 Ga0075433_10053135 3300006852 Bacteria 3531
151 Ga0075434_100005888 3300006871 Bacteria 11205
152 Ga0075434_100008297 3300006871 Bacteria 9650
153 Ga0075434_100011260 3300006871 Bacteria 8425
154 Ga0075434_100068540 3300006871 Bacteria 3534
155 Ga0075434_100158113 3300006871 Bacteria 2286
156 Ga0075434_100159391 3300006871 Bacteria 2276
157 Ga0075429_100130028 3300006880 Bacteria 2202
158 Ga0075429_100169059 3300006880 Unclassified 1915
159 Ga0075429_100172369 3300006880 Bacteria 1895
160 Ga0075429_100412710 3300006880 Bacteria 1182
161 Ga0075429_100458888 3300006880 Bacteria 1116
162 Ga0068865_100003401 3300006881 Bacteria 9522
163 Ga0068865_100013766 3300006881 Bacteria 5124
164 Ga0068865_100473479 3300006881 Bacteria 1039
165 Ga0068865_100730515 3300006881 Unclassified 849
166 Ga0075436_100001858 3300006914 Bacteria 14484
167 Ga0075436_100008889 3300006914 Bacteria 6873
168 Ga0075436_100020714 3300006914 Bacteria 4512
169 Ga0075436_100150723 3300006914 Bacteria 1636
170 Ga0075436_100187398 3300006914 Bacteria 1463
171 Ga0075436_100249948 3300006914 Bacteria 1262
172 Ga0075436_100425476 3300006914 Unclassified 965
173 Ga0097620_100121922 3300006931 Bacteria 2674
174 Ga0097620_100122761 3300006931 Bacteria 2664
175 Ga0075435_100006637 3300007076 Bacteria 8200
176 Ga0075435_100011923 3300007076 Bacteria 6420
177 Ga0075435_100030367 3300007076 Bacteria 4248
178 Ga0075435_100032642 3300007076 Bacteria 4113
179 Ga0075435_100043026 3300007076 Bacteria 3615
180 Ga0075435_100102481 3300007076 Bacteria 2372
181 Ga0075435_100354719 3300007076 Bacteria 1257
182 Ga0099794_10014958 3300007265 Bacteria 3413
183 Ga0099794_10018141 3300007265 Bacteria 3150
184 Ga0099794_10079020 3300007265 Bacteria 1620
185 Ga0105250_10168189 3300009092 Bacteria 917
186 Ga0105240_10237831 3300009093 Unclassified 2113
187 Ga0111539_10026686 3300009094 Bacteria 7059
188 Ga0111539_10048302 3300009094 Bacteria 5082
189 Ga0111539_10151220 3300009094 Bacteria 2717
190 Ga0111539_10153604 3300009094 Bacteria 2694
191 Ga0105245_10033791 3300009098 Bacteria 4533
192 Ga0105245_10091033 3300009098 Bacteria 2807
193 Ga0105245_10314958 3300009098 Bacteria 1540
194 Ga0105247_10505343 3300009101 Bacteria 881
195 Ga0114129_10028393 3300009147 Bacteria 7928
196 Ga0114129_10030204 3300009147 Bacteria 7675
197 Ga0114129_10062473 3300009147 Bacteria 5202
198 Ga0114129_10129575 3300009147 Bacteria 3467
199 Ga0114129_10159577 3300009147 Bacteria 3082
200 Ga0114129_10445707 3300009147 Unclassified 1699
201 Ga0114129_10834208 3300009147 Unclassified 1173
202 Ga0114129_10872039 3300009147 Bacteria 1143
203 Ga0114129_10961677 3300009147 Bacteria 1078
204 Ga0105243_10050204 3300009148 Bacteria 3295
205 Ga0105243_10196054 3300009148 Bacteria 1768
206 Ga0105241_10309912 3300009174 Bacteria 1357
207 Ga0105242_10032681 3300009176 Bacteria 4162
208 Ga0105242_10110368 3300009176 Bacteria 2343
209 Ga0105242_10249879 3300009176 Bacteria 1598
210 Ga0105248_10002426 3300009177 Bacteria 20687
211 Ga0105248_10104474 3300009177 Bacteria 3194
212 Ga0105248_10177476 3300009177 Bacteria 2401
213 Ga0105248_10409564 3300009177 Bacteria 1527
214 Ga0105248_10843108 3300009177 Bacteria 1034
215 Ga0105248_11370868 3300009177 Unclassified 800
216 Ga0105237_10007820 3300009545 Bacteria 11654
217 Ga0105238_10298845 3300009551 Bacteria 1593
218 Ga0105249_10005227 3300009553 Bacteria 11203
219 Ga0105249_10075534 3300009553 Bacteria 3121
220 Ga0105249_10284527 3300009553 Unclassified 1652
221 Ga0105249_10835401 3300009553 Bacteria 986
222 Ga0105249_11153789 3300009553 Bacteria 845
223 Ga0099796_10230788 3300010159 Unclassified 762
224 Ga0105239_10336328 3300010375 Bacteria 1704
225 Ga0157374_10183472 3300013296 Bacteria 2045
226 Ga0157378_10877231 3300013297 Bacteria 927
227 Ga0157378_11475601 3300013297 Bacteria 724
228 Ga0163162_10010669 3300013306 Bacteria 8934
229 Ga0163162_10118177 3300013306 Bacteria 2753
230 Ga0163162_10123668 3300013306 Bacteria 2693
231 Ga0163162_10430987 3300013306 Bacteria 1451
232 Ga0163162_10469701 3300013306 Unclassified 1389
233 Ga0157372_10548419 3300013307 Unclassified 1348
234 Ga0157375_10040280 3300013308 Bacteria 4503
235 Ga0157375_10183780 3300013308 Bacteria 2243
236 Ga0157375_10790137 3300013308 Bacteria 1098
237 Ga0163163_10099300 3300014325 Bacteria 2932
238 Ga0157380_10075881 3300014326 Bacteria 2734
239 Ga0157380_10188425 3300014326 Bacteria 1819
240 Ga0157380_10784448 3300014326 Bacteria 968
241 Ga0157377_10015522 3300014745 Bacteria 3899
242 Ga0157379_10370026 3300014968 Bacteria 1314
243 Ga0157379_10906062 3300014968 Bacteria 837
244 Ga0157376_10004354 3300014969 Bacteria 9846
245 Ga0157376_10031349 3300014969 Bacteria 4255
246 Ga0157376_10560707 3300014969 Bacteria 1132
247 Ga0157376_10631873 3300014969 Bacteria 1069
248 Ga0157376_10671372 3300014969 Bacteria 1039
249 Ga0163161_10158102 3300017792 Bacteria 1727
250 Ga0206356_11270007 3300020070 Bacteria 812
251 Ga0213872_10001072 3300021361 Bacteria 18898
252 Ga0213876_10025743 3300021384 Bacteria 3102
253 Ga0224712_10239706 3300022467 Bacteria 835
254 Ga0224572_1010248 3300024225 Bacteria 1759
255 Ga0228598_1009860 3300024227 Bacteria 1908
256 Ga0207697_10112345 3300025315 Bacteria 1167
257 Ga0207653_10003016 3300025885 Bacteria 5346
258 Ga0207682_10002915 3300025893 Bacteria 7544
259 Ga0207710_10095441 3300025900 Bacteria 1397
260 Ga0207688_10006975 3300025901 Bacteria 6148
261 Ga0207680_10178848 3300025903 Unclassified 1433
262 Ga0207699_10396661 3300025906 Bacteria 982
263 Ga0207645_10012718 3300025907 Bacteria 5706
264 Ga0207643_10022056 3300025908 Bacteria 3504
265 Ga0207684_10018022 3300025910 Bacteria 6052
266 Ga0207684_10078920 3300025910 Bacteria 2800
267 Ga0207707_10157218 3300025912 Bacteria 1988
268 Ga0207695_10133539 3300025913 Unclassified 2437
269 Ga0207695_10315556 3300025913 Unclassified 1453
270 Ga0207671_10225841 3300025914 Bacteria 1468
271 Ga0207660_10412624 3300025917 Bacteria 1088
272 Ga0207662_10001974 3300025918 Bacteria 10120
273 Ga0207649_10501458 3300025920 Unclassified 923
274 Ga0207646_10000005 3300025922 Bacteria 523896
275 Ga0207646_10240496 3300025922 Bacteria 1635
276 Ga0207646_10775055 3300025922 Unclassified 855
277 Ga0207681_10227709 3300025923 Unclassified 1445
278 Ga0207681_10423728 3300025923 Bacteria 1079
279 Ga0207694_10383639 3300025924 Bacteria 1167
280 Ga0207650_10003815 3300025925 Bacteria 10308
281 Ga0207659_10040309 3300025926 Bacteria 3265
282 Ga0207687_10012986 3300025927 Bacteria 5442
283 Ga0207687_10333530 3300025927 Bacteria 1231
284 Ga0207644_10122799 3300025931 Bacteria 1979
285 Ga0207644_10252967 3300025931 Bacteria 1406
286 Ga0207706_10017068 3300025933 Bacteria 6547
287 Ga0207706_10043603 3300025933 Bacteria 3975
288 Ga0207686_10018772 3300025934 Bacteria 3920
289 Ga0207686_10096501 3300025934 Bacteria 1964
290 Ga0207686_10401136 3300025934 Bacteria 1044
291 Ga0207709_10220021 3300025935 Bacteria 1369
292 Ga0207670_10059918 3300025936 Bacteria 2591
293 Ga0207669_10081323 3300025937 Bacteria 2075
294 Ga0207704_10033489 3300025938 Bacteria 2922
295 Ga0207704_10059859 3300025938 Bacteria 2353
296 Ga0207704_10100542 3300025938 Bacteria 1926
297 Ga0207704_10610291 3300025938 Unclassified 894
298 Ga0207665_10008672 3300025939 Bacteria 6692
299 Ga0207691_10010467 3300025940 Bacteria 8895
300 Ga0207691_10031364 3300025940 Bacteria 4961
301 Ga0207691_10304109 3300025940 Bacteria 1369
302 Ga0207711_10155122 3300025941 Bacteria 2069
303 Ga0207711_10339351 3300025941 Bacteria 1390
304 Ga0207711_10596631 3300025941 Bacteria 1030
305 Ga0207689_10002575 3300025942 Bacteria 16800
306 Ga0207679_10024682 3300025945 Bacteria 4124
307 Ga0207667_10155766 3300025949 Bacteria 2351
308 Ga0207651_10009309 3300025960 Bacteria 5367
309 Ga0207651_10313338 3300025960 Bacteria 1309
310 Ga0207712_10098589 3300025961 Bacteria 2168
311 Ga0207712_10107147 3300025961 Bacteria 2089
312 Ga0207712_10619234 3300025961 Unclassified 938
313 Ga0207668_10424913 3300025972 Bacteria 1129
314 Ga0207668_10642146 3300025972 Bacteria 928
315 Ga0207668_11078641 3300025972 Unclassified 719
316 Ga0207658_10947324 3300025986 Bacteria 785
317 Ga0207677_10059926 3300026023 Bacteria 2628
318 Ga0207677_10067722 3300026023 Bacteria 2502
319 Ga0207703_10220411 3300026035 Bacteria 1696
320 Ga0207678_10114023 3300026067 Bacteria 2306
321 Ga0207641_10009460 3300026088 Bacteria 8031
322 Ga0207641_10015591 3300026088 Bacteria 6228
323 Ga0207641_10308889 3300026088 Bacteria 1496
324 Ga0207648_10016241 3300026089 Bacteria 6812
325 Ga0207676_10008185 3300026095 Bacteria 7439
326 Ga0207675_100031483 3300026118 Bacteria 4941
327 Ga0207675_100326474 3300026118 Unclassified 1499
328 Ga0207683_10078682 3300026121 Bacteria 2922
329 Ga0207683_10158924 3300026121 Bacteria 2042
330 Ga0207683_10244973 3300026121 Bacteria 1635
331 Ga0209588_1006633 3300027671 Bacteria 3374
332 Ga0209588_1040120 3300027671 Bacteria 1510
333 Ga0207428_10013895 3300027907 Bacteria 7012
334 Ga0207428_10061336 3300027907 Bacteria 2978
335 Ga0207428_10216112 3300027907 Unclassified 1439
336 Ga0207428_10277567 3300027907 Bacteria 1244
337 Ga0207428_10624804 3300027907 Bacteria 775
338 Ga0265354_1000140 3300028016 Bacteria 13048
339 Ga0265354_1000496 3300028016 Bacteria 6795
340 Ga0265357_1012037 3300028023 Unclassified 887
341 Ga0268266_10017882 3300028379 Bacteria 6041
342 Ga0268266_10070943 3300028379 Bacteria 3019
343 Ga0268266_10143270 3300028379 Bacteria 2146
344 Ga0268266_10177178 3300028379 Unclassified 1939
345 Ga0268265_10034851 3300028380 Bacteria 3672
346 Ga0268265_10161262 3300028380 Bacteria 1905
347 Ga0268265_10413711 3300028380 Bacteria 1250
348 Ga0268264_10089418 3300028381 Bacteria 2652
349 Ga0268264_10217155 3300028381 Unclassified 1758
350 Ga0265770_1000351 3300030878 Bacteria 6312
351 Ga0265760_10001580 3300031090 Bacteria 6713
352 Ga0265760_10006711 3300031090 Bacteria 3294
353 Ga0265340_10198052 3300031247 Bacteria 904
354 Ga0265316_10000902 3300031344 Bacteria 32488
355 Ga0307410_10950104 3300031852 Bacteria 739
356 Ga0307416_100838162 3300032002 Bacteria 1017
357 Ga0307414_10927298 3300032004 Bacteria 799
358 Ga0373950_0005575 3300034818 Bacteria 1886
359 Ga0373959_0002979 3300034820 Bacteria 2689
360 Ga0373938_0002531 3300034957 Bacteria 2953
361 Ga0373929_0005770 3300035085 Bacteria 2235
362 Ga0373940_0142924 3300035088 Bacteria 757
363 Ga0373949_0008488 3300035090 Bacteria 2248
364 Ga0373949_0017957 3300035090 Unclassified 1599
365 Ga0373951_0003102 3300035091 Bacteria 4100
366 Ga0373952_0051754 3300035092 Bacteria 981
367 Ga0373932_0015060 3300035112 Bacteria 1955
368 Ga0373939_0003089 3300035114 Bacteria 3908
369 Ga0373939_0079737 3300035114 Bacteria 1085
370 Ga0373954_0009191 3300035118 Bacteria 4348
371 Ga0373960_0001999 3300035121 Bacteria 4578
372 Ga0373955_0058105 3300035172 Bacteria 2127
373 Ga0373942_0017342 3300035207 Bacteria 1774
374 Ga0373961_0004367 3300035241 Bacteria 3422
375 Ga0373962_0024027 3300035242 Bacteria 1626
376 Ga0373962_0033932 3300035242 Bacteria 1411
377 Ga0373931_0012497 3300035691 Bacteria 4113
378 Ga0373935_0474048 3300035692 Bacteria 906
379 Ga0373927_0054205 3300035695 Unclassified 2594
380 Ga0373927_0251937 3300035695 Bacteria 1161
381 Ga0373947_0509251 3300035725 Bacteria 818
382 Ga0373937_0045218 3300036401 Bacteria 4023
383 Ga0373937_0402316 3300036401 Bacteria 1299
384 Ga0436365_1505847 3300039437 Bacteria 6621
385 Ga0451800_1099319 3300041459 Bacteria 827
386 Ga0451576_0039792 3300045051 Bacteria 4976
387 Ga0495592_0007872 3300046454 Bacteria 7988
388 Ga0495629_0000018 3300046459 Bacteria 169239
389 Ga0495651_0002472 3300046462 Bacteria 14281
390 Ga0495653_0011358 3300046463 Bacteria 7276
391 Ga0495580_0035396 3300046472 Bacteria 3591
392 Ga0495580_0082018 3300046472 Bacteria 2248
393 Ga0495580_0099393 3300046472 Bacteria 2024
394 Ga0495582_0001254 3300046473 Bacteria 14252
395 Ga0495639_0007935 3300046475 Bacteria 4562
396 Ga0495662_0031784 3300046476 Bacteria 2550
397 Ga0495664_0051732 3300046477 Unclassified 2439
398 Ga0495594_0000960 3300046499 Bacteria 14991
399 Ga0495608_0014065 3300046511 Bacteria 5554
400 Ga0495618_0010301 3300046514 Bacteria 5656
401 Ga0495628_0001354 3300046516 Bacteria 22458
402 Ga0495630_0071980 3300046517 Bacteria 2602
403 Ga0495630_0084527 3300046517 Unclassified 2396
404 Ga0495652_0001829 3300046529 Bacteria 22590
405 Ga0495640_0337696 3300046533 Unclassified 931
406 Ga0495586_0145543 3300046535 Bacteria 1331
407 Ga0495586_0171988 3300046535 Bacteria 1224
408 Ga0495645_0073318 3300046543 Unclassified 2466
409 Ga0495667_0002946 3300046559 Bacteria 11418
410 Ga0495634_0118005 3300046642 Bacteria 1701
411 Ga0495635_0000069 3300046663 Bacteria 63592
412 Ga0495635_0055686 3300046663 Unclassified 2724
413 Ga0495659_0007350 3300046664 Bacteria 3494
414 Ga0495623_0086957 3300046679 Unclassified 1926
415 Ga0495647_0002903 3300046681 Bacteria 5442
416 Ga0495658_0000471 3300046683 Bacteria 22293
417 Ga0495613_0005080 3300046689 Bacteria 9864
418 Ga0495600_0001463 3300046809 Bacteria 13099
419 Ga0495604_0016106 3300047317 Bacteria 5972
420 Ga0495604_0524681 3300047317 Bacteria 766
421 Ga0495674_0023499 3300047319 Bacteria 5680
422 Ga0495674_0048005 3300047319 Bacteria 3781
423 Ga0495674_0141358 3300047319 Bacteria 2023
424 Ga0495674_0570850 3300047319 Unclassified 899
425 Ga0495676_0080094 3300047321 Bacteria 2481
426 Ga0495680_0000044 3300047322 Bacteria 97068
427 Ga0495680_0001532 3300047322 Bacteria 24733
428 Ga0495675_0000366 3300047444 Bacteria 31480
429 Ga0495675_0020005 3300047444 Bacteria 4254
430 Ga0495684_0026100 3300047471 Unclassified 4491
431 Ga0495614_0018343 3300048089 Bacteria 3031
432 Ga0496102_0040957 3300048905 Bacteria 4193
433 Ga0496102_0044366 3300048905 Bacteria 4035
434 Ga0496102_0759918 3300048905 Bacteria 892
435 Ga0496104_0007618 3300048907 Bacteria 9585
436 Ga0496105_0039898 3300048908 Bacteria 3871
437 Ga0496106_0169666 3300048909 Bacteria 1729
438 Ga0496106_0221528 3300048909 Bacteria 1509
439 Ga0496108_0002260 3300048911 Bacteria 15425
440 Ga0496109_0017369 3300048912 Bacteria 6305
441 Ga0496109_0121658 3300048912 Unclassified 2432
442 Ga0496110_0001014 3300048913 Bacteria 19798
443 Ga0496112_0008799 3300048915 Bacteria 9059
444 Ga0496113_0000999 3300048916 Bacteria 15144
445 Ga0496114_0256321 3300048917 Bacteria 1540
446 Ga0501033_0014320 3300049570 Bacteria 6027
447 Ga0501034_0001936 3300049571 Bacteria 26215
448 Ga0501034_0209699 3300049571 Bacteria 1904
449 Ga0501034_0776058 3300049571 Unclassified 852
450 Ga0501043_0384825 3300049579 Bacteria 1061
451 Ga0501046_0009058 3300049580 Bacteria 8630
452 Ga0501046_0051472 3300049580 Bacteria 3249
453 Ga0501047_0022792 3300049581 Bacteria 6012
454 Ga0501070_0002689 3300049586 Bacteria 15528
455 Ga0501080_1152257 3300049742 Bacteria 668
456 Ga0501044_0060576 3300049823 Bacteria 3875
457 Ga0501044_0097268 3300049823 Bacteria 2965
458 nmdc:mga05p37_104709_c1 3300050507 Bacteria 3481
459 nmdc:mga05p37_187676_c1 3300050507 Bacteria 2513
460 nmdc:mga05p37_25306_c1 3300050507 Bacteria 7218
461 nmdc:mga05p37_518962_c1 3300050507 Unclassified 1363
462 nmdc:mga05p37_62132_c1 3300050507 Bacteria 4597
463 nmdc:mga05p37_85364_c1 3300050507 Bacteria 3890
464 nmdc:mga05p37_924490_c1 3300050507 Bacteria 937
465 nmdc:mga09592_158122_c1 3300050508 Bacteria 1957
466 nmdc:mga09592_71066_c1 3300050508 Bacteria 2954
467 nmdc:mga09592_798209_c1 3300050508 Bacteria 799
468 nmdc:mga0qj67_121163_c1 3300050509 Bacteria 2116
469 nmdc:mga0qj67_150082_c1 3300050509 Bacteria 1891
470 nmdc:mga06r32_141118_c1 3300050510 Bacteria 2386
471 nmdc:mga06r32_18928_c1 3300050510 Bacteria 6314
472 nmdc:mga06r32_565810_c1 3300050510 Bacteria 1110
473 nmdc:mga08y16_282339_c1 3300050511 Bacteria 1712
474 nmdc:mga08y16_47922_c1 3300050511 Bacteria 4473
475 nmdc:mga08y16_61190_c1 3300050511 Bacteria 3932
476 nmdc:mga0n895_115046_c1 3300050512 Bacteria 2708
477 nmdc:mga0n895_117847_c1 3300050512 Bacteria 2675
478 nmdc:mga0n895_119652_c1 3300050512 Bacteria 2654
479 nmdc:mga0n895_157724_c1 3300050512 Bacteria 2301
480 nmdc:mga0n895_47526_c1 3300050512 Bacteria 4196
481 nmdc:mga0n895_98159_c1 3300050512 Bacteria 2936
482 nmdc:mga0rr50_105075_c1 3300050513 Bacteria 2226
483 nmdc:mga0rr50_14521_c1 3300050513 Bacteria 5170
484 nmdc:mga0rr50_23827_c1 3300050513 Bacteria 4231
485 nmdc:mga0rr50_34717_c1 3300050513 Bacteria 3614
486 nmdc:mga0rr50_58211_c1 3300050513 Bacteria 2895
487 nmdc:mga0rr50_66888_c1 3300050513 Bacteria 2728
488 nmdc:mga0rr50_93016_c1 3300050513 Unclassified 2352
489 nmdc:mga0rr50_97855_c1 3300050513 Bacteria 2299
490 nmdc:mga08x19_113439_c1 3300050514 Bacteria 1810
491 nmdc:mga08x19_11576_c1 3300050514 Bacteria 5310
492 nmdc:mga08x19_1552_c1 3300050514 Bacteria 14249
493 nmdc:mga08x19_161072_c1 3300050514 Bacteria 1524
494 nmdc:mga08x19_174587_c1 3300050514 Bacteria 1465
495 nmdc:mga08x19_385234_c1 3300050514 Bacteria 982
496 nmdc:mga08x19_421967_c1 3300050514 Bacteria 937
497 nmdc:mga08x19_42410_c1 3300050514 Bacteria 2901
498 nmdc:mga08x19_72084_c1 3300050514 Bacteria 2253
499 nmdc:mga08x19_89009_c1 3300050514 Bacteria 2036
500 nmdc:mga0a205_161_c1 3300050515 Bacteria 44265
501 nmdc:mga0a205_281895_c1 3300050515 Bacteria 1537
502 nmdc:mga0a205_341270_c1 3300050515 Bacteria 1366
503 nmdc:mga0a205_3521_c1 3300050515 Bacteria 13991
504 nmdc:mga0a205_39439_c1 3300050515 Bacteria 4546
505 nmdc:mga0a205_42795_c1 3300050515 Bacteria 4365
506 nmdc:mga0a205_47188_c1 3300050515 Bacteria 4156
507 Ga0495619_0003782 3300053085 Bacteria 9735
508 Ga0495619_0293266 3300053085 Unclassified 1127
509 Ga0587111_0006492 3300060346 Bacteria 1857
510 Ga0075429_100151520
511 JGI24749J21850_1014134
512 JGI24749J21850_1034686
513 JGI25406J46586_10013756
514 Ga0065714_10067030
515 Ga0065704_10223261
516 Ga0065704_10288588
517 Ga0065712_10068399
518 Ga0065715_10000217
519 Ga0065715_10224426
520 Ga0065715_10563425
521 Ga0065707_10350939
522 Ga0070676_10006316
523 Ga0070676_10030291
524 Ga0070690_100017024
525 Ga0070690_100101083
526 Ga0070670_100011887
527 Ga0070677_10021656
528 Ga0070677_10129629
529 Ga0068869_100058804
530 Ga0068869_100087383
531 Ga0070666_10055144
532 Ga0070682_100123081
533 Ga0068868_100018780
534 Ga0070689_100020491
535 Ga0070691_10110621
536 Ga0070687_100090482
537 Ga0070661_100172045
538 Ga0070668_100038267
539 Ga0070668_100200057
540 Ga0070669_100125134
541 Ga0070669_100173129
542 Ga0070675_100037521
543 Ga0070674_100042884
544 Ga0070673_100015974
545 Ga0070673_100430249
546 Ga0070673_100772247
547 Ga0070688_100031438
548 Ga0070688_100065272
549 Ga0070659_100022907
550 Ga0070659_100866634
551 Ga0070667_100067678
552 Ga0070667_100408437
553 Ga0070703_10053199
554 Ga0070709_10020764
555 Ga0070701_10166141
556 Ga0070701_10242840
557 Ga0070705_100011395
558 Ga0070705_100014615
559 Ga0070694_100023294
560 Ga0070708_100017141
561 Ga0070708_100027203
562 Ga0070708_100176976
563 Ga0070708_100282098
564 Ga0070708_100314501
565 Ga0070708_100799411
566 Ga0070663_100370431
567 Ga0070678_100161653
568 Ga0070678_100202608
569 Ga0070662_100012508
570 Ga0070662_100528737
571 Ga0070662_100944050
572 Ga0070681_10299558
573 Ga0068867_100119365
574 Ga0070685_10051369
575 Ga0070685_10113801
576 Ga0070706_100018009
577 Ga0070706_100058332
578 Ga0070706_100278613
579 Ga0070707_100056695
580 Ga0070707_100079189
581 Ga0070707_100764714
582 Ga0070707_100795090
583 Ga0070698_100036849
584 Ga0070698_100191364
585 Ga0070698_100320237
586 Ga0070698_100398353
587 Ga0070698_100466810
588 Ga0070699_100018519
589 Ga0070699_100275207
590 Ga0070699_100310483
591 Ga0070699_100325077
592 Ga0070697_100000671
593 Ga0070697_100227597
594 Ga0070697_100307249
595 Ga0070697_100309684
596 Ga0070672_100014624
597 Ga0070672_100301625
598 Ga0070686_100025014
599 Ga0070695_100028889
600 Ga0070695_100441696
601 Ga0070696_100001746
602 Ga0070696_100321855
603 Ga0070693_100000070
604 Ga0070693_100232803
605 Ga0070693_100711867
606 Ga0070665_100009511
607 Ga0070665_100080226
608 Ga0070665_100087755
609 Ga0070665_100113521
610 Ga0070665_100166724
611 Ga0070704_100008231
612 Ga0070704_100032382
613 Ga0070704_100092900
614 Ga0068855_100198264
615 Ga0070664_100009860
616 Ga0068854_100126729
617 Ga0068852_100098719
618 Ga0068859_100121921
619 Ga0068859_100122762
620 Ga0068864_100027105
621 Ga0068864_100051750
622 Ga0068861_100034069
623 Ga0068861_100259317
624 Ga0068870_10059175
625 Ga0068863_100022294
626 Ga0068863_100023610
627 Ga0068863_100593767
628 Ga0068858_100050031
629 Ga0068858_100255486
630 Ga0068860_100040441
631 Ga0068860_100081136
632 Ga0068860_100445618
633 Ga0068862_100034326
634 Ga0068862_100613097
635 Ga0081539_10000010
636 Ga0075432_10235470
637 Ga0070716_100044001
638 Ga0070716_100515736
639 Ga0097621_100046359
640 Ga0097621_100064190
641 Ga0097621_100175470
642 Ga0097621_100183018
643 Ga0097621_100226909
644 Ga0097621_100438815
645 Ga0068871_100005904
646 Ga0068871_100036279
647 Ga0068871_100111125
648 Ga0068871_100669554
649 Ga0075428_100079272
650 Ga0075428_100102324
651 Ga0075428_101171312
652 Ga0075430_100085770
653 Ga0075431_100012034
654 Ga0075431_100199173
655 Ga0075431_100495356
656 Ga0075433_10003209
657 Ga0075433_10005635
658 Ga0075433_10010403
659 Ga0075433_10053135
660 Ga0075434_100005888
661 Ga0075434_100008297
662 Ga0075434_100011260
663 Ga0075434_100068540
664 Ga0075434_100158113
665 Ga0075434_100159391
666 Ga0075429_100130028
667 Ga0075429_100169059
668 Ga0075429_100172369
669 Ga0075429_100412710
670 Ga0075429_100458888
671 Ga0068865_100003401
672 Ga0068865_100013766
673 Ga0068865_100473479
674 Ga0068865_100730515
675 Ga0075436_100001858
676 Ga0075436_100008889
677 Ga0075436_100020714
678 Ga0075436_100150723
679 Ga0075436_100187398
680 Ga0075436_100249948
681 Ga0075436_100425476
682 Ga0097620_100121922
683 Ga0097620_100122761
684 Ga0075435_100006637
685 Ga0075435_100011923
686 Ga0075435_100030367
687 Ga0075435_100032642
688 Ga0075435_100043026
689 Ga0075435_100102481
690 Ga0075435_100354719
691 Ga0099794_10014958
692 Ga0099794_10018141
693 Ga0099794_10079020
694 Ga0105250_10168189
695 Ga0105240_10237831
696 Ga0111539_10026686
697 Ga0111539_10048302
698 Ga0111539_10151220
699 Ga0111539_10153604
700 Ga0105245_10033791
701 Ga0105245_10091033
702 Ga0105245_10314958
703 Ga0105247_10505343
704 Ga0114129_10028393
705 Ga0114129_10030204
706 Ga0114129_10062473
707 Ga0114129_10129575
708 Ga0114129_10159577
709 Ga0114129_10445707
710 Ga0114129_10834208
711 Ga0114129_10872039
712 Ga0114129_10961677
713 Ga0105243_10050204
714 Ga0105243_10196054
715 Ga0105241_10309912
716 Ga0105242_10032681
717 Ga0105242_10110368
718 Ga0105242_10249879
719 Ga0105248_10002426
720 Ga0105248_10104474
721 Ga0105248_10177476
722 Ga0105248_10409564
723 Ga0105248_10843108
724 Ga0105248_11370868
725 Ga0105237_10007820
726 Ga0105238_10298845
727 Ga0105249_10005227
728 Ga0105249_10075534
729 Ga0105249_10284527
730 Ga0105249_10835401
731 Ga0105249_11153789
732 Ga0099796_10230788
733 Ga0105239_10336328
734 Ga0157374_10183472
735 Ga0157378_10877231
736 Ga0157378_11475601
737 Ga0163162_10010669
738 Ga0163162_10118177
739 Ga0163162_10123668
740 Ga0163162_10430987
741 Ga0163162_10469701
742 Ga0157372_10548419
743 Ga0157375_10040280
744 Ga0157375_10183780
745 Ga0157375_10790137
746 Ga0163163_10099300
747 Ga0157380_10075881
748 Ga0157380_10188425
749 Ga0157380_10784448
750 Ga0157377_10015522
751 Ga0157379_10370026
752 Ga0157379_10906062
753 Ga0157376_10004354
754 Ga0157376_10031349
755 Ga0157376_10560707
756 Ga0157376_10631873
757 Ga0157376_10671372
758 Ga0163161_10158102
759 Ga0206356_11270007
760 Ga0213872_10001072
761 Ga0213876_10025743
762 Ga0224712_10239706
763 Ga0224572_1010248
764 Ga0228598_1009860
765 Ga0207697_10112345
766 Ga0207653_10003016
767 Ga0207682_10002915
768 Ga0207710_10095441
769 Ga0207688_10006975
770 Ga0207680_10178848
771 Ga0207699_10396661
772 Ga0207645_10012718
773 Ga0207643_10022056
774 Ga0207684_10018022
775 Ga0207684_10078920
776 Ga0207707_10157218
777 Ga0207695_10133539
778 Ga0207695_10315556
779 Ga0207671_10225841
780 Ga0207660_10412624
781 Ga0207662_10001974
782 Ga0207649_10501458
783 Ga0207646_10000005
784 Ga0207646_10240496
785 Ga0207646_10775055
786 Ga0207681_10227709
787 Ga0207681_10423728
788 Ga0207694_10383639
789 Ga0207650_10003815
790 Ga0207659_10040309
791 Ga0207687_10012986
792 Ga0207687_10333530
793 Ga0207644_10122799
794 Ga0207644_10252967
795 Ga0207706_10017068
796 Ga0207706_10043603
797 Ga0207686_10018772
798 Ga0207686_10096501
799 Ga0207686_10401136
800 Ga0207709_10220021
801 Ga0207670_10059918
802 Ga0207669_10081323
803 Ga0207704_10033489
804 Ga0207704_10059859
805 Ga0207704_10100542
806 Ga0207704_10610291
807 Ga0207665_10008672
808 Ga0207691_10010467
809 Ga0207691_10031364
810 Ga0207691_10304109
811 Ga0207711_10155122
812 Ga0207711_10339351
813 Ga0207711_10596631
814 Ga0207689_10002575
815 Ga0207679_10024682
816 Ga0207667_10155766
817 Ga0207651_10009309
818 Ga0207651_10313338
819 Ga0207712_10098589
820 Ga0207712_10107147
821 Ga0207712_10619234
822 Ga0207668_10424913
823 Ga0207668_10642146
824 Ga0207668_11078641
825 Ga0207658_10947324
826 Ga0207677_10059926
827 Ga0207677_10067722
828 Ga0207703_10220411
829 Ga0207678_10114023
830 Ga0207641_10009460
831 Ga0207641_10015591
832 Ga0207641_10308889
833 Ga0207648_10016241
834 Ga0207676_10008185
835 Ga0207675_100031483
836 Ga0207675_100326474
837 Ga0207683_10078682
838 Ga0207683_10158924
839 Ga0207683_10244973
840 Ga0209588_1006633
841 Ga0209588_1040120
842 Ga0207428_10013895
843 Ga0207428_10061336
844 Ga0207428_10216112
845 Ga0207428_10277567
846 Ga0207428_10624804
847 Ga0265354_1000140
848 Ga0265354_1000496
849 Ga0265357_1012037
850 Ga0268266_10017882
851 Ga0268266_10070943
852 Ga0268266_10143270
853 Ga0268266_10177178
854 Ga0268265_10034851
855 Ga0268265_10161262
856 Ga0268265_10413711
857 Ga0268264_10089418
858 Ga0268264_10217155
859 Ga0265770_1000351
860 Ga0265760_10001580
861 Ga0265760_10006711
862 Ga0265340_10198052
863 Ga0265316_10000902
864 Ga0307410_10950104
865 Ga0307416_100838162
866 Ga0307414_10927298
867 Ga0373950_0005575
868 Ga0373959_0002979
869 Ga0373938_0002531
870 Ga0373929_0005770
871 Ga0373940_0142924
872 Ga0373949_0008488
873 Ga0373949_0017957
874 Ga0373951_0003102
875 Ga0373952_0051754
876 Ga0373932_0015060
877 Ga0373939_0003089
878 Ga0373939_0079737
879 Ga0373954_0009191
880 Ga0373960_0001999
881 Ga0373955_0058105
882 Ga0373942_0017342
883 Ga0373961_0004367
884 Ga0373962_0024027
885 Ga0373962_0033932
886 Ga0373931_0012497
887 Ga0373935_0474048
888 Ga0373927_0054205
889 Ga0373927_0251937
890 Ga0373947_0509251
891 Ga0373937_0045218
892 Ga0373937_0402316
893 Ga0436365_1505847
894 Ga0451800_1099319
895 Ga0451576_0039792
896 Ga0495592_0007872
897 Ga0495629_0000018
898 Ga0495651_0002472
899 Ga0495653_0011358
900 Ga0495580_0035396
901 Ga0495580_0082018
902 Ga0495580_0099393
903 Ga0495582_0001254
904 Ga0495639_0007935
905 Ga0495662_0031784
906 Ga0495664_0051732
907 Ga0495594_0000960
908 Ga0495608_0014065
909 Ga0495618_0010301
910 Ga0495628_0001354
911 Ga0495630_0071980
912 Ga0495630_0084527
913 Ga0495652_0001829
914 Ga0495640_0337696
915 Ga0495586_0145543
916 Ga0495586_0171988
917 Ga0495645_0073318
918 Ga0495667_0002946
919 Ga0495634_0118005
920 Ga0495635_0000069
921 Ga0495635_0055686
922 Ga0495659_0007350
923 Ga0495623_0086957
924 Ga0495647_0002903
925 Ga0495658_0000471
926 Ga0495613_0005080
927 Ga0495600_0001463
928 Ga0495604_0016106
929 Ga0495604_0524681
930 Ga0495674_0023499
931 Ga0495674_0048005
932 Ga0495674_0141358
933 Ga0495674_0570850
934 Ga0495676_0080094
935 Ga0495680_0000044
936 Ga0495680_0001532
937 Ga0495675_0000366
938 Ga0495675_0020005
939 Ga0495684_0026100
940 Ga0495614_0018343
941 Ga0496102_0040957
942 Ga0496102_0044366
943 Ga0496102_0759918
944 Ga0496104_0007618
945 Ga0496105_0039898
946 Ga0496106_0169666
947 Ga0496106_0221528
948 Ga0496108_0002260
949 Ga0496109_0017369
950 Ga0496109_0121658
951 Ga0496110_0001014
952 Ga0496112_0008799
953 Ga0496113_0000999
954 Ga0496114_0256321
955 Ga0501033_0014320
956 Ga0501034_0001936
957 Ga0501034_0209699
958 Ga0501034_0776058
959 Ga0501043_0384825
960 Ga0501046_0009058
961 Ga0501046_0051472
962 Ga0501047_0022792
963 Ga0501070_0002689
964 Ga0501080_1152257
965 Ga0501044_0060576
966 Ga0501044_0097268
967 nmdc:mga05p37_104709_c1
968 nmdc:mga05p37_187676_c1
969 nmdc:mga05p37_25306_c1
970 nmdc:mga05p37_518962_c1
971 nmdc:mga05p37_62132_c1
972 nmdc:mga05p37_85364_c1
973 nmdc:mga05p37_924490_c1
974 nmdc:mga09592_158122_c1
975 nmdc:mga09592_71066_c1
976 nmdc:mga09592_798209_c1
977 nmdc:mga0qj67_121163_c1
978 nmdc:mga0qj67_150082_c1
979 nmdc:mga06r32_141118_c1
980 nmdc:mga06r32_18928_c1
981 nmdc:mga06r32_565810_c1
982 nmdc:mga08y16_282339_c1
983 nmdc:mga08y16_47922_c1
984 nmdc:mga08y16_61190_c1
985 nmdc:mga0n895_115046_c1
986 nmdc:mga0n895_117847_c1
987 nmdc:mga0n895_119652_c1
988 nmdc:mga0n895_157724_c1
989 nmdc:mga0n895_47526_c1
990 nmdc:mga0n895_98159_c1
991 nmdc:mga0rr50_105075_c1
992 nmdc:mga0rr50_14521_c1
993 nmdc:mga0rr50_23827_c1
994 nmdc:mga0rr50_34717_c1
995 nmdc:mga0rr50_58211_c1
996 nmdc:mga0rr50_66888_c1
997 nmdc:mga0rr50_93016_c1
998 nmdc:mga0rr50_97855_c1
999 nmdc:mga08x19_113439_c1
1000 nmdc:mga08x19_11576_c1
1001 nmdc:mga08x19_1552_c1
1002 nmdc:mga08x19_161072_c1
1003 nmdc:mga08x19_174587_c1
1004 nmdc:mga08x19_385234_c1
1005 nmdc:mga08x19_421967_c1
1006 nmdc:mga08x19_42410_c1
1007 nmdc:mga08x19_72084_c1
1008 nmdc:mga08x19_89009_c1
1009 nmdc:mga0a205_161_c1
1010 nmdc:mga0a205_281895_c1
1011 nmdc:mga0a205_341270_c1
1012 nmdc:mga0a205_3521_c1
1013 nmdc:mga0a205_39439_c1
1014 nmdc:mga0a205_42795_c1
1015 nmdc:mga0a205_47188_c1
1016 Ga0495619_0003782
1017 Ga0495619_0293266
1018 Ga0587111_0006492

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

90

235

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lkp-assembly1.cif.gz_F-2 crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77 0.9332 36 191
8ff9-assembly1.cif.gz_B crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) 0.9244 37 186
2bjy-assembly1.cif.gz_L the x-ray crystal structure of listeria innocua dps h31g-h43g mutant. 0.9243 47 183
2bkc-assembly1.cif.gz_A the x-ray structure of the h43g listeria innocua dps mutant 0.9232 47 183
2bkc-assembly1.cif.gz_H the x-ray structure of the h43g listeria innocua dps mutant 0.9221 47 186
ID Description Score Start End Superfamily
2c41C01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9266 42 186 1.20.1260.10
1qghA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9201 47 183 1.20.1260.10
6hv1D00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9187 47 186 1.20.1260.10
1mojA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9178 42 196 1.20.1260.10
2bk6C00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9178 47 186 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A4U7EUU8-F1-model_v4 DNA starvation/stationary phase protection protein 0.9544 39 186 GO:0008199
AF-A0A537Z9P4-F1-model_v4 DNA starvation/stationary phase protection protein 0.9402 37 195 GO:0008199
GO:0016722
AF-A0A395JLR1-F1-model_v4 Starvation-inducible DNA-binding protein 0.9387 37 186 GO:0003677
GO:0008199
GO:0016722
AF-I0W7Q8-F1-model_v4 Ferritin Dps family protein 0.9377 33 190 GO:0008199
AF-A0A660MWD4-F1-model_v4 DNA starvation/stationary phase protection protein 0.9375 44 186 GO:0008199

Map